Diaphorina citri psyllid: psy9802


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MFQALYISHDYIFILCLEHSTLKVPYEILNKKFRAVQKTIDREVSYVQSAANELEKTIASSAQVLAKNLEVLFILQRWKLWRNENLGFYIPR
cccHHHHHcccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
**QALYISHDYIFILCLEHSTLKVPYEILNKKFRAVQKTIDREVSYVQSAANELEKTIASSAQVLAKNLEVLFILQRWKLWRNENLGFYIPR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQALYISHDYIFILCLEHSTLKVPYEILNKKFRAVQKTIDREVSYVQSAANELEKTIASSAQVLAKNLEVLFILQRWKLWRNENLGFYIPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Macrophage erythroblast attacher Plays a role in erythroblast enucleation and in the development of the mature macrophages. Mediates the attachment of erythroid cell to mature macrophages, in correlation with the presence of MAEA at cell surface of mature macrophages; This MAEA-mediated contact inhibits erythroid cells apoptosis. Participates to erythroblastic island formation, which is the functional unit of definitive erythropoiesis. Associates with F-actin to regulate actin distribution in erythroblasts and macrophages. May contribute to nuclear architecture and cells division events.confidentQ4VC33
Macrophage erythroblast attacher May play a possible role in erythroblast and macrophages maturation. May associate with F-actin to regulate actin distribution in erythroblasts and macrophages. May contribute to nuclear architecture and cells division events.confidentQ5F398
Macrophage erythroblast attacher May play a possible role in erythroblast and macrophages maturation. May associate with F-actin to regulate actin distribution in erythroblasts and macrophages. May contribute to nuclear architecture and cells division events.confidentQ7SXR3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0033033 [BP]negative regulation of myeloid cell apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0043066, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523, GO:0033032
GO:0016363 [CC]nuclear matrixprobableGO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005826 [CC]actomyosin contractile ringprobableGO:0015629, GO:0043229, GO:0043228, GO:0070938, GO:0043226, GO:0005856, GO:0005575, GO:0044430, GO:0005737, GO:0032153, GO:0032155, GO:0005938, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0071944, GO:0044448, GO:0044424, GO:0044422
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0007155 [BP]cell adhesionprobableGO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted