BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy9825
         (280 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2V50|A Chain A, The Missing Part Of The Bacterial Mexab-Oprm System:
           Structural Determination Of The Multidrug Exporter Mexb
 pdb|2V50|B Chain B, The Missing Part Of The Bacterial Mexab-Oprm System:
           Structural Determination Of The Multidrug Exporter Mexb
 pdb|2V50|C Chain C, The Missing Part Of The Bacterial Mexab-Oprm System:
           Structural Determination Of The Multidrug Exporter Mexb
 pdb|2V50|D Chain D, The Missing Part Of The Bacterial Mexab-Oprm System:
           Structural Determination Of The Multidrug Exporter Mexb
 pdb|2V50|E Chain E, The Missing Part Of The Bacterial Mexab-Oprm System:
           Structural Determination Of The Multidrug Exporter Mexb
 pdb|2V50|F Chain F, The Missing Part Of The Bacterial Mexab-Oprm System:
           Structural Determination Of The Multidrug Exporter Mexb
          Length = 1052

 Score = 29.3 bits (64), Expect = 2.3,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 9/66 (13%)

Query: 100 LSACLVPVLVCATALVVNFIAMYYHASRAIPFGTMVAVACICLFIILPLTLVGAVLGRNL 159
           LS    P L   + LVV       + S +IPF  M         +++PL ++GA+L  ++
Sbjct: 867 LSGSQAPALYALSLLVVFLCLAALYESWSIPFSVM---------LVVPLGVIGALLATSM 917

Query: 160 SGQQDN 165
            G  ++
Sbjct: 918 RGLSND 923


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.333    0.143    0.476 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,952,789
Number of Sequences: 62578
Number of extensions: 182873
Number of successful extensions: 463
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 462
Number of HSP's gapped (non-prelim): 1
length of query: 280
length of database: 14,973,337
effective HSP length: 98
effective length of query: 182
effective length of database: 8,840,693
effective search space: 1609006126
effective search space used: 1609006126
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 51 (24.3 bits)