Query         psy9785
Match_columns 63
No_of_seqs    103 out of 236
Neff          4.5 
Searched_HMMs 46136
Date          Fri Aug 16 19:31:33 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9785.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9785hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0696|consensus               99.6 1.3E-16 2.7E-21  124.1   0.2   50   14-63     18-67  (683)
  2 KOG0694|consensus               99.1 1.9E-11 4.2E-16   97.2   2.1   41   23-63    140-180 (694)
  3 KOG0695|consensus               98.9 2.1E-10 4.6E-15   88.4  -1.5   41   23-63    112-152 (593)
  4 PF00130 C1_1:  Phorbol esters/  97.7 2.5E-05 5.5E-10   42.7   2.4   22   42-63      1-22  (53)
  5 smart00109 C1 Protein kinase C  97.3 0.00012 2.7E-09   38.3   1.7   22   42-63      1-22  (49)
  6 cd00029 C1 Protein kinase C co  97.3 9.1E-05   2E-09   39.3   1.1   22   42-63      1-22  (50)
  7 KOG4236|consensus               94.0   0.011 2.3E-07   48.5  -0.8   27   37-63    141-167 (888)
  8 KOG0696|consensus               92.6    0.03 6.5E-07   44.8  -0.3   24   40-63    109-132 (683)
  9 KOG0694|consensus               85.1    0.23   5E-06   40.6  -0.4   24   40-63    229-252 (694)
 10 KOG1011|consensus               79.9    0.64 1.4E-05   39.2   0.3   28   36-63    164-194 (1283)
 11 KOG4239|consensus               68.3     1.5 3.2E-05   33.5  -0.3   28   36-63     46-73  (348)
 12 KOG4236|consensus               60.7     1.7 3.8E-05   36.0  -1.2   23   40-62    266-288 (888)
 13 COG4306 Uncharacterized protei  54.4     6.1 0.00013   27.1   0.8   26   38-63     54-80  (160)
 14 PF02148 zf-UBP:  Zn-finger in   50.3     9.8 0.00021   21.3   1.1   27   37-63     34-60  (63)
 15 TIGR03831 YgiT_finger YgiT-typ  50.1      19 0.00042   18.2   2.2   24   37-62     18-42  (46)
 16 PF14392 zf-CCHC_4:  Zinc knuck  39.5      25 0.00055   18.9   1.7   15   46-60     25-39  (49)
 17 PF07503 zf-HYPF:  HypF finger;  38.7      16 0.00034   19.1   0.7   17   47-63     16-32  (35)
 18 COG3627 PhnJ Uncharacterized e  36.8      23  0.0005   26.2   1.6   31   28-60    210-251 (291)
 19 KOG2996|consensus               35.2      11 0.00024   31.5  -0.3   25   38-62    520-544 (865)
 20 PF06007 PhnJ:  Phosphonate met  34.9      22 0.00048   26.5   1.2   31   28-60    202-243 (277)
 21 PF06220 zf-U1:  U1 zinc finger  31.7      21 0.00046   18.7   0.5   10   53-62      4-13  (38)
 22 KOG0190|consensus               30.5      21 0.00046   28.3   0.6   23   38-61     38-60  (493)
 23 KOG3564|consensus               28.3      13 0.00028   30.3  -1.0   22   41-62    286-307 (604)
 24 KOG3362|consensus               26.3      26 0.00057   24.1   0.4   10   50-59    116-125 (156)
 25 KOG4684|consensus               24.6      29 0.00062   25.7   0.3   10   54-63    172-182 (275)
 26 PF09788 Tmemb_55A:  Transmembr  24.1      34 0.00074   25.2   0.6   11   53-63    158-169 (256)
 27 PRK11582 flagella biosynthesis  23.1      32  0.0007   24.0   0.3   13   50-62     20-32  (169)
 28 PF06463 Mob_synth_C:  Molybden  22.9      33 0.00071   21.9   0.3   26   34-60     49-77  (128)
 29 TIGR03823 FliZ flagellar regul  22.4      32  0.0007   24.0   0.2   13   50-62     20-32  (168)
 30 PF13248 zf-ribbon_3:  zinc-rib  22.2      34 0.00074   16.2   0.2    9   52-60     16-24  (26)
 31 PF10083 DUF2321:  Uncharacteri  21.9      53  0.0011   22.7   1.2   14   47-60     63-76  (158)
 32 PF04828 GFA:  Glutathione-depe  20.2      30 0.00065   19.3  -0.2   13   51-63     47-59  (92)

No 1  
>KOG0696|consensus
Probab=99.60  E-value=1.3e-16  Score=124.09  Aligned_cols=50  Identities=64%  Similarity=1.091  Sum_probs=44.7

Q ss_pred             CccccccccccccccchhhhcceeecCCceeeeeecCCccccCCCCCccC
Q psy9785          14 NDMNTKFGLKIRGRKGALKKKNVYNVKDHKFIPRFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        14 ~~~~~~~~~~~~~RrgA~r~kKVh~v~GH~F~a~~f~qptfCa~C~efIW   63 (63)
                      ++.+....+..+.|+||+|++.||+|++|+|.++||+|||||+||.||||
T Consensus        18 ~e~~~~~~~~~f~RkGAlrqKnvhevk~HkF~aRFFKqPTfCsHCkDFiw   67 (683)
T KOG0696|consen   18 GESEGENSMKRFLRKGALRQKNVHEVKSHKFIARFFKQPTFCSHCKDFIW   67 (683)
T ss_pred             CcccchhHHHHHHhhhhhhhcchhhhccceeeehhccCCchhhhhhhhee
Confidence            44455556667789999999999999999999999999999999999999


No 2  
>KOG0694|consensus
Probab=99.13  E-value=1.9e-11  Score=97.16  Aligned_cols=41  Identities=41%  Similarity=0.883  Sum_probs=37.6

Q ss_pred             ccccccchhhhcceeecCCceeeeeecCCccccCCCCCccC
Q psy9785          23 KIRGRKGALKKKNVYNVKDHKFIPRFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        23 ~~~~RrgA~r~kKVh~v~GH~F~a~~f~qptfCa~C~efIW   63 (63)
                      ....|+||+.++|||+|.||+|++++|+|||+|++|++|||
T Consensus       140 ~~~~rrga~~~~kVhei~gH~F~aT~l~Qpt~Cs~C~kFi~  180 (694)
T KOG0694|consen  140 SKPRRRGAISQSKVHEIDGHKFGATSLRQPTFCSWCQKFIW  180 (694)
T ss_pred             cCcccccccccceeEEeeCcEEEEeeccCcchhhhhhhhee
Confidence            34458889888999999999999999999999999999999


No 3  
>KOG0695|consensus
Probab=98.86  E-value=2.1e-10  Score=88.36  Aligned_cols=41  Identities=32%  Similarity=0.705  Sum_probs=39.0

Q ss_pred             ccccccchhhhcceeecCCceeeeeecCCccccCCCCCccC
Q psy9785          23 KIRGRKGALKKKNVYNVKDHKFIPRFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        23 ~~~~RrgA~r~kKVh~v~GH~F~a~~f~qptfCa~C~efIW   63 (63)
                      ....||||+||+|+|..|||.|.++.|+++++|..|.|.||
T Consensus       112 ksiyrrgarrwrkly~~ngh~fqakr~nrr~~c~ic~d~iw  152 (593)
T KOG0695|consen  112 KSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGICSDRIW  152 (593)
T ss_pred             chHHHhHHHHHHHHHhhcCcchhhhhhccceeeeechhhhh
Confidence            35679999999999999999999999999999999999999


No 4  
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=97.74  E-value=2.5e-05  Score=42.66  Aligned_cols=22  Identities=50%  Similarity=1.389  Sum_probs=19.4

Q ss_pred             ceeeeeecCCccccCCCCCccC
Q psy9785          42 HKFIPRFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        42 H~F~a~~f~qptfCa~C~efIW   63 (63)
                      |.|+.+.|.+|++|++|+++||
T Consensus         1 H~f~~~~~~~~~~C~~C~~~i~   22 (53)
T PF00130_consen    1 HHFVPTTFSKPTYCDVCGKFIW   22 (53)
T ss_dssp             -EEEEEESSSTEB-TTSSSBEC
T ss_pred             CeEEEccCCCCCCCcccCcccC
Confidence            8999999999999999999997


No 5  
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=97.34  E-value=0.00012  Score=38.34  Aligned_cols=22  Identities=50%  Similarity=1.164  Sum_probs=20.8

Q ss_pred             ceeeeeecCCccccCCCCCccC
Q psy9785          42 HKFIPRFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        42 H~F~a~~f~qptfCa~C~efIW   63 (63)
                      |.|+...+.+|++|.+|+++||
T Consensus         1 H~~~~~~~~~~~~C~~C~~~i~   22 (49)
T smart00109        1 HHFVERTFKKPTKCCVCRKSIW   22 (49)
T ss_pred             CceEEeccCCCCCccccccccC
Confidence            7899999999999999999998


No 6  
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=97.33  E-value=9.1e-05  Score=39.32  Aligned_cols=22  Identities=45%  Similarity=1.213  Sum_probs=21.0

Q ss_pred             ceeeeeecCCccccCCCCCccC
Q psy9785          42 HKFIPRFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        42 H~F~a~~f~qptfCa~C~efIW   63 (63)
                      |.|+...+.+|++|++|.++||
T Consensus         1 H~f~~~~~~~~~~C~~C~~~i~   22 (50)
T cd00029           1 HRFVRKSFFKPTFCDVCRKSIW   22 (50)
T ss_pred             CccEEeeCCCCCChhhcchhhh
Confidence            8899999999999999999998


No 7  
>KOG4236|consensus
Probab=94.02  E-value=0.011  Score=48.46  Aligned_cols=27  Identities=26%  Similarity=0.915  Sum_probs=24.0

Q ss_pred             eecCCceeeeeecCCccccCCCCCccC
Q psy9785          37 YNVKDHKFIPRFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        37 h~v~GH~F~a~~f~qptfCa~C~efIW   63 (63)
                      ..|.-|.+-.+-++.||||++|+|.+|
T Consensus       141 ~~i~PH~l~vhSY~~PtFCD~CGEmL~  167 (888)
T KOG4236|consen  141 FQIRPHTLFVHSYKAPTFCDFCGEMLF  167 (888)
T ss_pred             eeeecceeeeecccCchHHHHHHHHHH
Confidence            356789999999999999999999887


No 8  
>KOG0696|consensus
Probab=92.59  E-value=0.03  Score=44.83  Aligned_cols=24  Identities=38%  Similarity=0.982  Sum_probs=20.8

Q ss_pred             CCceeeeeecCCccccCCCCCccC
Q psy9785          40 KDHKFIPRFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        40 ~GH~F~a~~f~qptfCa~C~efIW   63 (63)
                      .-|+|..+.+..||||+||+.+++
T Consensus       109 ~kHkf~~~tYssPTFCDhCGsLLy  132 (683)
T KOG0696|consen  109 SKHKFKIHTYSSPTFCDHCGSLLY  132 (683)
T ss_pred             cccceeeeecCCCchhhhHHHHHH
Confidence            349999999999999999998653


No 9  
>KOG0694|consensus
Probab=85.15  E-value=0.23  Score=40.63  Aligned_cols=24  Identities=33%  Similarity=0.913  Sum_probs=21.9

Q ss_pred             CCceeeeeecCCccccCCCCCccC
Q psy9785          40 KDHKFIPRFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        40 ~GH~F~a~~f~qptfCa~C~efIW   63 (63)
                      +.|.|..+...+|+||.||+.++|
T Consensus       229 ~Phrf~~~~~q~ptFc~hCGs~L~  252 (694)
T KOG0694|consen  229 NPHRFVKLNRQRPTFCDHCGSVLY  252 (694)
T ss_pred             CCCcchhhhccCccHHHhcchhhh
Confidence            349999999999999999999876


No 10 
>KOG1011|consensus
Probab=79.90  E-value=0.64  Score=39.20  Aligned_cols=28  Identities=36%  Similarity=1.077  Sum_probs=24.8

Q ss_pred             eeec---CCceeeeeecCCccccCCCCCccC
Q psy9785          36 VYNV---KDHKFIPRFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        36 Vh~v---~GH~F~a~~f~qptfCa~C~efIW   63 (63)
                      +|.|   ..|.|....|..||||.-|...+|
T Consensus       164 iypis~ttphnf~~~t~~tpt~cyecegllw  194 (1283)
T KOG1011|consen  164 IYPISATTPHNFATTTFQTPTFCYECEGLLW  194 (1283)
T ss_pred             eeecccCCCCceeeeeccCCchhhhhhhHHH
Confidence            5555   469999999999999999999998


No 11 
>KOG4239|consensus
Probab=68.33  E-value=1.5  Score=33.51  Aligned_cols=28  Identities=36%  Similarity=0.912  Sum_probs=24.8

Q ss_pred             eeecCCceeeeeecCCccccCCCCCccC
Q psy9785          36 VYNVKDHKFIPRFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        36 Vh~v~GH~F~a~~f~qptfCa~C~efIW   63 (63)
                      +...+||.|-.....-|+-|+-|+||||
T Consensus        46 lv~~r~~~~~~~g~~~~~~~~~c~~~~~   73 (348)
T KOG4239|consen   46 LVPLRGHNFYTAGLLLPTWCDKCGDFIW   73 (348)
T ss_pred             eeeccccccccccccccccchhhhHHHH
Confidence            3445899999999999999999999998


No 12 
>KOG4236|consensus
Probab=60.66  E-value=1.7  Score=36.02  Aligned_cols=23  Identities=35%  Similarity=0.827  Sum_probs=20.3

Q ss_pred             CCceeeeeecCCccccCCCCCcc
Q psy9785          40 KDHKFIPRFFKQPTFCSHCKDFI   62 (63)
Q Consensus        40 ~GH~F~a~~f~qptfCa~C~efI   62 (63)
                      --|.|+.+-+++||-|.+|+..+
T Consensus       266 vPHTf~vHSY~rpTVCq~CkkLL  288 (888)
T KOG4236|consen  266 VPHTFIVHSYTRPTVCQYCKKLL  288 (888)
T ss_pred             CCeeEEEeeccCchHHHHHHHHH
Confidence            36999999999999999998653


No 13 
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=54.41  E-value=6.1  Score=27.05  Aligned_cols=26  Identities=27%  Similarity=0.691  Sum_probs=17.2

Q ss_pred             ecCCceeeeeecCCccccCCCCC-ccC
Q psy9785          38 NVKDHKFIPRFFKQPTFCSHCKD-FIW   63 (63)
Q Consensus        38 ~v~GH~F~a~~f~qptfCa~C~e-fIW   63 (63)
                      .|.|=.-.-.-+..|+||..|+. |-|
T Consensus        54 ~vegvlglg~dye~psfchncgs~fpw   80 (160)
T COG4306          54 YVEGVLGLGGDYEPPSFCHNCGSRFPW   80 (160)
T ss_pred             eeeeeeccCCCCCCcchhhcCCCCCCc
Confidence            34443334455678999999998 445


No 14 
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=50.35  E-value=9.8  Score=21.34  Aligned_cols=27  Identities=19%  Similarity=0.630  Sum_probs=21.1

Q ss_pred             eecCCceeeeeecCCccccCCCCCccC
Q psy9785          37 YNVKDHKFIPRFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        37 h~v~GH~F~a~~f~qptfCa~C~efIW   63 (63)
                      ++..||.+....=..-.+|..|.++|.
T Consensus        34 ~~~~~H~l~v~~~~~~i~C~~C~~~v~   60 (63)
T PF02148_consen   34 YKETGHPLAVSLSTGSIWCYACDDYVY   60 (63)
T ss_dssp             HHHHT--EEEETTTTCEEETTTTEEEE
T ss_pred             hcccCCeEEEECCCCeEEEcCCCcEEe
Confidence            356799999988888899999999873


No 15 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=50.12  E-value=19  Score=18.16  Aligned_cols=24  Identities=17%  Similarity=0.469  Sum_probs=16.9

Q ss_pred             eecCCceeeeeecCCcc-ccCCCCCcc
Q psy9785          37 YNVKDHKFIPRFFKQPT-FCSHCKDFI   62 (63)
Q Consensus        37 h~v~GH~F~a~~f~qpt-fCa~C~efI   62 (63)
                      ....|+..+.+.+  |. +|..|++.+
T Consensus        18 ~~~~~~~~~i~~v--p~~~C~~CGE~~   42 (46)
T TIGR03831        18 YEYGGELIVIENV--PALVCPQCGEEY   42 (46)
T ss_pred             EEeCCEEEEEeCC--CccccccCCCEe
Confidence            3456777766665  54 699999865


No 16 
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=39.52  E-value=25  Score=18.88  Aligned_cols=15  Identities=33%  Similarity=0.941  Sum_probs=12.1

Q ss_pred             eeecCCccccCCCCC
Q psy9785          46 PRFFKQPTFCSHCKD   60 (63)
Q Consensus        46 a~~f~qptfCa~C~e   60 (63)
                      .++=+.|.||.+|+-
T Consensus        25 v~YE~lp~~C~~C~~   39 (49)
T PF14392_consen   25 VKYERLPRFCFHCGR   39 (49)
T ss_pred             EEECCcChhhcCCCC
Confidence            356688999999985


No 17 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=38.66  E-value=16  Score=19.07  Aligned_cols=17  Identities=29%  Similarity=0.426  Sum_probs=9.9

Q ss_pred             eecCCccccCCCCCccC
Q psy9785          47 RFFKQPTFCSHCKDFIW   63 (63)
Q Consensus        47 ~~f~qptfCa~C~efIW   63 (63)
                      +|..|++-|.+|+=.+|
T Consensus        16 R~~~~~isC~~CGPr~~   32 (35)
T PF07503_consen   16 RFHYQFISCTNCGPRYS   32 (35)
T ss_dssp             TTT-TT--BTTCC-SCC
T ss_pred             cccCcCccCCCCCCCEE
Confidence            56679999999986554


No 18 
>COG3627 PhnJ Uncharacterized enzyme of phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=36.80  E-value=23  Score=26.18  Aligned_cols=31  Identities=35%  Similarity=0.749  Sum_probs=23.5

Q ss_pred             cchhhhcceeec-----------CCceeeeeecCCccccCCCCC
Q psy9785          28 KGALKKKNVYNV-----------KDHKFIPRFFKQPTFCSHCKD   60 (63)
Q Consensus        28 rgA~r~kKVh~v-----------~GH~F~a~~f~qptfCa~C~e   60 (63)
                      -||.|.+++|-+           ..|-|-...+..|  |+.|+.
T Consensus       210 fGAGREKRiYAvPP~T~V~SLDF~DHPFevq~wd~~--CalCgs  251 (291)
T COG3627         210 FGAGREKRIYAVPPFTRVESLDFDDHPFEVQQWDEP--CALCGS  251 (291)
T ss_pred             hcCCcceeeEecCCcceeeecccCCCcceeeecccc--hhhhCc
Confidence            377888888866           3588888888665  888875


No 19 
>KOG2996|consensus
Probab=35.22  E-value=11  Score=31.50  Aligned_cols=25  Identities=28%  Similarity=0.615  Sum_probs=21.8

Q ss_pred             ecCCceeeeeecCCccccCCCCCcc
Q psy9785          38 NVKDHKFIPRFFKQPTFCSHCKDFI   62 (63)
Q Consensus        38 ~v~GH~F~a~~f~qptfCa~C~efI   62 (63)
                      ..++|.|.-+.|..+|-|..|.-++
T Consensus       520 ~an~H~fqmhtF~~~tsCkvC~mll  544 (865)
T KOG2996|consen  520 RANNHDFQMHTFKNTTSCKVCQMLL  544 (865)
T ss_pred             cccCcceEEEeccCCcchHHHHHHh
Confidence            4589999999999999999997654


No 20 
>PF06007 PhnJ:  Phosphonate metabolism protein PhnJ;  InterPro: IPR010306 This family consists of several bacterial phosphonate metabolism (PhnJ) sequences. The exact role that PhnJ plays in phosphonate utilisation is unknown.; GO: 0042916 alkylphosphonate transport
Probab=34.89  E-value=22  Score=26.48  Aligned_cols=31  Identities=32%  Similarity=0.547  Sum_probs=23.0

Q ss_pred             cchhhhcceeecCC-----------ceeeeeecCCccccCCCCC
Q psy9785          28 KGALKKKNVYNVKD-----------HKFIPRFFKQPTFCSHCKD   60 (63)
Q Consensus        28 rgA~r~kKVh~v~G-----------H~F~a~~f~qptfCa~C~e   60 (63)
                      =||.|.+|+|-|+-           |-|....|..  .|+.|+.
T Consensus       202 fGAGREkrIYAvPPyT~V~sL~FeD~pF~~e~~~~--~C~~CGs  243 (277)
T PF06007_consen  202 FGAGREKRIYAVPPYTDVESLDFEDHPFEVERFDG--PCALCGS  243 (277)
T ss_pred             hcCCcceeeeecCCCccccccCccCCCCccccccC--cccccCC
Confidence            48889999997754           5566666655  7999974


No 21 
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=31.68  E-value=21  Score=18.65  Aligned_cols=10  Identities=30%  Similarity=1.202  Sum_probs=4.4

Q ss_pred             cccCCCCCcc
Q psy9785          53 TFCSHCKDFI   62 (63)
Q Consensus        53 tfCa~C~efI   62 (63)
                      -||.+|.-+|
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            4899998765


No 22 
>KOG0190|consensus
Probab=30.52  E-value=21  Score=28.32  Aligned_cols=23  Identities=35%  Similarity=0.924  Sum_probs=18.6

Q ss_pred             ecCCceeeeeecCCccccCCCCCc
Q psy9785          38 NVKDHKFIPRFFKQPTFCSHCKDF   61 (63)
Q Consensus        38 ~v~GH~F~a~~f~qptfCa~C~ef   61 (63)
                      .|.||.|+---|..| .|.||+..
T Consensus        38 ~i~~~~~vlVeFYAP-WCghck~L   60 (493)
T KOG0190|consen   38 TINGHEFVLVEFYAP-WCGHCKAL   60 (493)
T ss_pred             HhccCceEEEEEEch-hhhhhhhh
Confidence            357999997777788 99999853


No 23 
>KOG3564|consensus
Probab=28.27  E-value=13  Score=30.26  Aligned_cols=22  Identities=32%  Similarity=0.591  Sum_probs=20.2

Q ss_pred             CceeeeeecCCccccCCCCCcc
Q psy9785          41 DHKFIPRFFKQPTFCSHCKDFI   62 (63)
Q Consensus        41 GH~F~a~~f~qptfCa~C~efI   62 (63)
                      -|.|+.+.+..|-+|-+|+..|
T Consensus       286 ~htfi~kt~~~~~~Cv~C~krI  307 (604)
T KOG3564|consen  286 LHTFISKTVIKPENCVPCGKRI  307 (604)
T ss_pred             cchhhHhhccCcccchhhhhhh
Confidence            4999999999999999999866


No 24 
>KOG3362|consensus
Probab=26.33  E-value=26  Score=24.15  Aligned_cols=10  Identities=30%  Similarity=0.833  Sum_probs=8.1

Q ss_pred             CCccccCCCC
Q psy9785          50 KQPTFCSHCK   59 (63)
Q Consensus        50 ~qptfCa~C~   59 (63)
                      -+.+||+.|+
T Consensus       116 P~r~fCaVCG  125 (156)
T KOG3362|consen  116 PLRKFCAVCG  125 (156)
T ss_pred             CcchhhhhcC
Confidence            3568999998


No 25 
>KOG4684|consensus
Probab=24.55  E-value=29  Score=25.68  Aligned_cols=10  Identities=40%  Similarity=1.431  Sum_probs=7.2

Q ss_pred             ccCCCCC-ccC
Q psy9785          54 FCSHCKD-FIW   63 (63)
Q Consensus        54 fCa~C~e-fIW   63 (63)
                      -|.||+| |+|
T Consensus       172 ~CgHC~~tFLf  182 (275)
T KOG4684|consen  172 KCGHCNETFLF  182 (275)
T ss_pred             EecCccceeeh
Confidence            5788887 665


No 26 
>PF09788 Tmemb_55A:  Transmembrane protein 55A;  InterPro: IPR019178  Members of this family catalyse the hydrolysis of the 4-position phosphate of phosphatidylinositol 4,5-bisphosphate, in the reaction:  1-phosphatidyl-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate + phosphate.  
Probab=24.15  E-value=34  Score=25.22  Aligned_cols=11  Identities=36%  Similarity=1.395  Sum_probs=7.7

Q ss_pred             cccCCCCC-ccC
Q psy9785          53 TFCSHCKD-FIW   63 (63)
Q Consensus        53 tfCa~C~e-fIW   63 (63)
                      .-|+||.+ |+|
T Consensus       158 v~CghC~~~Fl~  169 (256)
T PF09788_consen  158 VICGHCSNTFLF  169 (256)
T ss_pred             EECCCCCCcEec
Confidence            36888877 666


No 27 
>PRK11582 flagella biosynthesis protein FliZ; Provisional
Probab=23.12  E-value=32  Score=24.00  Aligned_cols=13  Identities=31%  Similarity=1.053  Sum_probs=10.3

Q ss_pred             CCccccCCCCCcc
Q psy9785          50 KQPTFCSHCKDFI   62 (63)
Q Consensus        50 ~qptfCa~C~efI   62 (63)
                      +..|.|+||...+
T Consensus        20 hsQthCshC~K~L   32 (169)
T PRK11582         20 HSQTHCAHCRKLL   32 (169)
T ss_pred             ccccchhhhccch
Confidence            5689999998743


No 28 
>PF06463 Mob_synth_C:  Molybdenum Cofactor Synthesis C;  InterPro: IPR010505 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cis-dithiolene moiety to molybdopterin (MPT). MoCF is ubiquitous in nature, and the pathway for MoCF biosynthesis is conserved in all three domains of life. MoCF-containing enzymes function as oxidoreductases in carbon, nitrogen, and sulphur metabolism [, ].  In Escherichia coli, biosynthesis of MoCF is a three stage process. It begins with the MoaA and MoaC conversion of GTP to the meta-stable pterin intermediate precursor Z. The second stage involves MPT synthase (MoaD and MoaE), which converts precursor Z to MPT; MoeB is involved in the recycling of MPT synthase. The final step in MoCF synthesis is the attachment of mononuclear Mo to MPT, a process that requires MoeA and which is enhanced by MogA in an Mg2 ATP-dependent manner []. MoCF is the active co-factor in eukaryotic and some prokaryotic molybdo-enzymes, but the majority of bacterial enzymes requiring MoCF, need a modification of MTP for it to be active; MobA is involved in the attachment of a nucleotide monophosphate to MPT resulting in the MGD co-factor, the active co-factor for most prokaryotic molybdo-enzymes. Bacterial two-hybrid studies have revealed the close interactions between MoeA, MogA, and MobA in the synthesis of MoCF []. Moreover the close functional association of MoeA and MogA in the synthesis of MoCF is supported by fact that the known eukaryotic homologues to MoeA and MogA exist as fusion proteins: CNX1 (Q39054 from SWISSPROT) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) []. This entry represents MoaA, which belongs to a family of enzymes involved in the synthesis of metallo-cofactors (IPR000385 from INTERPRO). Each subunit of the MoaA dimer is comprised of an N-terminal SAM domain (IPR007197 from INTERPRO) that contains the [4Fe-4S] cluster typical for this family of enzymes, as well as an additional [4Fe-4S] cluster in the C-terminal domain that is unique to MoaA proteins []. The unique Fe site of the C-terminal [4Fe-4S] cluster is thought to be involved in the binding and activation of 5'-GTP. Mutations in the human MoCF biosynthesis proteins MOCS1, MOCS2 or GEPH cause MoCF Deficiency type A (MOCOD), causing the loss of activity of MoCF-containing enzymes, resulting in neurological abnormalities and death [].; GO: 0051539 4 iron, 4 sulfur cluster binding, 0006777 Mo-molybdopterin cofactor biosynthetic process, 0019008 molybdopterin synthase complex; PDB: 2FB2_A 2FB3_A 1TV8_B 1TV7_A.
Probab=22.94  E-value=33  Score=21.87  Aligned_cols=26  Identities=27%  Similarity=0.600  Sum_probs=12.9

Q ss_pred             cceeecCCce--e-eeeecCCccccCCCCC
Q psy9785          34 KNVYNVKDHK--F-IPRFFKQPTFCSHCKD   60 (63)
Q Consensus        34 kKVh~v~GH~--F-~a~~f~qptfCa~C~e   60 (63)
                      ++.+.++|..  + +-.-+.+| ||+.|.-
T Consensus        49 a~~y~~~g~~g~vG~I~~~s~~-FC~~CNR   77 (128)
T PF06463_consen   49 ARYYRIPGGKGRVGFISPVSNP-FCSSCNR   77 (128)
T ss_dssp             SEEEEETTT--EEEEE-TTTS---GGG--E
T ss_pred             ceEEEECCCCcEEEEEeCCCCC-CCCcCCE
Confidence            3567777766  2 23556777 9999974


No 29 
>TIGR03823 FliZ flagellar regulatory protein FliZ. FliZ is involved in the regulation of flagellar assembly and possibly also the down-regulation of the motile phenotype. FliZ interacts with the flagellar translational activator FlhCD complex.
Probab=22.41  E-value=32  Score=23.97  Aligned_cols=13  Identities=38%  Similarity=1.027  Sum_probs=10.3

Q ss_pred             CCccccCCCCCcc
Q psy9785          50 KQPTFCSHCKDFI   62 (63)
Q Consensus        50 ~qptfCa~C~efI   62 (63)
                      +..|.|+||...+
T Consensus        20 hsQthCshC~K~L   32 (168)
T TIGR03823        20 HSQTHCSHCHKLL   32 (168)
T ss_pred             cccchhhhhcchh
Confidence            5689999998743


No 30 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=22.19  E-value=34  Score=16.20  Aligned_cols=9  Identities=33%  Similarity=1.132  Sum_probs=5.9

Q ss_pred             ccccCCCCC
Q psy9785          52 PTFCSHCKD   60 (63)
Q Consensus        52 ptfCa~C~e   60 (63)
                      -.||.+|+.
T Consensus        16 ~~fC~~CG~   24 (26)
T PF13248_consen   16 AKFCPNCGA   24 (26)
T ss_pred             cccChhhCC
Confidence            457777765


No 31 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=21.87  E-value=53  Score=22.68  Aligned_cols=14  Identities=21%  Similarity=1.013  Sum_probs=11.5

Q ss_pred             eecCCccccCCCCC
Q psy9785          47 RFFKQPTFCSHCKD   60 (63)
Q Consensus        47 ~~f~qptfCa~C~e   60 (63)
                      ..+..|.||+.|+.
T Consensus        63 ~~~~~PsYC~~CGk   76 (158)
T PF10083_consen   63 GHYEAPSYCHNCGK   76 (158)
T ss_pred             CCCCCChhHHhCCC
Confidence            44568999999997


No 32 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=20.17  E-value=30  Score=19.33  Aligned_cols=13  Identities=23%  Similarity=0.795  Sum_probs=8.2

Q ss_pred             CccccCCCCCccC
Q psy9785          51 QPTFCSHCKDFIW   63 (63)
Q Consensus        51 qptfCa~C~efIW   63 (63)
                      +..||..|+..||
T Consensus        47 ~r~FC~~CGs~l~   59 (92)
T PF04828_consen   47 ERYFCPTCGSPLF   59 (92)
T ss_dssp             EEEEETTT--EEE
T ss_pred             cCcccCCCCCeee
Confidence            4569999998664


Done!