BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy9825
(280 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2V50|A Chain A, The Missing Part Of The Bacterial Mexab-Oprm System:
Structural Determination Of The Multidrug Exporter Mexb
pdb|2V50|B Chain B, The Missing Part Of The Bacterial Mexab-Oprm System:
Structural Determination Of The Multidrug Exporter Mexb
pdb|2V50|C Chain C, The Missing Part Of The Bacterial Mexab-Oprm System:
Structural Determination Of The Multidrug Exporter Mexb
pdb|2V50|D Chain D, The Missing Part Of The Bacterial Mexab-Oprm System:
Structural Determination Of The Multidrug Exporter Mexb
pdb|2V50|E Chain E, The Missing Part Of The Bacterial Mexab-Oprm System:
Structural Determination Of The Multidrug Exporter Mexb
pdb|2V50|F Chain F, The Missing Part Of The Bacterial Mexab-Oprm System:
Structural Determination Of The Multidrug Exporter Mexb
Length = 1052
Score = 29.3 bits (64), Expect = 2.3, Method: Composition-based stats.
Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 9/66 (13%)
Query: 100 LSACLVPVLVCATALVVNFIAMYYHASRAIPFGTMVAVACICLFIILPLTLVGAVLGRNL 159
LS P L + LVV + S +IPF M +++PL ++GA+L ++
Sbjct: 867 LSGSQAPALYALSLLVVFLCLAALYESWSIPFSVM---------LVVPLGVIGALLATSM 917
Query: 160 SGQQDN 165
G ++
Sbjct: 918 RGLSND 923
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.333 0.143 0.476
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,952,789
Number of Sequences: 62578
Number of extensions: 182873
Number of successful extensions: 463
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 462
Number of HSP's gapped (non-prelim): 1
length of query: 280
length of database: 14,973,337
effective HSP length: 98
effective length of query: 182
effective length of database: 8,840,693
effective search space: 1609006126
effective search space used: 1609006126
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 51 (24.3 bits)