Diaphorina citri psyllid: psy9858


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
MPMPKMESTELPLEKSNCFFGGSNIFASSVWYIRVHSALKKQYLLPDCEVKNDLLVYYQWRSVHVGRFATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLQELHHENVLGLTDVFGYMSNVSLVFEFVDTDLEVIIKDPTIVFTPSNIKAYAIMTLRGLEYLHDHWILHRDLKPNNLLINKQGVLKIGDFGLAKFFGSPTRLYTHQVVTRWYRLIKCLLYCVQFNVKNVQWCCFAKDPSSHGNLFPGIPLNEIFTAAGDDLLAVISSLLCLNPTKRADCTATLKMDYFSLTKEMYW
ccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccEEEEEcccccEEEEEEEEcccccEEEEEEEEccccccccccccHHHHHHHHHHHHccccccEEEEEEEEEccEEEEEEEccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEcccccccccccccccccccEEEEEcccccccccccccccccHHHHHHHHHHcccccccccccHHHHcccccccHHHHHHHcccccccccccHHHHHccccccccccccc
**************************************************KNDLLVYYQWRSVHVGRFATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLQELHHENVLGLTDVFGYMSNVSLVFEFVDTDLEVIIKDPTIVFTPSNIKAYAIMTLRGLEYLHDHWILHRDLKPNNLLINKQGVLKIGDFGLAKFFGSPTRLYTHQVVTRWYRLIKCLLYCVQFNVKNVQWCCFAKDPSSHGNLFPGIPLNEIFTAAGDDLLAVISSLLCLNPTKRADCTATLKMDYFSLTK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPMPKMESTELPLEKSNCFFGGSNIFASSVWYIRVHSALKKQYLLPDCEVKNDLLVYYQWRSVHVGRFATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLQELHHENVLGLTDVFGYMSNVSLVFEFVDTDLEVIIKDPTIVFTPSNIKAYAIMTLRGLEYLHDHWILHRDLKPNNLLINKQGVLKIGDFGLAKFFGSPTRLYTHQVVTRWYRLIKCLLYCVQFNVKNVQWCCFAKDPSSHGNLFPGIPLNEIFTAAGDDLLAVISSLLCLNPTKRADCTATLKMDYFSLTKEMYW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cyclin-dependent kinase 7 (Fragment) Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.confidentP51952
Cyclin-dependent kinase 7 Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.confidentP50613
Cyclin-dependent kinase 7 Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.confidentQ03147

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008353 [MF]RNA polymerase II carboxy-terminal domain kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001111 [BP]promoter clearance from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0001109, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0000079 [BP]regulation of cyclin-dependent protein serine/threonine kinase activityprobableGO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0071900, GO:0050789, GO:0043549, GO:0051246, GO:0065007, GO:0031399, GO:0065009, GO:0045859, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0032268, GO:0051726, GO:0051338, GO:0001932
GO:0009299 [BP]mRNA transcriptionprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0032806 [CC]carboxy-terminal domain protein kinase complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0006281 [BP]DNA repairprobableGO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0035173 [MF]histone kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0048709 [BP]oligodendrocyte differentiationprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0042063, GO:0008150, GO:0032501, GO:0044763, GO:0010001, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0007417
GO:0008022 [MF]protein C-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051129 [BP]negative regulation of cellular component organizationprobableGO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0048523, GO:0048519, GO:0051128, GO:0050789, GO:0044699
GO:0010005 [CC]cortical microtubule, transverse to long axisprobableGO:0030981, GO:0043229, GO:0071944, GO:0005874, GO:0043226, GO:0005737, GO:0005575, GO:0044430, GO:0005856, GO:0015630, GO:0055028, GO:0005881, GO:0005938, GO:0043234, GO:0032991, GO:0043232, GO:0030863, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0043228, GO:0044422, GO:0044424, GO:0044448
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0018107 [BP]peptidyl-threonine phosphorylationprobableGO:0044267, GO:0006468, GO:0009987, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0018210, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0045448 [BP]mitotic cell cycle, embryonicprobableGO:0032502, GO:0032501, GO:0000278, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0044763, GO:0044699, GO:0008150, GO:0009987, GO:0007275, GO:0007049
GO:0031100 [BP]organ regenerationprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0031099, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:2000241 [BP]regulation of reproductive processprobableGO:0008150, GO:0065007, GO:0050789
GO:0007160 [BP]cell-matrix adhesionprobableGO:0031589, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0051240 [BP]positive regulation of multicellular organismal processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0031396 [BP]regulation of protein ubiquitinationprobableGO:0032268, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031323, GO:0050794, GO:0065007, GO:0031399, GO:0008150, GO:0050789
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0045471 [BP]response to ethanolprobableGO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033
GO:0044702 [BP]single organism reproductive processprobableGO:0022414, GO:0008150, GO:0000003, GO:0044699
GO:0044708 [BP]single-organism behaviorprobableGO:0050896, GO:0008150, GO:0007610
GO:0000993 [MF]RNA polymerase II core bindingprobableGO:0019899, GO:0070063, GO:0043175, GO:0001098, GO:0001099, GO:0003674, GO:0005488, GO:0005515, GO:0032403
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0016572 [BP]histone phosphorylationprobableGO:0016310, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0006468, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0008150, GO:0016568, GO:0016569
GO:0005935 [CC]cellular bud neckprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0048638 [BP]regulation of developmental growthprobableGO:0050793, GO:0008150, GO:0040008, GO:0065007, GO:0050789
GO:0007519 [BP]skeletal muscle tissue developmentprobableGO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0044767, GO:0061061, GO:0014706, GO:0048513, GO:0008150, GO:0060537, GO:0060538, GO:0048731, GO:0007275, GO:0044699
GO:0005840 [CC]ribosomeprobableGO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0045860 [BP]positive regulation of protein kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:2000273 [BP]positive regulation of receptor activityprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0044093, GO:0023051, GO:0008150, GO:0065009, GO:0010646, GO:0010469, GO:0050789
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0006461 [BP]protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0000086 [BP]G2/M transition of mitotic cell cycleprobableGO:0000278, GO:0008150, GO:0009987, GO:0044770, GO:0044772, GO:0044763, GO:0044699, GO:0022402, GO:0007049
GO:0000082 [BP]G1/S transition of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0046822 [BP]regulation of nucleocytoplasmic transportprobableGO:0060341, GO:0051049, GO:0032386, GO:0050794, GO:0065007, GO:0008150, GO:0032879, GO:0050789
GO:0033043 [BP]regulation of organelle organizationprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051128
GO:0033136 [BP]serine phosphorylation of STAT3 proteinprobableGO:0018105, GO:0016310, GO:0048583, GO:0023051, GO:0010646, GO:0010627, GO:0050789, GO:0044267, GO:0044260, GO:0009966, GO:0018193, GO:0071704, GO:0065007, GO:0006468, GO:0046425, GO:0009987, GO:0006464, GO:0050794, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044238, GO:0018209, GO:0042501, GO:0044237, GO:0043170, GO:0019538, GO:0006796, GO:0006793
GO:0071156 [BP]regulation of cell cycle arrestprobableGO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:0065007, GO:0050789
GO:0045931 [BP]positive regulation of mitotic cell cycleprobableGO:0007346, GO:0045787, GO:0051726, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0045930 [BP]negative regulation of mitotic cell cycleprobableGO:0007346, GO:0045786, GO:0051726, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005675 [CC]holo TFIIH complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0048646 [BP]anatomical structure formation involved in morphogenesisprobableGO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0090068 [BP]positive regulation of cell cycle processprobableGO:0051726, GO:0010564, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0008094 [MF]DNA-dependent ATPase activityprobableGO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0080135 [BP]regulation of cellular response to stressprobableGO:0080134, GO:0048583, GO:0050794, GO:0008150, GO:0065007, GO:0050789
GO:0006260 [BP]DNA replicationprobableGO:0071704, GO:1901576, GO:0044238, GO:0008152, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0044249, GO:0009058, GO:0009059, GO:0006807, GO:0034645, GO:0006259, GO:0008150, GO:1901360, GO:0046483
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0070816 [BP]phosphorylation of RNA polymerase II C-terminal domainprobableGO:0080090, GO:0019222, GO:0016310, GO:0031323, GO:0050789, GO:0044267, GO:0044260, GO:0071704, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0031326, GO:0010468, GO:0006468, GO:0019219, GO:0009987, GO:0009889, GO:0006464, GO:0050794, GO:0043412, GO:0036211, GO:0008150, GO:0051171, GO:0008152, GO:2001141, GO:0044238, GO:0019538, GO:0051252, GO:0044237, GO:0043170, GO:0006355, GO:0006796, GO:0010556, GO:0006793
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0010647 [BP]positive regulation of cell communicationprobableGO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0010646, GO:0050789, GO:0048522
GO:2000045 [BP]regulation of G1/S transition of mitotic cell cycleprobableGO:0007346, GO:0051726, GO:0010564, GO:0050794, GO:1901987, GO:0065007, GO:1901990, GO:0008150, GO:0050789
GO:0032869 [BP]cellular response to insulin stimulusprobableGO:0070887, GO:0032868, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007010 [BP]cytoskeleton organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0015030 [CC]Cajal bodyprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0010515 [BP]negative regulation of induction of conjugation with cellular fusionprobableGO:0046999, GO:0031138, GO:0031137, GO:0031135, GO:0050794, GO:0008150, GO:0043900, GO:0043901, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0006275 [BP]regulation of DNA replicationprobableGO:0009889, GO:0051052, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:2000112, GO:0050794, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:0008150, GO:0050789, GO:0080090
GO:0000302 [BP]response to reactive oxygen speciesprobableGO:1901700, GO:0050896, GO:0006950, GO:0008150, GO:0042221, GO:0006979
GO:0030175 [CC]filopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0000235 [CC]astral microtubuleprobableGO:0043229, GO:0043228, GO:0005874, GO:0043226, GO:0005876, GO:0005737, GO:0044446, GO:0005818, GO:0005819, GO:0044430, GO:0005856, GO:0015630, GO:0005881, GO:0043234, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0004693 [MF]cyclin-dependent protein serine/threonine kinase activityprobableGO:0097472, GO:0016773, GO:0016772, GO:0003824, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0001558 [BP]regulation of cell growthprobableGO:0040008, GO:0050794, GO:0008150, GO:0065007, GO:0051128, GO:0050789
GO:0043525 [BP]positive regulation of neuron apoptotic processprobableGO:0050789, GO:0050794, GO:0043065, GO:0010942, GO:0043067, GO:0043523, GO:0065007, GO:0048518, GO:1901216, GO:0008150, GO:1901214, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0016202 [BP]regulation of striated muscle tissue developmentprobableGO:1901861, GO:0050793, GO:0048634, GO:0008150, GO:2000026, GO:0051239, GO:0065007, GO:0050789
GO:0030549 [MF]acetylcholine receptor activator activityprobableGO:0030545, GO:0030546, GO:0030548, GO:0003674
GO:0050767 [BP]regulation of neurogenesisprobableGO:0030154, GO:0007275, GO:0044699, GO:0048869, GO:0060284, GO:0050789, GO:0008150, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0044707, GO:0048856, GO:0051960, GO:2000026, GO:0048731
GO:0060968 [BP]regulation of gene silencingprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0003006 [BP]developmental process involved in reproductionprobableGO:0032502, GO:0022414, GO:0008150, GO:0000003
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0051602 [BP]response to electrical stimulusprobableGO:0009628, GO:0050896, GO:0008150
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0009611 [BP]response to woundingprobableGO:0006950, GO:0008150, GO:0050896
GO:0051591 [BP]response to cAMPprobableGO:1901700, GO:0009719, GO:0050896, GO:1901698, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0014074, GO:0046683, GO:0014070
GO:0007067 [BP]mitosisprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0016049 [BP]cell growthprobableGO:0008150, GO:0009987, GO:0044763, GO:0040007, GO:0044699
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0005176 [MF]ErbB-2 class receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0006887 [BP]exocytosisprobableGO:0046903, GO:0009987, GO:0016192, GO:0006810, GO:0044765, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0007126 [BP]meiosisprobableGO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0045956 [BP]positive regulation of calcium ion-dependent exocytosisprobableGO:0045921, GO:0060341, GO:0051046, GO:0051047, GO:0051049, GO:0051050, GO:0060627, GO:0017158, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0017157, GO:0050789, GO:0050794, GO:0048522
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0090316 [BP]positive regulation of intracellular protein transportprobableGO:0033157, GO:0070201, GO:0032879, GO:0032388, GO:0060341, GO:0051050, GO:0051049, GO:0032386, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0051222, GO:0051223, GO:0050789, GO:0032880
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0010035 [BP]response to inorganic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0044265 [BP]cellular macromolecule catabolic processprobableGO:1901575, GO:0044260, GO:0009987, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:0009057
GO:0050321 [MF]tau-protein kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005816 [CC]spindle pole bodyprobableGO:0043234, GO:0005575, GO:0005819, GO:0032991, GO:0005622, GO:0043232, GO:0005856, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630
GO:0016533 [CC]cyclin-dependent protein kinase 5 holoenzyme complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0000307, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0043226, GO:0044424, GO:0019908, GO:0043227, GO:0005634, GO:0044422
GO:0048584 [BP]positive regulation of response to stimulusprobableGO:0048518, GO:0065007, GO:0048583, GO:0050789, GO:0008150
GO:0043125 [MF]ErbB-3 class receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0034501 [BP]protein localization to kinetochoreprobableGO:0008104, GO:0034502, GO:0070727, GO:0034613, GO:0044763, GO:0033365, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0072686 [CC]mitotic spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0030332 [MF]cyclin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0007095 [BP]mitotic G2 DNA damage checkpointprobableGO:0010948, GO:0044773, GO:1901991, GO:1901990, GO:0050789, GO:0044699, GO:0051716, GO:0031572, GO:0031570, GO:0010564, GO:0065007, GO:0007049, GO:0048519, GO:0009987, GO:0007346, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0008150, GO:0044774, GO:1901988, GO:0000077, GO:0000075, GO:0051726, GO:0050896, GO:0044763, GO:0033554, GO:0022402, GO:0048523, GO:0007093
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0048488 [BP]synaptic vesicle endocytosisprobableGO:0019226, GO:0035637, GO:0051649, GO:0023052, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0097480, GO:0097479, GO:0051641, GO:0032501, GO:0050877, GO:0006810, GO:0044765, GO:0008150, GO:0051648, GO:0007268, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051640, GO:0003008, GO:0044700, GO:0006897, GO:0016192, GO:0044707, GO:0044763, GO:0009987

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UA2, chain A
Confidence level:very confident
Coverage over the Query: 58-88,101-303
View the alignment between query and template
View the model in PyMOL
Template: 4G3G, chain A
Confidence level:probable
Coverage over the Query: 23-94,105-204
View the alignment between query and template
View the model in PyMOL