RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy9859
         (78 letters)



>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 7.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 7 (CDK7) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK7 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK7 plays essential roles in the cell cycle
          and in transcription. It associates with cyclin H and
          MAT1 and acts as a CDK-Activating Kinase (CAK) by
          phosphorylating and activating cell cycle CDKs
          (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is
          also a component of the general transcription factor
          TFIIH, which phosphorylates the C-terminal domain (CTD)
          of RNA polymerase II when it is bound with
          unphosphorylated DNA, as present in the pre-initiation
          complex. Following phosphorylation, the CTD dissociates
          from the DNA which allows transcription initiation.
          Length = 298

 Score = 78.0 bits (193), Expect = 4e-19
 Identities = 39/76 (51%), Positives = 46/76 (60%), Gaps = 11/76 (14%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLSVTISRENWLILRVIL 63
          +A V+KARD ET  IVA+KKIKLG   +AKDGIN TALREIKLL   +   N        
Sbjct: 13 YAVVYKARDKETGRIVAIKKIKLGERKEAKDGINFTALREIKLLQ-ELKHPN-------- 63

Query: 64 KMNLHKV--TKSTINI 77
           + L  V   KS IN+
Sbjct: 64 IIGLLDVFGHKSNINL 79


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
           protein Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase (CDK)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKs are partly
           regulated by their subcellular localization, which
           defines substrate phosphorylation and the resulting
           specific function. CDK1, CDK2, CDK4, and CDK6 have
           well-defined functions in the cell cycle, such as the
           regulation of the early G1 phase by CDK4 or CDK6, the
           G1/S phase transition by CDK2, or the entry of mitosis
           by CDK1. They also exhibit overlapping cyclin
           specificity and functions in certain conditions.
           Knockout mice with a single CDK deleted remain viable
           with specific phenotypes, showing that some CDKs can
           compensate for each other. For example, CDK4 can
           compensate for the loss of CDK6, however, double
           knockout mice with both CDK4 and CDK6 deleted die in
           utero. CDK8 and CDK9 are mainly involved in
           transcription while CDK5 is implicated in neuronal
           function. CDK7 plays essential roles in both the cell
           cycle as a CDK-Activating Kinase (CAK) and in
           transcription as a component of the general
           transcription factor TFIIH.
          Length = 282

 Score = 57.1 bits (139), Expect = 1e-11
 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 23/92 (25%)

Query: 4   FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREI------------KLLSVTI 51
           +  V+KARD +T  IVA+KKI+L    + ++GI  TALREI            KLL V  
Sbjct: 12  YGVVYKARDKKTGEIVALKKIRLD---NEEEGIPSTALREISLLKELKHPNIVKLLDVIH 68

Query: 52  SREN-WLI-------LRVILKMNLHKVTKSTI 75
           +    +L+       L+  L      ++ + I
Sbjct: 69  TERKLYLVFEYCDMDLKKYLDKRPGPLSPNLI 100


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
          Serine/Threonine Kinases.  Serine/Threonine Kinases
          (STKs), CMGC family, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The CMGC family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. The CMGC family
          consists of Cyclin-Dependent protein Kinases (CDKs),
          Mitogen-activated protein kinases (MAPKs) such as
          Extracellular signal-regulated kinase (ERKs), c-Jun
          N-terminal kinases (JNKs), and p38, and similar
          proteins. CDKs belong to a large subfamily of STKs that
          are regulated by their cognate cyclins. Together, they
          are involved in the control of cell-cycle progression,
          transcription, and neuronal function. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation.
          Length = 283

 Score = 55.8 bits (135), Expect = 5e-11
 Identities = 25/44 (56%), Positives = 30/44 (68%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +  V+KARD  T  IVA+KKIKL       +GI +TALREIKLL
Sbjct: 12 YGVVYKARDKLTGEIVAIKKIKLRFE---SEGIPKTALREIKLL 52


>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 9-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 9 (CDK9)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK9-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK9 and CDK12
          from higher eukaryotes, yeast BUR1, C-type plant CDKs
          (CdkC), and similar proteins. CDK9, BUR1, and CdkC are
          functionally equivalent. They act as a kinase for the
          C-terminal domain of RNA polymerase II and participate
          in regulating mutliple steps of gene expression
          including transcription elongation and RNA processing.
          CDK9 and CdkC associate with T-type cyclins while BUR1
          associates with the cyclin BUR2. CDK12 is a unique CDK
          that contains an arginine/serine-rich (RS) domain,
          which is predominantly found in splicing factors. CDK12
          interacts with cyclins L1 and L2, and participates in
          regulating transcription and alternative splicing.
          Length = 287

 Score = 51.8 bits (125), Expect = 1e-09
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +  V+KAR+ +T  +VA+KKI++    + K+G   TA+REIKLL
Sbjct: 12 YGQVYKARNKKTGELVALKKIRM---ENEKEGFPITAIREIKLL 52


>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine
          Kinase, Cell Cycle-Related Kinase.  Serine/Threonine
          Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          CCRK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CCRK was previously called
          p42. It is a Cyclin-Dependent Kinase (CDK)-Activating
          Kinase (CAK) which is essential for the activation of
          CDK2. It is indispensable for cell growth and has been
          implicated in the progression of glioblastoma
          multiforme. In the heart, a splice variant of CCRK with
          a different C-terminal half is expressed, this variant
          promotes cardiac cell growth and survival and is
          significantly down-regulated during the development of
          heart failure.
          Length = 286

 Score = 48.1 bits (115), Expect = 3e-08
 Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
             VFKA+D ET   VA+KK+ L      + GI   ALREIK L 
Sbjct: 13 HGIVFKAKDRETGETVALKKVALRR---LEGGIPNQALREIKALQ 54


>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 1-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 1 (CDK1)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK1 from
          higher eukaryotes, plants, and yeasts, as well as CDK2
          and CDK3. CDK1 is also called Cell division control
          protein 2 (Cdc2) or p34 protein kinase, and is
          regulated by cyclins A, B, and E. The CDK1/cyclin A
          complex controls G2 phase entry and progression while
          the CDK1/cyclin B complex is critical for G2 to M phase
          transition. CDK2 is regulated by cyclin E or cyclin A.
          Upon activation by cyclin E, it phosphorylates the
          retinoblastoma (pRb) protein which activates E2F
          mediated transcription and allows cells to move into S
          phase. The CDK2/cyclin A complex plays a role in
          regulating DNA replication. Studies in knockout mice
          revealed that CDK1 can compensate for the loss of the
          cdk2 gene as it can also bind cyclin E and drive G1 to
          S phase transition. CDK3 is regulated by cyclin C and
          it phosphorylates pRB specifically during the G0/G1
          transition. This phosphorylation is required for cells
          to exit G0 efficiently and enter the G1 phase.
          Length = 283

 Score = 46.9 bits (112), Expect = 7e-08
 Identities = 22/41 (53%), Positives = 28/41 (68%), Gaps = 3/41 (7%)

Query: 7  VFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          V+KARD  T  IVA+KKI+L T     +G+  TA+REI LL
Sbjct: 15 VYKARDKLTGEIVALKKIRLETE---DEGVPSTAIREISLL 52


>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine
          Kinase, Cell Division Cycle 2-like 1.  Serine/Threonine
          Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          CDC2L1 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDC2L1, also called PITSLRE, exists in
          different isoforms which are named using the alias
          CDK11(p). The CDC2L1 gene produces two protein
          products, CDK11(p110) and CDK11(p58). CDC2L1 is also
          represented by the caspase-processed CDK11(p46).
          CDK11(p110), the major isoform, associates with cyclin
          L and is expressed throughout the cell cycle. It is
          involved in RNA processing and the regulation of
          transcription. CDK11(p58) associates with cyclin D3 and
          is expressed during the G2/M phase of the cell cycle.
          It plays roles in spindle morphogenesis, centrosome
          maturation, sister chromatid cohesion, and the
          completion of mitosis. CDK11(p46) is formed from the
          larger isoforms by caspases during TNFalpha- and
          Fas-induced apoptosis. It functions as a downstream
          effector kinase in apoptotic signaling pathways and
          interacts with eukaryotic initiation factor 3f (eIF3f),
           p21-activated kinase (PAK1), and Ran-binding protein
          (RanBPM).
          Length = 293

 Score = 46.1 bits (110), Expect = 2e-07
 Identities = 19/44 (43%), Positives = 29/44 (65%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +  V++ARD +T  IVA+KK+K+      K+G   T+LREI +L
Sbjct: 18 YGVVYRARDKKTGEIVALKKLKM---EKEKEGFPITSLREINIL 58


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
          domain.  Phosphotransferases. Serine or
          threonine-specific kinase subfamily.
          Length = 254

 Score = 45.2 bits (108), Expect = 2e-07
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 4/45 (8%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
          F  V+ ARD +T  +VA+K IK               LREIK+L 
Sbjct: 12 FGKVYLARDKKTGKLVAIKVIKK----KKIKKDRERILREIKILK 52


>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine
          Kinase, Fungal Cyclin-Dependent protein Kinase Bypass
          UAS Requirement 1 and similar proteins.
          Serine/Threonine Kinases (STKs), Bypass UAS Requirement
          1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          BUR1 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. BUR1, also called SGV1, is a yeast
          Cyclin-Dependent protein Kinase (CDK) that is
          functionally equivalent to mammalian CDK9. It
          associates with the cyclin BUR2. BUR genes were
          orginally identified in a genetic screen as factors
          involved in general transcription. The BUR1/BUR2
          complex phosphorylates the C-terminal domain of RNA
          polymerase II. In addition, this complex regulates
          histone modification by phosporylating Rad6 and
          mediating the association of the Paf1 complex with
          chromatin.
          Length = 311

 Score = 45.4 bits (108), Expect = 3e-07
 Identities = 23/44 (52%), Positives = 29/44 (65%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          F  V+KAR I+T  +VA+KKI      + KDG   TALREIK+L
Sbjct: 21 FGEVYKARQIKTGRVVALKKI---LMHNEKDGFPITALREIKIL 61


>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 5.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 5 (CDK5) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK5 is unusual in that it is regulated by
          non-cyclin proteins, p35 and p39. It is highly
          expressed in the nervous system and is critical in
          normal neural development and function. It plays a role
          in neuronal migration and differentiation, and is also
          important in synaptic plasticity and learning. CDK5
          also participates in protecting against cell death and
          promoting angiogenesis. Impaired CDK5 activity is
          implicated in Alzheimer's disease, amyotrophic lateral
          sclerosis, Parkinson's disease, Huntington's disease
          and acute neuronal injury.
          Length = 284

 Score = 45.5 bits (108), Expect = 3e-07
 Identities = 21/44 (47%), Positives = 31/44 (70%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          + TVFKA++ ET  IVA+K+++L    D  +G+  +ALREI LL
Sbjct: 13 YGTVFKAKNRETHEIVALKRVRL---DDDDEGVPSSALREICLL 53


>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
          Kinase Like Serine/Threonine Kinases.  Serine/Threonine
          Kinases (STKs), Cyclin-dependent protein kinase like
          (CDKL) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          CDKL subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDKL1-5 and
          similar proteins. Some CDKLs, like CDKL1 and CDKL3, may
          be implicated in transformation and others, like CDKL3
          and CDKL5, are associated with mental retardation when
          impaired. CDKL2 plays a role in learning and memory.
          Length = 288

 Score = 45.0 bits (107), Expect = 3e-07
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +  V K R+  T  IVA+KK K    ++  + + +TALRE+K+L
Sbjct: 14 YGVVLKCRNKATGEIVAIKKFK---ESEDDEDVKKTALREVKVL 54


>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 9.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 9 (CDK9) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK9 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK9 together with a cyclin partner (cyclin
          T1, T2a, T2b, or K) is the main component of distinct
          positive transcription elongation factors (P-TEFb),
          which function as Ser2 C-terminal domain kinases of RNA
          polymerase II. P-TEFb participates in multiple steps of
          gene expression including transcription elongation,
          mRNA synthesis, processing, export, and translation. It
          also plays a role in mediating cytokine induced
          transcription networks such as IL6-induced STAT3
          signaling. In addition, the CDK9/cyclin T2a complex
          promotes muscle differentiation and enhances the
          function of some myogenic regulatory factors.
          Length = 310

 Score = 45.1 bits (107), Expect = 3e-07
 Identities = 22/44 (50%), Positives = 29/44 (65%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          F  VFKAR  +T  IVA+KK+ +    + K+G   TALREIK+L
Sbjct: 25 FGEVFKARHKKTKQIVALKKVLME---NEKEGFPITALREIKIL 65


>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine
          Kinase, Fungal Cyclin-Dependent protein Kinase Pho85.
          Serine/Threonine Kinases (STKs), Pho85 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The Pho85 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Pho85 is a multifunctional
          Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs
          belong to a large family of STKs that are regulated by
          their cognate cyclins. Together, they are involved in
          the control of cell-cycle progression, transcription,
          and neuronal function. Pho85 is regulated by 10
          different cyclins (Pcls) and plays a role in G1
          progression, cell polarity, phosphate and glycogen
          metabolism, gene expression, and in signaling changes
          in the environment. It is not essential for yeast
          viability and is the functional homolog of mammalian
          CDK5, which plays a role in central nervous system
          development.
          Length = 284

 Score = 43.6 bits (103), Expect = 1e-06
 Identities = 21/44 (47%), Positives = 30/44 (68%), Gaps = 4/44 (9%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +ATV+K R+  T  IVA+K+I L    DA++G   TA+REI L+
Sbjct: 13 YATVYKGRNRTTGEIVALKEIHL----DAEEGTPSTAIREISLM 52


>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 10.
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein Kinase 10 (CDK10) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK10 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK10, also called PISSLRE, is essential for
          cell growth and proliferation, and acts through the
          G2/M phase of the cell cycle. CDK10 has also been
          identified as an important factor in endocrine therapy
          resistance in breast cancer. CDK10 silencing increases
          the transcription of c-RAF and the activation of the
          p42/p44 MAPK pathway, which leads to antiestrogen
          resistance. Patients who express low levels of CDK10
          relapse early on tamoxifen.
          Length = 309

 Score = 43.1 bits (102), Expect = 2e-06
 Identities = 18/41 (43%), Positives = 29/41 (70%), Gaps = 3/41 (7%)

Query: 7  VFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          V++ARD  +  IVA+KK+++    + +DGI  ++LREI LL
Sbjct: 23 VYRARDTTSGEIVALKKVRM---DNERDGIPISSLREITLL 60


>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine
          Kinases, Cyclin-Dependent protein Kinase 2 and 3.
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase 2 (CDK2) and CDK3 subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK2/3 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK2 is regulated by cyclin E or cyclin A.
          Upon activation by cyclin E, it phosphorylates the
          retinoblastoma (pRb) protein which activates E2F
          mediated transcription and allows cells to move into S
          phase. The CDK2/cyclin A complex plays a role in
          regulating DNA replication. CDK2, together with CDK4,
          also regulates embryonic cell proliferation. Despite
          these important roles, mice deleted for the cdk2 gene
          are viable and normal except for being sterile. This
          may be due to compensation provided by CDK1 (also
          called Cdc2), which can also bind cyclin E and drive
          the G1 to S phase transition. CDK3 is regulated by
          cyclin C and it phosphorylates pRB specifically during
          the G0/G1 transition. This phosphorylation is required
          for cells to exit G0 efficiently and enter the G1
          phase.
          Length = 284

 Score = 42.9 bits (101), Expect = 2e-06
 Identities = 20/44 (45%), Positives = 29/44 (65%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +  V+KAR+  T  +VA+KKI+L T     +G+  TA+REI LL
Sbjct: 13 YGVVYKARNKLTGEVVALKKIRLDTET---EGVPSTAIREISLL 53


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 41.9 bits (99), Expect = 4e-06
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          F TV+KA+   T  IVAVK +K       K   ++TA REI++L
Sbjct: 12 FGTVYKAKHKGTGKIVAVKILKK---RSEKSKKDQTARREIRIL 52


>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 4 and 6-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase 4 (CDK4) and CDK6-like subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK4/6-like
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK4 and CDK6 partner with D-type cyclins to
          regulate the early G1 phase of the cell cycle. They are
          the first kinase activated by mitogenic signals to
          release cells from the G0 arrested state. CDK4 and CDK6
          are both expressed ubiquitously, associate with all
          three D cyclins (D1, D2 and D3), and phosphorylate the
          retinoblastoma (pRb) protein. They are also regulated
          by the INK4 family of inhibitors which associate with
          either the CDK alone or the CDK/cyclin complex. CDK4
          and CDK6 show differences in subcellular localization,
          sensitivity to some inhibitors, timing in activation,
          tumor selectivity, and possibly substrate profiles.
          Although CDK4 and CDK6 seem to show some redundancy,
          they also have discrete, nonoverlapping functions. CDK6
          plays an important role in cell differentiation.
          Length = 287

 Score = 41.9 bits (99), Expect = 4e-06
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          + TV+KARD+ T   VA+KK+++     +++GI  + LREI LL
Sbjct: 12 YGTVYKARDLNTGRFVALKKVRVPL---SEEGIPLSTLREIALL 52


>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 12.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 12 (CDK12) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK12 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK12 is also called Cdc2-related protein
          kinase 7 (CRK7) or Cdc2-related kinase
          arginine/serine-rich (CrkRS). It is a unique CDK that
          contains an arginine/serine-rich (RS) domain, which is
          predominantly found in splicing factors. CDK12 is
          widely expressed in tissues. It interacts with cyclins
          L1 and L2, and plays roles in regulating transcription
          and alternative splicing.
          Length = 302

 Score = 40.9 bits (96), Expect = 1e-05
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +  V+KARD +T  +VA+KK++L    + K+G   TA+REIK+L
Sbjct: 20 YGQVYKARDKDTGELVALKKVRL---DNEKEGFPITAIREIKIL 60


>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional.
          Length = 294

 Score = 39.4 bits (92), Expect = 4e-05
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +  V+KARD  T+  +A+KKI+L       +G+  TA+REI LL
Sbjct: 15 YGVVYKARDRVTNETIALKKIRL---EQEDEGVPSTAIREISLL 55


>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the
          Serine/Threonine Kinase, Plant B-type Cyclin-Dependent
          protein Kinase.  Serine/Threonine Kinases (STKs), Plant
          B-type Cyclin-Dependent protein Kinase (CdkB)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          CdkB subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. The plant-specific B-type CDKs are expressed
          from the late S to the M phase of the cell cycle. They
          are characterized by the cyclin binding motif
          PPT[A/T]LRE. They play a role in controlling mitosis
          and integrating developmental pathways, such as stomata
          and leaf development. CdkB has been shown to associate
          with both cyclin B, which controls G2/M transition, and
          cyclin D, which acts as a mediator in linking
          extracellular signals to the cell cycle.
          Length = 295

 Score = 39.0 bits (91), Expect = 4e-05
 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +  V+KARD  T  +VA+KK +L      ++GI  TALREI LL
Sbjct: 14 YGKVYKARDKNTGKLVALKKTRLEMD---EEGIPPTALREISLL 54


>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like
          Serine/Threonine Kinases.  Serine/Threonine Kinases
          (STKs), PCTAIRE-like subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The PCTAIRE-like subfamily is part of a
          larger superfamily that includes the catalytic domains
          of other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Members of this
          subfamily share sequence similarity with
          Cyclin-Dependent Kinases (CDKs), which belong to a
          large family of STKs that are regulated by their
          cognate cyclins. Together, CDKs and cyclins are
          involved in the control of cell-cycle progression,
          transcription, and neuronal function. The association
          of PCTAIRE-like proteins with cyclins has not been
          widely studied, although PFTAIRE-1 has been shown to
          function as a CDK which is regulated by cyclin D3 as
          well as the membrane-associated cyclin Y. PCTAIRE-like
          proteins show unusual expression patterns with high
          levels in post-mitotic tissues, suggesting that they
          may be involved in regulating post-mitotic cellular
          events.
          Length = 291

 Score = 39.3 bits (92), Expect = 4e-05
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 4/44 (9%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +ATV+K R   T  +VA+K+I+L    + ++G   TA+RE  LL
Sbjct: 18 YATVYKGRSKLTGQLVALKEIRL----EHEEGAPFTAIREASLL 57


>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional.
          Length = 335

 Score = 39.0 bits (91), Expect = 5e-05
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 16/83 (19%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKD---------GINRTALREIKLLSVTISRE 54
          +  V KA D  T  IVA+KK+K+   ++            GI+ T LRE+K+++  I  E
Sbjct: 22 YGKVEKAYDTLTGKIVAIKKVKIIEISNDVTKDRQLVGMCGIHFTTLRELKIMN-EIKHE 80

Query: 55 NWLILRVILKMNLHKVTKSTINI 77
          N + L  +       V    IN+
Sbjct: 81 NIMGLVDVY------VEGDFINL 97


>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 1 from higher
          eukaryotes-like.  Serine/Threonine Kinases (STKs),
          Cyclin-Dependent protein Kinase 1 (CDK1) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK1 from
          higher eukaryotes. CDK1 is also called Cell division
          control protein 2 (Cdc2) or p34 protein kinase, and is
          regulated by cyclins A, B, and E. The CDK1/cyclin A
          complex controls G2 phase entry and progression.
          CDK1/cyclin A2 has also been implicated as an important
          regulator of S phase events. The CDK1/cyclin B complex
          is critical for G2 to M phase transition. It induces
          mitosis by activating nuclear enzymes that regulate
          chromatin condensation, nuclear membrane degradation,
          mitosis-specific microtubule and cytoskeletal
          reorganization. CDK1 also associates with cyclin E and
          plays a role in the entry into S phase. CDK1
          transcription is stable throughout the cell cycle but
          is modulated in some pathological conditions. It may
          play a role in regulating apoptosis under these
          conditions. In breast cancer cells, HER2 can mediate
          apoptosis by inactivating CDK1. Activation of CDK1 may
          contribute to HIV-1 induced apoptosis and neuronal
          apoptosis in neurodegenerative diseases.
          Length = 285

 Score = 37.8 bits (88), Expect = 1e-04
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +  V+K R+ +T  IVA+KKI+L +    ++G+  TA+REI LL
Sbjct: 13 YGVVYKGRNKKTGQIVAMKKIRLESE---EEGVPSTAIREISLL 53


>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated
          protein kinase kinase kinase kinase-like Protein
          Serine/Threonine Kinases.  Serine/threonine kinases
          (STKs), mitogen-activated protein kinase (MAPK) kinase
          kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAP4K3-like
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily includes
          MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins.
          Vertebrate members contain an N-terminal catalytic
          domain and a C-terminal citron homology (CNH)
          regulatory domain, similar to MAP4K4/6. MAP4Ks are
          involved in some MAPK signaling pathways that are
          important in mediating cellular responses to
          extracellular signals by activating a MAPK kinase
          kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
          activated either by a small GTP-binding protein or by
          an adaptor protein, which transmits the signal either
          directly to a MAP3K to start the triple kinase core
          cascade or indirectly through a mediator kinase, a
          MAP4K. MAP4K1, also called haematopoietic progenitor
          kinase 1 (HPK1), is a hematopoietic-specific STK
          involved in many cellular signaling cascades including
          MAPK, antigen receptor, apoptosis, growth factor, and
          cytokine signaling. It participates in the regulation
          of T cell receptor signaling and T cell-mediated immune
          responses. MAP4K2 was referred to as germinal center
          (GC) kinase because of its preferred location in GC B
          cells. MAP4K3 plays a role in the nutrient-responsive
          pathway of mTOR (mammalian target of rapamycin)
          signaling. It is required in the activation of S6
          kinase by amino acids and for the phosphorylation of
          the mTOR-regulated inhibitor of eukaryotic initiation
          factor 4E. MAP4K5, also called germinal center
          kinase-related enzyme (GCKR), has been shown to
          activate the MAPK c-Jun N-terminal kinase (JNK).
          Length = 262

 Score = 37.7 bits (88), Expect = 1e-04
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 5/44 (11%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +  V+KARDI T  +VA+K IKL    +  D       +EI +L
Sbjct: 16 YGDVYKARDIATGELVAIKVIKL----EPGDDF-EIIQQEISML 54


>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine
          Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. 
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase like 1 (CDKL1) and CDKL4 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDKL1 and CDKL4
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDKL1, also called p42 KKIALRE, is a glial
          protein that is upregulated in gliosis. It is present
          in neuroblastoma and A431 human carcinoma cells, and
          may be implicated in neoplastic transformation. The
          function of CDKL4 is unknown.
          Length = 286

 Score = 37.4 bits (87), Expect = 2e-04
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 7  VFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          VFK R+ ET  IVA+KK      ++    I + ALREI++L
Sbjct: 17 VFKCRNRETGQIVAIKKF---VESEDDPVIKKIALREIRML 54


>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division
          control protein 7-like Protein Serine/Threonine
          Kinases.  Serine/threonine kinases (STKs),  (Cdc7)-like
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Cdc7-like subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this subfamily
          include Schizosaccharomyces pombe Cdc7, Saccharomyces
          cerevisiae Cdc15, Arabidopsis thaliana
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK) epsilon, and related proteins. MAPKKKs
          phosphorylate and activate MAPK kinases (MAPKKs or MKKs
          or MAP2Ks), which in turn phosphorylate and activate
          MAPKs during signaling cascades that are important in
          mediating cellular responses to extracellular signals.
          Fission yeast Cdc7 is essential for cell division by
          playing a key role in the initiation of septum
          formation and cytokinesis. Budding yeast Cdc15
          functions to coordinate mitotic exit with cytokinesis.
          Arabidopsis MAPKKK epsilon is required for pollen
          development in the plasma membrane.
          Length = 254

 Score = 36.8 bits (86), Expect = 3e-04
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
          F  V+K  ++ET   VA+K+I L      ++ +  + ++EI LL 
Sbjct: 13 FGVVYKGLNLETGDFVAIKQISL--EKIKEEALK-SIMQEIDLLK 54


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein
          Kinases (PKs), catalytic (c) domain. PKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine or tyrosine residues on protein
          substrates. The PK family is part of a larger
          superfamily that includes the catalytic domains of RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, phosphoinositide 3-kinase (PI3K), and
          actin-fragmin kinase. PKs make up a large family of
          serine/threonine kinases, protein tyrosine kinases
          (PTKs), and dual-specificity PKs that phosphorylate
          both serine/threonine and tyrosine residues of target
          proteins. Majority of protein phosphorylation, about
          95%, occurs on serine residues while only 1% occurs on
          tyrosine residues. Protein phosphorylation is a
          mechanism by which a wide variety of cellular proteins,
          such as enzymes and membrane channels, are reversibly
          regulated in response to certain stimuli. PKs often
          function as components of signal transduction pathways
          in which one kinase activates a second kinase, which in
          turn, may act on other kinases; this sequential action
          transmits a signal from the cell surface to target
          proteins, which results in cellular responses. The PK
          family is one of the largest known protein families
          with more than 100 homologous yeast enzymes and 550
          human proteins. A fraction of PK family members are
          pseudokinases that lack crucial residues for catalytic
          activity. The mutiplicity of kinases allows for
          specific regulation according to substrate, tissue
          distribution, and cellular localization. PKs regulate
          many cellular processes including proliferation,
          division, differentiation, motility, survival,
          metabolism, cell-cycle progression, cytoskeletal
          rearrangement, immunity, and neuronal functions. Many
          kinases are implicated in the development of various
          human diseases including different types of cancer.
          Length = 215

 Score = 36.4 bits (85), Expect = 4e-04
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLSVTISRENWLILRVI 62
          F TV+ ARD +T   VA+K IK    +   + +    LREI++L   ++  N  I+++ 
Sbjct: 6  FGTVYLARDKKTGKKVAIKIIKKEDSSSLLEEL----LREIEILK-KLNHPN--IVKLY 57


>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine
          Kinase, PCTAIRE-2 kinase.  Serine/Threonine Kinases
          (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The PCTAIRE-2 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares
          sequence similarity with Cyclin-Dependent Kinases
          (CDKs), which belong to a large family of STKs that are
          regulated by their cognate cyclins. Together, CDKs and
          cyclins are involved in the control of cell-cycle
          progression, transcription, and neuronal function.
          PCTAIRE-2 is specifically expressed in neurons in the
          central nervous system, mainly in terminally
          differentiated neurons. It associates with Trap (Tudor
          repeat associator with PCTAIRE-2) and could play a role
          in regulating mitochondrial function in neurons.
          Length = 309

 Score = 35.4 bits (81), Expect = 0.001
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 4/44 (9%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +ATVFK R   T+ +VA+K+I+L    + ++G   TA+RE+ LL
Sbjct: 19 YATVFKGRSKLTENLVALKEIRL----EHEEGAPCTAIREVSLL 58


>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase Like 5.
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase like 5 (CDKL5) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDKL5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. Mutations in the gene encoding CDKL5,
          previously called STK9, are associated with early onset
          epilepsy and severe mental retardation [X-linked
          infantile spasm syndrome (ISSX) or West syndrome]. In
          addition, CDKL5 mutations also sometimes cause a
          phenotype similar to Rett syndrome (RTT), a progressive
          neurodevelopmental disorder. These pathogenic mutations
          are located in the N-terminal portion of the protein
          within the kinase domain.
          Length = 287

 Score = 35.0 bits (80), Expect = 0.001
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLSVTISRENWLILR 60
          +  V K R  ET  IVA+KK K    ++  + +  T LRE+K+L  T+ +EN + L+
Sbjct: 14 YGVVLKCRHKETKEIVAIKKFK---DSEENEEVKETTLRELKMLR-TLKQENIVELK 66


>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine
          Kinase, PCTAIRE-3 kinase.  Serine/Threonine Kinases
          (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The PCTAIRE-3 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares
          sequence similarity with Cyclin-Dependent Kinases
          (CDKs), which belong to a large family of STKs that are
          regulated by their cognate cyclins. Together, CDKs and
          cyclins are involved in the control of cell-cycle
          progression, transcription, and neuronal function.
          PCTAIRE-3 shows a restricted pattern of expression and
          is present in brain, kidney, and intestine. It is
          elevated in Alzheimer's disease (AD) and has been shown
          to associate with paired helical filaments (PHFs) and
          stimulate Tau phosphorylation. As AD progresses,
          phosphorylated Tau aggregates and forms PHFs, which
          leads to the formation of neurofibrillary tangles
          (NFTs). In human glioma cells, PCTAIRE-3 induces cell
          cycle arrest and cell death.
          Length = 288

 Score = 34.6 bits (79), Expect = 0.002
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 4/44 (9%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +ATVFK R   T+ +VA+K+I+L    + ++G   TA+RE+ LL
Sbjct: 18 YATVFKGRSKLTENLVALKEIRL----EHEEGAPCTAIREVSLL 57


>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
          Kinase, Mitogen-Activated Protein Kinase.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase (MAPK) subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The MAPK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation. Typical MAPK pathways involve a triple
          kinase core cascade comprising of the MAPK, which is
          phosphorylated and activated by a MAPK kinase (MAP2K or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAP3K or MKKK). Each cascade is
          activated either by a small GTP-binding protein or by
          an adaptor protein, which transmits the signal either
          directly to a MAP3K to start the triple kinase core
          cascade or indirectly through a mediator kinase, a
          MAP4K. There are three main typical MAPK subfamilies:
          Extracellular signal-Regulated Kinase (ERK), c-Jun
          N-terminal Kinase (JNK), and p38. Some MAPKs are
          atypical in that they are not regulated by MAP2Ks.
          These include MAPK4, MAPK6, NLK, and ERK7.
          Length = 330

 Score = 34.8 bits (81), Expect = 0.002
 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 3/41 (7%)

Query: 7  VFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          V  A D  T   VA+KKI      D  D   +  LREIKLL
Sbjct: 16 VCSAVDKRTGRKVAIKKISN-VFDDLIDA--KRILREIKLL 53


>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine
          Kinase, PCTAIRE-1 kinase.  Serine/Threonine Kinases
          (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The PCTAIRE-1 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares
          sequence similarity with Cyclin-Dependent Kinases
          (CDKs), which belong to a large family of STKs that are
          regulated by their cognate cyclins. Together, CDKs and
          cyclins are involved in the control of cell-cycle
          progression, transcription, and neuronal function.
          PCTAIRE-1 is expressed ubiquitously and is localized in
          the cytoplasm. Its kinase activity is cell cycle
          dependent and peaks at the S and G2 phases. PCTAIRE-1
          is highly expressed in the brain and may play a role in
          regulating neurite outgrowth. It can also associate
          with Trap (Tudor repeat associator with PCTAIRE-2), a
          physiological partner of PCTAIRE-2; with p11, a small
          dimeric protein with similarity to S100; and with
          14-3-3 proteins, mediators of phosphorylation-dependent
          interactions in many different proteins.
          Length = 301

 Score = 34.6 bits (79), Expect = 0.002
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 4/44 (9%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +ATV+K R   TD +VA+K+I+L    + ++G   TA+RE+ LL
Sbjct: 19 YATVYKGRSKLTDNLVALKEIRL----EHEEGAPCTAIREVSLL 58


>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 4.
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase 4 (CDK4) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK4 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK4 partners with all three D-type cyclins
          (D1, D2, and D3) and is also regulated by INK4
          inhibitors. It is active towards the retinoblastoma
          (pRb) protein and plays a role in regulating the early
          G1 phase of the cell cycle. It is expressed
          ubiquitously and is localized in the nucleus. CDK4 also
          shows kinase activity towards Smad3, a signal
          transducer of transforming growth factor (TGF)-beta
          signaling which modulates transcription and plays a
          role in cell proliferation and apoptosis. CDK4 is
          inhibited by the p21 inhibitor and is specifically
          mutated in human melanoma.
          Length = 288

 Score = 34.6 bits (79), Expect = 0.002
 Identities = 16/44 (36%), Positives = 29/44 (65%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          + TV+KARD  +   VA+K +++ T+   +DG+  + +RE+ LL
Sbjct: 13 YGTVYKARDPHSGHFVALKSVRVQTN---EDGLPLSTVREVALL 53


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mitogen-Activated Protein
          Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MAPKKK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks)
          are also called MAP/ERK kinase kinases (MEKKs) in some
          cases. They phosphorylate and activate MAPK kinases
          (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
          and activate MAPKs during signaling cascades that are
          important in mediating cellular responses to
          extracellular signals. This subfamily is composed of
          the Apoptosis Signal-regulating Kinases ASK1 (or
          MAPKKK5) and ASK2 (or MAPKKK6), MEKK1, MEKK2, MEKK3,
          MEKK4, as well as plant and fungal MAPKKKs. Also
          included in this subfamily are the cell division
          control proteins Schizosaccharomyces pombe Cdc7 and
          Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 34.5 bits (80), Expect = 0.002
 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 3/45 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
          F +V+ A D +T  ++AVK ++L    D+++ +     REI++LS
Sbjct: 13 FGSVYLALDKDTGELMAVKSVELSG--DSEEELEAL-EREIRILS 54


>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein
          Serine/Threonine Kinases, Never In Mitosis gene
          A-related kinase 6 and 7.  Serine/Threonine Kinases
          (STKs), Never In Mitosis gene A (NIMA)-related kinase 6
          (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The Nek6/7 subfamily is part of a family of
          11 different Neks (Nek1-11) that are involved in cell
          cycle control. The Nek family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Nek6 and Nek7
          are the shortest Neks, consisting only of the catalytic
          domain and a very short N-terminal extension. They show
          distinct expression patterns and both appear to be
          downstream substrates of Nek9. They are required for
          mitotic spindle formation and cytokinesis. They may
          also be regulators of the p70 ribosomal S6 kinase.
          Length = 267

 Score = 34.3 bits (79), Expect = 0.002
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          F+ V+KA  +    +VA+KK+++    DAK    +  L+EI LL
Sbjct: 15 FSVVYKAICLLDGRVVALKKVQIFEMMDAKA--RQDCLKEIDLL 56


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase (Nek)
          family, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The Nek family is composed
          of 11 different mammalian members (Nek1-11) with
          similarity to the catalytic domain of Aspergillus
          nidulans NIMA kinase, the founding member of the Nek
          family which was identified in a screen for cell cycle
          mutants that were prevented from entering mitosis. Neks
          contain a conserved N-terminal catalytic domain and a
          more divergent C-terminal regulatory region of various
          sizes and structures. They are involved in the
          regulation of downstream processes following the
          activation of Cdc2, and many of their functions are
          cell cycle-related. They play critical roles in
          microtubule dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 33.6 bits (78), Expect = 0.003
 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 3/45 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
          F  V+  R      +  +K+I L ++   K+     AL E+K+L 
Sbjct: 13 FGKVYLVRRKSDGKLYVLKEIDL-SNMSEKE--REDALNEVKILK 54


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c)
          domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The STE family
          is part of a larger superfamily that includes the
          catalytic domains of other protein serine/threonine
          kinases (STKs), protein tyrosine kinases (PTKs), RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase (PI3K). This
          family is composed of STKs, and some dual-specificity
          PKs that phosphorylate both threonine and tyrosine
          residues of target proteins. Most members are kinases
          involved in mitogen-activated protein kinase (MAPK)
          signaling cascades, acting as MAPK kinases (MAPKKs),
          MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase
          kinases (MAP4Ks). The MAPK signaling pathways are
          important mediators of cellular responses to
          extracellular signals. The pathways involve a triple
          kinase core cascade comprising of the MAPK, which is
          phosphorylated and activated by a MAPKK, which itself
          is phosphorylated and activated by a MAPKKK. Each MAPK
          cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAPKKK to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. Other STE family members include
          p21-activated kinases (PAKs) and class III myosins,
          among others. PAKs are Rho family GTPase-regulated
          kinases that serve as important mediators in the
          function of Cdc42 (cell division cycle 42) and Rac.
          Class III myosins are motor proteins containing an
          N-terminal kinase catalytic domain and a C-terminal
          actin-binding domain, which can phosphorylate several
          cytoskeletal proteins, conventional myosin regulatory
          light chains, as well as autophosphorylate the
          C-terminal motor domain. They play an important role in
          maintaining the structural integrity of photoreceptor
          cell microvilli.
          Length = 253

 Score = 33.7 bits (78), Expect = 0.004
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 5/45 (11%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
          F  V+KAR   T   VA+K IKL +    +  IN     EI++L 
Sbjct: 13 FGEVYKARHKRTGKEVAIKVIKLESKEKKEKIIN-----EIQILK 52


>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like
          protein kinase 3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), mammalian Ste20-like
          protein kinase 3 (MST3)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MST3-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1
          and Sid1, Saccharomyces cerevisiae sporulation-specific
          protein 1 (SPS1), and related proteins. Nak1 is
          required by fission yeast for polarizing the tips of
          actin cytoskeleton and is involved in cell growth, cell
          separation, cell morphology and cell-cycle progression.
          Sid1 is a component in the septation initiation network
          (SIN) signaling pathway, and plays a role in
          cytokinesis. SPS1 plays a role in regulating proteins
          required for spore wall formation. MST4 plays a role in
          mitogen-activated protein kinase (MAPK) signaling
          during cytoskeletal rearrangement, morphogenesis, and
          apoptosis. MST3 phosphorylates the STK NDR and may play
          a role in cell cycle progression and cell morphology.
          STK25 may play a role in the regulation of cell
          migration and polarization.
          Length = 274

 Score = 33.0 bits (76), Expect = 0.007
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
          F  V+KA D  T+ +VA+K I L    D  + I     +EI+ LS
Sbjct: 14 FGEVYKAIDKRTNQVVAIKVIDLEEAEDEIEDIQ----QEIQFLS 54


>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity.
          Phosphotransferases. The specificity of this class of
          kinases can not be predicted. Possible dual-specificity
          Ser/Thr/Tyr kinase.
          Length = 258

 Score = 32.9 bits (76), Expect = 0.008
 Identities = 11/50 (22%), Positives = 19/50 (38%), Gaps = 8/50 (16%)

Query: 3  HFATVFKAR----DIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
           F  V+K          ++ VAVK +K        +      LRE +++ 
Sbjct: 11 AFGEVYKGTLKGKGDGKEVEVAVKTLKEDASEQQIEEF----LREARIMR 56


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
          cell-Associated Kinase-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Male germ
          cell-Associated Kinase (MAK)-like subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAK-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of human MAK and MAK-related kinase (MRK),
          Saccharomyces cerevisiae Ime2p, Schizosaccharomyces
          pombe Mei4-dependent protein 3 (Mde3) and Pit1,
          Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK,
          and similar proteins. These proteins play important
          roles during meiosis. MAK is highly expressed in
          testicular cells specifically in the meiotic phase, but
          is not essential for spermatogenesis and fertility. It
          functions as a coactivator of the androgen receptor in
          prostate cells. MRK, also called Intestinal Cell Kinase
          (ICK), is expressed ubiquitously, with highest
          expression in the ovary and uterus. A missense mutation
          in MRK causes endocrine-cerebro-osteodysplasia (ECO),
          suggesting that this protein plays an important role in
          the development of many organs. MAK and MRK may be
          involved in regulating cell cycle and cell fate. Ime2p
          is a meiosis-specific kinase that is important during
          meiotic initiation and during the later stages of
          meiosis. Mde3 functions downstream of the transcription
          factor Mei-4 which is essential for meiotic prophase I.
          Length = 283

 Score = 32.5 bits (75), Expect = 0.009
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 4/44 (9%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          F +V+ AR+ ET  +VA+KK+K       ++ +N   LRE+K L
Sbjct: 12 FGSVYLARNKETGELVAIKKMK-KKFYSWEECMN---LREVKSL 51


>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase. 
          Length = 258

 Score = 32.1 bits (74), Expect = 0.012
 Identities = 12/50 (24%), Positives = 20/50 (40%), Gaps = 8/50 (16%)

Query: 3  HFATVFKAR----DIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
           F  V+K         T+  VAVK +K G   + ++      L E  ++ 
Sbjct: 11 AFGEVYKGTLKGDGEGTETKVAVKTLKEGASEEEREEF----LEEASIMK 56


>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine
          Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. 
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase like 2 (CDKL2) and CDKL3 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDKL2 and CDKL3
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDKL2, also called p56 KKIAMRE, is expressed
          in testis, kidney, lung, and brain. It functions mainly
          in mature neurons and plays an important role in
          learning and memory. Inactivation of CDKL3, also called
          NKIAMRE (NKIATRE in rat), by translocation is
          associated with mild mental retardation. It has been
          reported that CDKL3 is lost in leukemic cells having a
          chromosome arm 5q deletion, and may contribute to the
          transformed phenotype.
          Length = 286

 Score = 32.4 bits (74), Expect = 0.012
 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +  V K +  ET  IVA+KK      ++    + + A+REI++L
Sbjct: 14 YGMVMKCKHKETGQIVAIKKF---LESEDDKMVKKIAMREIRML 54


>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
          dual-specificity MAP kinase kinases and similar
          proteins.  Protein kinases (PKs), MAP kinase kinase
          (MAPKK) subfamily, Plant MAPKKs and similar proteins,
          catalytic (c) domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The MAPKK
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein serine/threonine
          kinases, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising of the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). Members of this
          group include MAPKKs from plants, kinetoplastids,
          alveolates, and mycetozoa. The MAPKK, LmxPK4, from
          Leishmania mexicana, is important in differentiation
          and virulence. Dictyostelium discoideum MEK1 is
          required for proper chemotaxis. MEK1 null mutants
          display severe defects in cell polarization and
          directional movement. Plants contain multiple MAPKKs
          like other eukaryotes. The Arabidopsis genome encodes
          for 10 MAPKKs while poplar and rice contain 13 MAPKKs
          each. The functions of these proteins have not been
          fully elucidated. There is evidence to suggest that
          MAPK cascades are involved in plant stress responses.
          In Arabidopsis, MKK3 plays a role in pathogen
          signaling, MKK2 is involved in cold and salt stress
          signaling, MKK4/MKK5 participates in innate immunity,
          and MKK7 regulates basal and systemic acquired
          resistance.
          Length = 264

 Score = 32.2 bits (74), Expect = 0.014
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 4/48 (8%)

Query: 6  TVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLSVTISR 53
           V+K R   T  I A+KKI    H D  +   +  LRE+K L    S 
Sbjct: 16 VVYKVRHKPTGKIYALKKI----HVDGDEEFRKQLLRELKTLRSCESP 59


>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the
          Serine/Threonine Kinases, TEY Mitogen-Activated Protein
          Kinases from Plants.  Serine/Threonine Kinases (STKs),
          Plant TEY Mitogen-Activated Protein Kinase (MAPK)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          TEY MAPK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. In plants, MAPKs are associated with
          physiological, developmental, hormonal, and stress
          responses. Some plants show numerous gene duplications
          of MAPKs. Arabidopsis thaliana harbors at least 20
          MAPKs, named AtMPK1-20. There are two subtypes of plant
          MAPKs based on the conserved phosphorylation motif
          present in the activation loop, TEY and TDY. This
          subfamily represents the TEY subtype and is further
          subdivided into three groups (A, B, and C). Group A is
          represented by AtMPK3, AtMPK6, Nicotiana tabacum BTF4
          (NtNTF4), among others. They are mostly involved in
          environmental and hormonal responses. AtMPK3 and
          AtMPK6 are also key regulators for stomatal development
          and patterning. Group B is represented by AtMPK4,
          AtMPK13, and NtNTF6, among others. They may be involved
          in both cell division and environmental stress
          response. AtMPK4 also participates in regulating innate
          immunity. Group C is represented by AtMPK1, AtMPK2,
          NtNTF3, Oryza sativa MAPK4 (OsMAPK4), among others.
          They may also be involved in stress responses. AtMPK1
          and AtMPK2 are activated following mechanical injury
          and in the presence of stress chemicals such as
          jasmonic acid, hydrogen peroxide and abscisic acid.
          OsMAPK4 is also called OsMSRMK3 for Multiple
          Stress-Responsive MAPK3.
          Length = 337

 Score = 32.0 bits (73), Expect = 0.014
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 7  VFKARDIETDMIVAVKKIK--LGTHADAKDGINRTALREIKLLSVTISRENWLILRVILK 64
          V  A++ ET+  VA+KKI        DAK    RT LREIKLL   +  EN + ++ I+ 
Sbjct: 21 VCSAKNSETNEKVAIKKIANAFDNRIDAK----RT-LREIKLLR-HLDHENVIAIKDIMP 74


>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 8-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 8 (CDK8)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK8-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK8, CDC2L6,
          and similar proteins. CDK8 functions as a negative or
          positive regulator of transcription, depending on the
          scenario. Together with its regulator, cyclin C, it
          reversibly associates with the multi-subunit core
          Mediator complex, a cofactor that is involved in
          regulating RNA polymerase II (RNAP II)-dependent
          transcription. CDC2L6 also associates with Mediator in
          complexes lacking CDK8. In VP16-dependent
          transcriptional activation, CDK8 and CDC2L6 exerts
          opposing effects by positive and negative regulation,
          respectively, in similar conditions.
          Length = 316

 Score = 31.5 bits (72), Expect = 0.021
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 7  VFKARDIETDM--IVAVKKIKLGTHADAKDGINRTALREIKLLSVTISRENWLILRVILK 64
          V+KA+          A+KK K     +   GI+++A REI LL   +  EN + L  +  
Sbjct: 16 VYKAKRKNGKDGKEYAIKKFK--GDKEQYTGISQSACREIALLR-ELKHENVVSLVEVF- 71

Query: 65 MNLHKVTKS 73
            L    KS
Sbjct: 72 --LEHADKS 78


>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine
          Kinases, Mitogen-Activated Protein Kinases 4 and 6.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAPK4/6 subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. MAPK4 is also called ERK4 or p63MAPK, while
          MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6
          are atypical MAPKs that are not regulated by MAP2Ks.
          MAPK6 is expressed ubiquitously with highest amounts in
          brain and skeletal muscle. It may be involved in the
          control of cell differentiation by negatively
          regulating cell cycle progression in certain
          conditions. It may also play a role in glucose-induced
          insulin secretion. MAPK6 and MAPK4 cooperate to
          regulate the activity of MAPK-activated protein kinase
          5 (MK5), leading to its relocation to the cytoplasm and
          exclusion from the nucleus. The MAPK6/MK5 and MAPK4/MK5
          pathways may play critical roles in embryonic and
          post-natal development.
          Length = 342

 Score = 31.3 bits (71), Expect = 0.026
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 5/43 (11%)

Query: 5  ATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
            VF A D + D  VAVKKI L    D +    + ALREIK++
Sbjct: 19 GLVFSAVDSDCDKRVAVKKIVL---TDPQS--VKHALREIKII 56


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
          Serine/Threonine Kinase, Phosphoinositide-dependent
          kinase 1.  Serine/Threonine Kinases (STKs),
          Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The PDK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). PDK1 carries an
          N-terminal catalytic domain and a C-terminal pleckstrin
          homology (PH) domain that binds phosphoinositides. It
          phosphorylates the activation loop of AGC kinases that
          are regulated by PI3K such as PKB, SGK, and PKC, among
          others, and is crucial for their activation. Thus, it
          contributes in regulating many processes including
          metabolism, growth, proliferation, and survival. PDK1
          also has the ability to autophosphorylate and is
          constitutively active in mammalian cells. PDK1 is
          essential for normal embryo development and is
          important in regulating cell volume.
          Length = 280

 Score = 31.0 bits (71), Expect = 0.036
 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 23/69 (33%)

Query: 4  FATVFKARDIETDMIVAVK---KIKLGTHADAKDGINRTALREIKLLSVTISRENWLILR 60
          F+TV  A++ ET+   A+K   K +L              ++E K+  V I +E      
Sbjct: 14 FSTVVLAKEKETNKEYAIKILDKRQL--------------IKEKKVKYVKIEKE------ 53

Query: 61 VILKMNLHK 69
          V+ ++N H 
Sbjct: 54 VLTRLNGHP 62


>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
          Phosphotransferases. Tyrosine-specific kinase
          subfamily.
          Length = 257

 Score = 30.6 bits (70), Expect = 0.042
 Identities = 11/50 (22%), Positives = 20/50 (40%), Gaps = 8/50 (16%)

Query: 3  HFATVFKAR----DIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
           F  V+K +      +  + VAVK +K        +      LRE +++ 
Sbjct: 11 AFGEVYKGKLKGKGGKKKVEVAVKTLKEDASEQQIEEF----LREARIMR 56


>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein
          Serine/Threonine Kinase, MAP/ERK kinase kinase 1.
          Serine/threonine kinases (STKs), MAP/ERK kinase kinase
          1 (MEKK1) subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The MEKK1 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MEKK1 is a
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK or MKKK or MAP3K), that phosphorylates and
          activates MAPK kinases (MAPKKs or MKKs or MAP2Ks),
          which in turn phosphorylate and activate MAPKs during
          signaling cascades that are important in mediating
          cellular responses to extracellular signals. MEKK1
          activates the extracellular signal-regulated kinase 1/2
          (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by
          activating their respective MAPKKs, MEK1/2 and
          MKK4/MKK7, respectively. MEKK1 is important in
          regulating cell survival and apoptosis. MEKK1 also
          plays a role in cell migration, tissue maintenance and
          homeostasis, and wound healing.
          Length = 268

 Score = 30.6 bits (69), Expect = 0.046
 Identities = 11/46 (23%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 4  FATVFKARDIETDMIVAVKKIKL-GTHADAKDGINRTALREIKLLS 48
          F++ ++ARD++T  ++AVK++      +  ++ +     +EI+L++
Sbjct: 13 FSSCYQARDVKTGTLMAVKQVTYVRNTSSEQEEVVEALRKEIRLMA 58


>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine
          Kinase, Fungal Mitogen-Activated Protein Kinase MPK1.
          Serine/Threonine Kinases (STKs), Fungal
          Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MPK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1
          from Schizosaccharomyces pombe, and similar proteins.
          MAPKs are important mediators of cellular responses to
          extracellular signals. MPK1 (also called Slt2) and Pmk1
          (also called Spm1) are stress-activated MAPKs that
          regulate the cell wall integrity (CWI) pathway, and are
          therefore important in the maintainance of cell shape,
          cell wall construction, morphogenesis, and ion
          homeostasis. MPK1 is activated in response to cell wall
          stress including heat stimulation, osmotic shock, UV
          irradiation, and any agents that interfere with cell
          wall biogenesis such as chitin antagonists, caffeine,
          or zymolase. MPK1 is regulated by the MAP2Ks Mkk1/2,
          which are regulated by the MAP3K Bck1. Pmk1 is also
          activated by multiple stresses including elevated
          temperatures, hyper- or hypotonic stress, glucose
          deprivation, exposure to cell-wall damaging compounds,
          and oxidative stress. It is regulated by the MAP2K
          Pek1, which is regulated by the MAP3K Mkh1.
          Length = 332

 Score = 30.4 bits (69), Expect = 0.055
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 5/46 (10%)

Query: 4  FATVFKARDIET--DMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +  V  AR+ ET  +  VA+KKI   T+  +K  + + ALRE+KLL
Sbjct: 13 YGIVCSARNAETSEEETVAIKKI---TNVFSKKILAKRALRELKLL 55


>gnl|CDD|236042 PRK07525, PRK07525, sulfoacetaldehyde acetyltransferase; Validated.
          Length = 588

 Score = 30.4 bits (69), Expect = 0.064
 Identities = 10/23 (43%), Positives = 12/23 (52%)

Query: 12  DIETDMIVAVKKIKLGTHADAKD 34
           DI  D I   KK+ +G   DAK 
Sbjct: 301 DINPDRIGLTKKVSVGICGDAKA 323


>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity
          Protein Kinase, Mitogen-Activated Protein Kinase
          Kinase.  Protein kinases (PKs), MAP kinase kinase
          (MAPKK) subfamily, catalytic (c) domain. PKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine or tyrosine residues on protein
          substrates. The MAPKK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein serine/threonine kinases, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK or MAP2K), which itself is phosphorylated and
          activated by a MAPK kinase kinase (MAPKKK or MKKK or
          MAP3K). MAPKKs are dual-specificity PKs that
          phosphorylate their downstream targets, MAPKs, at
          specific threonine and tyrosine residues. There are
          three MAPK subfamilies: extracellular signal-regulated
          kinase (ERK), c-Jun N-terminal kinase (JNK), and p38.
          In mammalian cells, there are seven MAPKKs (named
          MKK1-7) and 20 MAPKKKs. Each MAPK subfamily can be
          activated by at least two cognate MAPKKs and by
          multiple MAPKKKs.
          Length = 265

 Score = 30.0 bits (68), Expect = 0.075
 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 4/42 (9%)

Query: 6  TVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
           V K     T  I+AVK I      +  + I +  LRE+ +L
Sbjct: 16 VVSKVLHRPTGKIMAVKTI----RLEINEAIQKQILRELDIL 53


>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine
          Kinase, Mitogen-Activated Protein Kinase 15.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase 15 (MAPK15) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAPK15 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. Human MAPK15 is also called Extracellular
          signal Regulated Kinase 8 (ERK8) while the rat protein
          is called ERK7. ERK7 and ERK8 display both similar and
          different biochemical properties. They
          autophosphorylate and activate themselves and do not
          require upstream activating kinases. ERK7 is
          constitutively active and is not affected by
          extracellular stimuli whereas ERK8 shows low basal
          activity and is activated by DNA-damaging agents. ERK7
          and ERK8 also have different substrate profiles. Genome
          analysis shows that they are orthologs with similar
          gene structures. ERK7 and ERK 8 may be involved in the
          signaling of some nuclear receptor transcription
          factors. ERK7 regulates hormone-dependent degradation
          of estrogen receptor alpha while ERK8 down-regulates
          the transcriptional co-activation androgen and
          glucocorticoid receptors.
          Length = 337

 Score = 29.9 bits (68), Expect = 0.080
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 7/43 (16%)

Query: 7  VFKARDIETDMIVAVKKI--KLGTHADAKDGINRTALREIKLL 47
          V+KA D  T  +VA+KKI        DA+    RT  REI  L
Sbjct: 23 VWKAIDRRTKEVVALKKIFDAFRNATDAQ----RT-FREIMFL 60


>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine
          Kinase, MAPK/MAK/MRK Overlapping Kinase.
          Serine/Threonine Kinases (STKs), MAPK/MAK/MRK
          Overlapping Kinase (MOK) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MOK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MOK, also called Renal tumor
          antigen 1 (RAGE-1), is widely expressed and is enriched
          in testis, kidney, lung, and brain. It is expressed in
          approximately 50% of renal cell carcinomas (RCC) and is
          a potential target for immunotherapy. MOK is stabilized
          by its association with the HSP90 molecular chaperone.
          It is induced by the transcription factor Cdx2 and may
          be involved in regulating intestinal epithelial
          development and differentiation.
          Length = 282

 Score = 29.5 bits (67), Expect = 0.12
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          F+ V KA+  +T    A+K +K   H  + + +N   LREI+ L
Sbjct: 12 FSEVLKAQSRKTGKYYAIKCMK--KHFKSLEQVNN--LREIQAL 51


>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine
          Kinase,  Extracellular signal-Regulated Kinase 5.
          Serine/Threonine Kinases (STKs), Extracellular
          signal-Regulated Kinase 5 (ERK5) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The ERK5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7,
          has a unique C-terminal extension, making it
          approximately twice as big as other MAPKs. This
          extension contains transcriptional activation
          capability which is inhibited by the N-terminal half.
          ERK5 is activated in response to growth factors and
          stress by a cascade that leads to its phosphorylation
          by the MAP2K MEK5, which in turn is regulated by the
          MAP3Ks MEKK2 and MEKK3. Activated ERK5 phosphorylates
          its targets including myocyte enhancer factor 2 (MEF2),
          Sap1a, c-Myc, and RSK. It plays a role in EGF-induced
          cell proliferation during the G1/S phase transition.
          Studies on knockout mice revealed that ERK5 is
          essential for cardiovascular development and plays an
          important role in angiogenesis. It is also critical for
          neural differentiation and survival. The ERK5 pathway
          has been implicated in the pathogenesis of many
          diseases including cancer, cardiac hypertrophy, and
          atherosclerosis.
          Length = 334

 Score = 29.6 bits (67), Expect = 0.12
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLSVTISRENWLILRVIL 63
          +  V  A D  +   VA+KKI    HA     + +  LRE+K+L      +N + +R IL
Sbjct: 18 YGVVCSAIDTRSGKKVAIKKI---PHAFDVPTLAKRTLRELKILR-HFKHDNIIAIRDIL 73

Query: 64 K 64
          +
Sbjct: 74 R 74


>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine
          Kinases, Fungal Mitogen-Activated Protein Kinases Sty1
          and Hog1.  Serine/Threonine Kinases (STKs), Fungal
          Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Sty1/Hog1 subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1
          from Saccharomyces cerevisiae, and similar proteins.
          MAPKs are important mediators of cellular responses to
          extracellular signals. Sty1 and Hog1 are
          stress-activated MAPKs that partipate in
          transcriptional regulation in response to stress. Sty1
          is activated in response to oxidative stress, osmotic
          stress, and UV radiation. Sty1 is regulated by the
          MAP2K Wis1, which is activated by the MAP3Ks Wis4 and
          Win1, which receive signals of the stress condition
          from membrane-spanning histidine kinases Mak1-3.
          Activated Sty1 stabilizes the Atf1 transcription factor
          and induces transcription of Atf1-dependent genes of
          the core environmetal stress response (CESR). Hog1 is
          the key element in the high osmolarity glycerol (HOG)
          pathway and is activated upon hyperosmotic stress.
          Activated Hog1 accumulates in the nucleus and regulates
          stress-induced transcription. The HOG pathway is
          mediated by two transmembrane osmosensors, Sln1 and
          Sho1.
          Length = 328

 Score = 29.4 bits (66), Expect = 0.12
 Identities = 22/49 (44%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 1  MTHFATVFKARDIETDMIVAVKKI--KLGTHADAKDGINRTALREIKLL 47
          M  F  V  ARD  T   VA+KKI     T   AK    RT  RE+KLL
Sbjct: 20 MGAFGLVCSARDQLTGQNVAIKKIMKPFSTPVLAK----RT-YRELKLL 63


>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases.
          Protein Tyrosine Kinase (PTK) family, catalytic domain.
          This PTKc family is part of a larger superfamily that
          includes the catalytic domains of protein
          serine/threonine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. They can
          be classified into receptor and non-receptor tyr
          kinases. PTKs play important roles in many cellular
          processes including, lymphocyte activation, epithelium
          growth and maintenance, metabolism control,
          organogenesis regulation, survival, proliferation,
          differentiation, migration, adhesion, motility, and
          morphogenesis. Receptor tyr kinases (RTKs) are integral
          membrane proteins which contain an extracellular
          ligand-binding region, a transmembrane segment, and an
          intracellular tyr kinase domain. RTKs are usually
          activated through ligand binding, which causes
          dimerization and autophosphorylation of the
          intracellular tyr kinase catalytic domain, leading to
          intracellular signaling. Some RTKs are orphan receptors
          with no known ligands. Non-receptor (or cytoplasmic)
          tyr kinases are distributed in different intracellular
          compartments and are usually multi-domain proteins
          containing a catalytic tyr kinase domain as well as
          various regulatory domains such as SH3 and SH2. PTKs
          are usually autoinhibited and require a mechanism for
          activation. In many PTKs, the phosphorylation of tyr
          residues in the activation loop is essential for
          optimal activity. Aberrant expression of PTKs is
          associated with many development abnormalities and
          cancers.
          Length = 262

 Score = 29.0 bits (66), Expect = 0.14
 Identities = 12/49 (24%), Positives = 21/49 (42%), Gaps = 7/49 (14%)

Query: 3  HFATVFKAR---DIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
           F  V+K +          VAVK +K     DA +   +  L+E +++ 
Sbjct: 7  AFGEVYKGKLKGKDGKTTEVAVKTLK----EDASEEERKDFLKEARVMK 51


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein
          Serine/Threonine Kinase, p21-activated kinase.
          Serine/threonine kinases (STKs), p21-activated kinase
          (PAK) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          PAK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. PAKs are Rho family
          GTPase-regulated kinases that serve as important
          mediators in the function of Cdc42 (cell division cycle
          42) and Rac. PAKs are implicated in the regulation of
          many cellular processes including growth factor
          receptor-mediated proliferation, cell polarity, cell
          motility, cell death and survival, and actin
          cytoskeleton organization. PAK deregulation is
          associated with tumor development. PAKs from higher
          eukaryotes are classified into two groups (I and II),
          according to their biochemical and structural features.
          Group I PAKs contain a PBD (p21-binding domain)
          overlapping with an AID (autoinhibitory domain), a
          C-terminal catalytic domain, SH3 binding sites and a
          non-classical SH3 binding site for PIX (PAK-interacting
          exchange factor). Group II PAKs contain a PBD and a
          catalytic domain, but lack other motifs found in group
          I PAKs. Since group II PAKs do not contain an obvious
          AID, they may be regulated differently from group I
          PAKs. Group I PAKs interact with the SH3 containing
          proteins Nck, Grb2 and PIX; no such binding has been
          demonstrated for group II PAKs.
          Length = 286

 Score = 27.6 bits (62), Expect = 0.52
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 6/41 (14%)

Query: 7  VFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          V+KA D  T   VA+KK++L      K+ I    + EI ++
Sbjct: 35 VYKATDRATGKEVAIKKMRLR--KQNKELI----INEILIM 69


>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine
          Kinase, PFTAIRE-2 kinase.  Serine/Threonine Kinases
          (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The PFTAIRE-2 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares
          sequence similarity with Cyclin-Dependent Kinases
          (CDKs), which belong to a large family of STKs that are
          regulated by their cognate cyclins. Together, CDKs and
          cyclins are involved in the control of cell-cycle
          progression, transcription, and neuronal function.
          PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic
          lateral sclerosis 2 (juvenile) chromosome region
          candidate 7). It may be associated with amyotrophic
          lateral sclerosis 2 (ALS2), an autosomal recessive form
          of juvenile ALS. The function of PFTAIRE-2 is not yet
          known.
          Length = 291

 Score = 27.6 bits (61), Expect = 0.53
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +ATV+K        +VA+K I        ++G+  TA+RE  LL
Sbjct: 18 YATVYKGISRINGQLVALKVI----SMKTEEGVPFTAIREASLL 57


>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III
          myosin-like Protein Serine/Threonine Kinases.
          Serine/threonine kinases (STKs), Class III myosin-like
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          class III myosin-like subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Class III
          myosins are motor proteins with an N-terminal kinase
          catalytic domain and a C-terminal actin-binding motor
          domain. Class III myosins are present in the
          photoreceptors of invertebrates and vertebrates and in
          the auditory hair cells of mammals. The kinase domain
          of myosin III can phosphorylate several cytoskeletal
          proteins, conventional myosin regulatory light chains,
          and can autophosphorylate the C-terminal motor domain.
          Myosin III may play an important role in maintaining
          the structural integrity of photoreceptor cell
          microvilli. It may also function as a cargo carrier
          during light-dependent translocation, in photoreceptor
          cells, of proteins such as transducin and arrestin. The
          Drosophila class III myosin, called NinaC (Neither
          inactivation nor afterpotential protein C), is critical
          in normal adaptation and termination of photoresponse. 
          Vertebrates contain two isoforms of class III myosin,
          IIIA and IIIB. This subfamily also includes mammalian
          NIK-like embryo-specific kinase (NESK), Traf2- and
          Nck-interacting kinase (TNIK), mitogen-activated
          protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4
          or MAP4K4) and MAPKKKK6 (or MAP4K6). MAP4Ks are
          involved in some MAPK signaling pathways by activating
          a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each
          MAPK cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAP3K to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. MAPK signaling cascades are important
          in mediating cellular responses to extracellular
          signals.
          Length = 275

 Score = 27.2 bits (61), Expect = 0.60
 Identities = 8/19 (42%), Positives = 13/19 (68%)

Query: 4  FATVFKARDIETDMIVAVK 22
          +  V+KAR  +T  +VA+K
Sbjct: 19 YGKVYKARHKKTGQLVAIK 37


>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine
          Kinase, p38 Mitogen-Activated Protein Kinase.
          Serine/Threonine Kinases (STKs), p38 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The p38 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They function in the regulation
          of the cell cycle, cell development, cell
          differentiation, senescence, tumorigenesis, apoptosis,
          pain development and pain progression, and immune
          responses. p38 kinases are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. p38 substrates include other protein kinases
          and factors that regulate transcription, nuclear
          export, mRNA stability and translation. p38 kinases are
          drug targets for the inflammatory diseases psoriasis,
          rheumatoid arthritis, and chronic pulmonary disease.
          Vertebrates contain four isoforms of p38, named alpha,
          beta, gamma, and delta, which show varying substrate
          specificity and expression patterns. p38alpha and
          p38beta are ubiquitously expressed, p38gamma is
          predominantly found in skeletal muscle, and p38delta is
          found in the heart, lung, testis, pancreas, and small
          intestine.
          Length = 343

 Score = 27.3 bits (61), Expect = 0.66
 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 11/48 (22%)

Query: 4  FATVFKARDIETDMIVAVKKI----KLGTHADAKDGINRTALREIKLL 47
          +  V  A D +T   VA+KK+    +   HA       +   RE++LL
Sbjct: 28 YGQVCSAFDTKTGRKVAIKKLSRPFQSAIHA-------KRTYRELRLL 68


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
          Serine/Threonine Kinases, Mammalian Ste20-like protein
          kinase 1 and 2.  Serine/threonine kinases (STKs),
          mammalian Ste20-like protein kinase 1 (MST1) and MST2
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MST1/2 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of MST1, MST2, and related proteins including
          Drosophila Hippo and Dictyostelium discoideum Krs1
          (kinase responsive to stress 1). MST1/2 and Hippo are
          involved in a conserved pathway that governs cell
          contact inhibition, organ size control, and tumor
          development. MST1 activates the mitogen-activated
          protein kinases (MAPKs) p38 and c-Jun N-terminal kinase
          (JNK) through MKK7 (a MAPK kinase) and MEKK1 (a MAPK
          kinase kinase) by acting as a MAPK kinase kinase kinase
          (MAPKKKK). Activation of JNK by MST1 leads to caspase
          activation and apoptosis. MST1 has also been implicated
          in cell proliferation and differentiation. Krs1 may
          regulate cell growth arrest and apoptosis in response
          to cellular stress.
          Length = 256

 Score = 26.5 bits (59), Expect = 1.2
 Identities = 8/21 (38%), Positives = 14/21 (66%)

Query: 4  FATVFKARDIETDMIVAVKKI 24
          + +V+KA   ET  +VA+K +
Sbjct: 16 YGSVYKAIHKETGQVVAIKVV 36


>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mitogen-activated protein
          kinase kinase kinase kinase 5.  Serine/threonine
          kinases (STKs), mitogen-activated protein kinase (MAPK)
          kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAP4K5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this subfamily
          contain an N-terminal catalytic domain and a C-terminal
          citron homology (CNH) regulatory domain, similar to
          MAP4K4/6. MAP4Ks are involved in some MAPK signaling
          pathways that are important in mediating cellular
          responses to extracellular signals by activating a MAPK
          kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
          cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAP3K to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. MAP4K5, also called germinal center
          kinase-related enzyme (GCKR), has been shown to
          activate the MAPK c-Jun N-terminal kinase (JNK). MAP4K5
          also facilitates Wnt signaling in B cells, and may
          therefore be implicated in the control of cell fate,
          proliferation, and polarity.
          Length = 267

 Score = 26.5 bits (58), Expect = 1.3
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 4  FATVFKARDIETDMIVAVKKIKL 26
          +  V+KAR++ T  + AVK IKL
Sbjct: 22 YGDVYKARNLHTGELAAVKIIKL 44


>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine
          Kinase, PFTAIRE-1 kinase.  Serine/Threonine Kinases
          (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The PFTAIRE-1 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares
          sequence similarity with Cyclin-Dependent Kinases
          (CDKs), which belong to a large family of STKs that are
          regulated by their cognate cyclins. Together, CDKs and
          cyclins are involved in the control of cell-cycle
          progression, transcription, and neuronal function.
          PFTAIRE-1 is widely expressed except in the spleen and
          thymus. It is highly expressed in the brain, heart,
          pancreas, testis, and ovary, and is localized in the
          cytoplasm. It is regulated by cyclin D3 and is
          inhibited by the p21 cell cycle inhibitor. It has also
          been shown to interact with the membrane-associated
          cyclin Y, which recruits the protein to the plasma
          membrane.
          Length = 303

 Score = 26.6 bits (58), Expect = 1.3
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 4/44 (9%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
          +ATV+K +      +VA+K I+L      ++G   TA+RE  LL
Sbjct: 18 YATVYKGKSKVNGKLVALKVIRL----QEEEGTPFTAIREASLL 57


>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein
          Serine/Threonine Kinases, Oxidative stress response
          kinase and Ste20-related proline alanine-rich kinase.
          Serine/threonine kinases (STKs), oxidative stress
          response kinase (OSR1) and Ste20-related proline
          alanine-rich kinase (SPAK) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The OSR1 and SPAK
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. SPAK is also referred to as
          STK39 or PASK (proline-alanine-rich STE20-related
          kinase). OSR1 and SPAK regulate the activity of
          cation-chloride cotransporters through direct
          interaction and phosphorylation. They are also
          implicated in cytoskeletal rearrangement, cell
          differentiation, transformation and proliferation. OSR1
          and SPAK contain a conserved C-terminal (CCT) domain,
          which recognizes a unique motif ([RK]FX[VI]) present in
          their activating kinases (WNK1/WNK4) and their
          substrates.
          Length = 267

 Score = 26.6 bits (59), Expect = 1.3
 Identities = 12/51 (23%), Positives = 24/51 (47%), Gaps = 5/51 (9%)

Query: 5  ATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLSVTISREN 55
          A V+ A  +  +  VA+K+I L     + D +     +E++ +S   +  N
Sbjct: 15 AVVYAAICLPNNEKVAIKRIDLEKCQTSVDEL----RKEVQAMS-QCNHPN 60


>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like
          Protein Serine/Threonine Kinases.  Serine/threonine
          kinases (STKs), Nak1 subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The Nak1 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. This subfamily
          is composed of Schizosaccharomyces pombe Nak1,
          Saccharomyces cerevisiae Kic1p (kinase that interacts
          with Cdc31p) and related proteins. Nak1 (also known as
          N-rich kinase 1), is required by fission yeast for
          polarizing the tips of actin cytoskeleton and is
          involved in cell growth, cell separation, cell
          morphology and cell-cycle progression. Kic1p is
          required by budding yeast for cell integrity and
          morphogenesis. Kic1p interacts with Cdc31p, the yeast
          homologue of centrin, and phosphorylates substrates in
          a Cdc31p-dependent manner.
          Length = 277

 Score = 26.2 bits (58), Expect = 1.8
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
          +  V++ + + T  +VA+K I L T  D    I     RE+ LLS
Sbjct: 14 YGAVYRGKHVPTGRVVALKIINLDTPDDDVSDIQ----REVALLS 54


>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein
          Serine/Threonine Kinase, Chlamydomonas reinhardtii
          CNK2,  and similar domains.  Serine/Threonine Kinases
          (STKs), Chlamydomonas reinhardtii Never In Mitosis gene
          A (NIMA)-related kinase 1 (CNK2)-like subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The Chlamydomonas
          reinhardtii CNK2-like subfamily belongs to the
          (NIMA)-related kinase (Nek) family. The Nek family
          includes seven different Chlamydomonas Neks (CNKs 1-6
          and Fa2). This subfamily includes CNK1, and -2.  The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase.  Chlamydomonas reinhardtii
          CNK2 has both cilliary and cell cycle functions. It
          influences flagellar length through promoting flagellar
          disassembly, and it regulates cell size, through
          influencing the size threshold at which cells commit to
          mitosis.
          Length = 256

 Score = 25.9 bits (57), Expect = 1.9
 Identities = 12/48 (25%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL-SVT 50
          + +V+K + +  +   A+K++ LG+ +  +      A+ EI++L SV 
Sbjct: 13 YGSVYKVKRLSDNQFYALKEVDLGSMSQKE---REDAVNEIRILASVN 57


>gnl|CDD|226864 COG4457, SrfB, Uncharacterized protein conserved in bacteria,
           putative virulence factor [Function unknown].
          Length = 1014

 Score = 26.0 bits (57), Expect = 2.2
 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 8/56 (14%)

Query: 1   MTHFATVFKARD---IETDMIVAVKK-----IKLGTHADAKDGINRTALREIKLLS 48
           +    TV    +   +  D+++ V       I +  H D  DG+N+T   E++ LS
Sbjct: 235 VPEVKTVSDTLNVPAVPVDLVLDVGNSRTCGILIEDHPDENDGLNQTYELELRDLS 290


>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein
          Serine/Threonine Kinase, Thousand-and-one amino acids
          2.  Serine/threonine kinases (STKs), thousand-and-one
          amino acids 2 (TAO2) subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The TAO subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. TAO proteins
          possess mitogen-activated protein kinase (MAPK) kinase
          kinase (MAPKKK or MAP3K or MKKK) activity. MAPK
          signaling cascades are important in mediating cellular
          responses to extracellular signals. Human TAO2 is also
          known as prostate-derived Ste20-like kinase (PSK) and
          was identified in a screen for overexpressed RNAs in
          prostate cancer. TAO2 activates both p38 and c-Jun
          N-terminal kinase (JNK), by phosphorylating and
          activating the respective MAP/ERK kinases (MEKs, also
          known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. TAO2
          contains a long C-terminal extension with
          autoinhibitory segments. It is activated by the release
          of this inhibition and the phosphorylation of its
          activation loop serine. TAO2 functions as a regulator
          of actin cytoskeletal and microtubule organization. In
          addition, it regulates the transforming growth
          factor-activated kinase 1 (TAK1), which is a MAPKKK
          that plays an essential role in the signaling pathways
          of tumor necrosis factor (TNF), interleukin 1 (IL-1),
          and Toll-like receptor (TLR).
          Length = 308

 Score = 25.8 bits (56), Expect = 2.4
 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 4  FATVFKARDIETDMIVAVKKIKL-GTHADAKDGINRTALREIKLL 47
          F  V+ ARD+    +VA+KK+   G  ++ K    +  ++E++ L
Sbjct: 28 FGAVYFARDVRNSEVVAIKKMSYSGKQSNEK---WQDIIKEVRFL 69


>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein
          Serine/Threonine Kinase, Thousand-and-one amino acids
          proteins.  Serine/threonine kinases (STKs),
          thousand-and-one amino acids (TAO) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The TAO subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. TAO proteins possess
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK or MAP3K or MKKK) activity. They activate the
          MAPKs, p38 and c-Jun N-terminal kinase (JNK), by
          phosphorylating and activating the respective MAP/ERK
          kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6
          and MKK4/MKK7. MAPK signaling cascades are important in
          mediating cellular responses to extracellular signals.
          Vertebrates contain three TAO subfamily members, named
          TAO1, TAO2, and TAO3.
          Length = 307

 Score = 25.9 bits (57), Expect = 2.4
 Identities = 10/21 (47%), Positives = 16/21 (76%)

Query: 4  FATVFKARDIETDMIVAVKKI 24
          F  V+ ARD+ T+ +VA+KK+
Sbjct: 28 FGAVYFARDVRTNEVVAIKKM 48


>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine
          Kinase, Colony-Stimulating Factor-1 Receptor.  Protein
          Tyrosine Kinase (PTK) family; Colony-Stimulating
          Factor-1 Receptor (CSF-1R); catalytic (c) domain. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. CSF-1R,
          also called c-Fms, is a member of the Platelet Derived
          Growth Factor Receptor (PDGFR) subfamily of proteins,
          which are receptor tyr kinases (RTKs) containing an
          extracellular ligand-binding region with five
          immunoglobulin-like domains, a transmembrane segment,
          and an intracellular catalytic domain. The binding of
          CSF-1R to its ligand, CSF-1, leads to receptor
          dimerization, trans phosphorylation and activation, and
          intracellular signaling. CSF-1R signaling is critical
          in the regulation of macrophages and osteoclasts. It
          leads to increases in gene transcription and protein
          translation, and induces cytoskeletal remodeling.
          CSF-1R signaling leads to a variety of cellular
          responses including survival, proliferation, and
          differentiation of target cells. It plays an important
          role in innate immunity, tissue development and
          function, and the pathogenesis of some diseases
          including atherosclerosis and cancer. CSF-1R signaling
          is also implicated in mammary gland development during
          pregnancy and lactation. Aberrant CSF-1/CSF-1R
          expression correlates with tumor cell invasiveness,
          poor clinical prognosis, and bone metastasis in breast
          cancer. Although the structure of the human CSF-1R
          catalytic domain is known, it is excluded from this
          specific alignment model because it contains a deletion
          in its sequence.
          Length = 374

 Score = 25.6 bits (56), Expect = 2.8
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 5  ATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
          AT F     +  + VAVK +K   H D ++ +    + E+K+LS
Sbjct: 57 ATAFGLGKEDNVLRVAVKMLKASAHTDEREAL----MSELKILS 96


>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein
          Serine/Threonine Kinase, Thousand-and-one amino acids
          1.  Serine/threonine kinases (STKs), thousand-and-one
          amino acids 1 (TAO1) subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The TAO subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. TAO proteins
          possess mitogen-activated protein kinase (MAPK) kinase
          kinase (MAPKKK or MAP3K or MKKK) activity. MAPK
          signaling cascades are important in mediating cellular
          responses to extracellular signals. TAO1 is sometimes
          referred to as prostate-derived sterile 20-like kinase
          2 (PSK2). TAO1 activates the p38 MAPK through direct
          interaction with and activation of MEK3. TAO1 is highly
          expressed in the brain and may play a role in neuronal
          apoptosis. TAO1 interacts with the checkpoint proteins
          BubR1 and Mad2, and plays an important role in
          regulating mitotic progression, which is required for
          both chromosome congression and checkpoint-induced
          anaphase delay. TAO1 may play a role in protecting
          genomic stability.
          Length = 317

 Score = 25.4 bits (55), Expect = 3.0
 Identities = 10/21 (47%), Positives = 16/21 (76%)

Query: 4  FATVFKARDIETDMIVAVKKI 24
          F  V+ ARD+ T+ +VA+KK+
Sbjct: 38 FGAVYFARDVRTNEVVAIKKM 58


>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mitogen-activated protein
          kinase kinase kinase kinase 3.  Serine/threonine
          kinases (STKs), mitogen-activated protein kinase (MAPK)
          kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAP4K3 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this subfamily
          contain an N-terminal catalytic domain and a C-terminal
          citron homology (CNH) regulatory domain, similar to
          MAP4K4/6. MAP4Ks are involved in some MAPK signaling
          pathways that are important in mediating cellular
          responses to extracellular signals by activating a MAPK
          kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
          cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAP3K to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. MAP4K3 plays a role in the
          nutrient-responsive pathway of mTOR (mammalian target
          of rapamycin) signaling. MAP4K3 is required in the
          activation of S6 kinase by amino acids and for the
          phosphorylation of the mTOR-regulated inhibitor of
          eukaryotic initiation factor 4E. mTOR regulates
          ribosome biogenesis and protein translation, and is
          frequently deregulated in cancer.
          Length = 267

 Score = 25.4 bits (55), Expect = 3.1
 Identities = 10/23 (43%), Positives = 16/23 (69%)

Query: 4  FATVFKARDIETDMIVAVKKIKL 26
          +  V+KAR++ T  + A+K IKL
Sbjct: 22 YGDVYKARNVNTGELAAIKVIKL 44


>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mammalian Ste20-like protein
          kinase 4.  Serine/threonine kinases (STKs), mammalian
          Ste20-like protein kinase 4 (MST4) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MST4 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MST4 is sometimes referred
          to as MASK (MST3 and SOK1-related kinase). It plays a
          role in mitogen-activated protein kinase (MAPK)
          signaling during cytoskeletal rearrangement,
          morphogenesis, and apoptosis. It influences cell growth
          and transformation by modulating the extracellular
          signal-regulated kinase (ERK) pathway. MST4 may also
          play a role in tumor formation and progression. It
          localizes in the Golgi apparatus by interacting with
          the Golgi matrix protein GM130 and may play a role in
          cell migration.
          Length = 277

 Score = 25.4 bits (55), Expect = 3.5
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 4/45 (8%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
          F  VFK  D  T  +VA+K I L    D  + I     +EI +LS
Sbjct: 17 FGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQ----QEITVLS 57


>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR
          kinase-like Protein Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Rho-associated
          coiled-coil containing protein kinase (ROCK) and
          Nuclear Dbf2-Related (NDR)-like kinase subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The ROCK- and NDR-like
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this subfamily
          include ROCK and ROCK-like proteins such as DMPK, MRCK,
          and CRIK, as well as NDR and NDR-like proteins such as
          LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of
          the small GTPase Rho, while MRCK is an effector of the
          small GTPase Cdc42. NDR and NDR-like kinases contain an
          N-terminal regulatory (NTR) domain and an insert within
          the catalytic domain that contains an auto-inhibitory
          sequence. Proteins in this subfamily are involved in
          regulating many cellular functions including
          contraction, motility, division, proliferation,
          apoptosis, morphogenesis, and cytokinesis.
          Length = 350

 Score = 25.3 bits (56), Expect = 3.6
 Identities = 7/23 (30%), Positives = 13/23 (56%)

Query: 3  HFATVFKARDIETDMIVAVKKIK 25
           F  V+  RD +T  + A+K ++
Sbjct: 13 AFGEVWLVRDKDTGQVYAMKVLR 35


>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Apoptosis signal-regulating
          kinase.  Serine/threonine kinases (STKs), Apoptosis
          signal-regulating kinase (ASK) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The ASK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Subfamily members are
          mitogen-activated protein kinase (MAPK) kinase kinases
          (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2,
          and MAPKKK15. MAPKKKs phosphorylate and activate MAPK
          kinases (MAPKKs or MKKs or MAP2Ks), which in turn
          phosphorylate and activate MAPKs during signaling
          cascades that are important in mediating cellular
          responses to extracellular signals. ASK1 (also called
          MAPKKK5) functions in the c-Jun N-terminal kinase (JNK)
          and p38 MAPK signaling pathways by directly activating
          their respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. It
          plays important roles in cytokine and stress responses,
          as well as in reactive oxygen species (ROS)-mediated
          cellular responses. ASK1 is implicated in various
          diseases mediated by oxidative stress including
          inschemic heart disease, hypertension, vessel injury,
          brain ischemia, Fanconi anemia, asthma, and pulmonary
          edema, among others. ASK2 (also called MAPKKK6)
          functions only in a heteromeric complex with ASK1, and
          can activate ASK1 by direct phosphorylation. The
          function of MAPKKK15 is still unknown.
          Length = 268

 Score = 25.2 bits (55), Expect = 3.6
 Identities = 8/21 (38%), Positives = 15/21 (71%)

Query: 4  FATVFKARDIETDMIVAVKKI 24
          +  V+ ARD+ T + +A+K+I
Sbjct: 21 YGIVYAARDLSTQVRIAIKEI 41


>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group I p21-activated kinase.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group I, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs are
           implicated in the regulation of many cellular processes
           including growth factor receptor-mediated proliferation,
           cell polarity, cell motility, cell death and survival,
           and actin cytoskeleton organization. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs, also called conventional PAKs, include
           PAK1, PAK2, and PAK3. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). They interact
           with the SH3 domain containing proteins Nck, Grb2 and
           PIX. Binding of group I PAKs to activated GTPases leads
           to conformational changes that destabilize the AID,
           allowing autophosphorylation and full activation of the
           kinase domain. Known group I PAK substrates include
           MLCK, Bad, Raf, MEK1, LIMK, Merlin, Vimentin, Myc,
           Stat5a, and Aurora A, among others.
          Length = 293

 Score = 25.2 bits (55), Expect = 3.9
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 8/77 (10%)

Query: 6   TVFKARDIETDMIVAVKKIKLGTHADAKDGINRT-ALREIK-------LLSVTISRENWL 57
           TV+ A D+ T   VA+K++ L      +  IN    +RE K       L S  +  E W+
Sbjct: 34  TVYTAIDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKHPNIVNYLDSYLVGDELWV 93

Query: 58  ILRVILKMNLHKVTKST 74
           ++  +   +L  V   T
Sbjct: 94  VMEYLAGGSLTDVVTET 110


>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine
          Kinase, Kit.  Protein Tyrosine Kinase (PTK) family; Kit
          (or c-Kit); catalytic (c) domain. The PTKc family is
          part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Kit is a
          member of the Platelet Derived Growth Factor Receptor
          (PDGFR) subfamily of proteins, which are receptor tyr
          kinases (RTKs) containing an extracellular
          ligand-binding region with five immunoglobulin-like
          domains, a transmembrane segment, and an intracellular
          catalytic domain. The binding of Kit to its ligand, the
          stem-cell factor (SCF), leads to receptor dimerization,
          trans phosphorylation and activation, and intracellular
          signaling. Kit is important in the development of
          melanocytes, germ cells, mast cells, hematopoietic stem
          cells, the interstitial cells of Cajal, and the
          pacemaker cells of the GI tract. Kit signaling is
          involved in major cellular functions including cell
          survival, proliferation, differentiation, adhesion, and
          chemotaxis. Mutations in Kit, which result in
          constitutive ligand-independent activation, are found
          in human cancers such as gastrointestinal stromal tumor
          (GIST) and testicular germ cell tumor (TGCT). The
          aberrant expression of Kit and/or SCF is associated
          with other tumor types such as systemic mastocytosis
          and cancers of the breast, neurons, lung, prostate,
          colon, and rectum.  Although the structure of the human
          Kit catalytic domain is known, it is excluded from this
          specific alignment model because it contains a deletion
          in its sequence.
          Length = 375

 Score = 25.2 bits (55), Expect = 4.1
 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 5  ATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
          AT +     +  M VAVK +K   H   ++ +    + E+K+LS
Sbjct: 54 ATAYGLFKSDAAMTVAVKMLKPSAHLTEREAL----MSELKVLS 93


>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine
          Kinases, Tropomyosin Related Kinases.  Protein Tyrosine
          Kinase (PTK) family; Tropomyosin Related Kinase (Trk)
          subfamily; catalytic (c) domain. The Trk subfamily
          consists of TrkA, TrkB, TrkC, and similar proteins. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Trk
          subfamily members are receptor tyr kinases (RTKs)
          containing an extracellular region with arrays of
          leucine-rich motifs flanked by two cysteine-rich
          clusters followed by two immunoglobulin-like domains, a
          transmembrane segment, and an intracellular catalytic
          domain. Binding to their ligands, the nerve growth
          factor (NGF) family of neutrotrophins, leads to Trk
          receptor oligomerization and activation of the
          catalytic domain. Trk receptors are mainly expressed in
          the peripheral and central nervous systems. They play
          important roles in cell fate determination, neuronal
          survival and differentiation, as well as in the
          regulation of synaptic plasticity. Altered expression
          of Trk receptors is associated with many human
          diseases.
          Length = 280

 Score = 25.1 bits (55), Expect = 4.1
 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 10/57 (17%)

Query: 4  FATVFKAR-----DIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLSVTISREN 55
          F  VF              +VAVK +K     DA+    +   RE +LL+     EN
Sbjct: 18 FGKVFLGECYHLEPENDKELVAVKTLKETASNDAR----KDFEREAELLT-NFQHEN 69


>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular
          signal-Regulated Kinase 1 and 2-like Serine/Threonine
          Kinases.  Serine/Threonine Kinases (STKs),
          Extracellular signal-regulated kinases 1 and 2 (ERK1/2)
          and Fus3 subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. This
          ERK1/2-like subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of the mitogen-activated protein kinases (MAPKs) ERK1,
          ERK2, baker's yeast Fus3, and similar proteins. MAPK
          pathways are important mediators of cellular responses
          to extracellular signals. ERK1/2 activation is
          preferentially by mitogenic factors, differentiation
          stimuli, and cytokines, through a kinase cascade
          involving the MAPK kinases MEK1/2 and a MAPK kinase
          kinase from the Raf family. ERK1/2 have numerous
          substrates, many of which are nuclear and participate
          in transcriptional regulation of many cellular
          processes. They regulate cell growth, cell
          proliferation, and cell cycle progression from G1 to S
          phase. Although the distinct roles of ERK1 and ERK2
          have not been fully determined, it is known that ERK2
          can maintain most functions in the absence of ERK1, and
          that the deletion of ERK2 is embryonically lethal. The
          MAPK, Fus3, regulates yeast mating processes including
          mating-specific gene expression, G1 arrest, mating
          projection, and cell fusion.
          Length = 336

 Score = 24.9 bits (55), Expect = 4.8
 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 4/42 (9%)

Query: 7  VFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLLS 48
          V  A    T + VA+KKI    H        RT LREIK+L 
Sbjct: 21 VCSATHKPTGVKVAIKKISPFEHQTF---CQRT-LREIKILR 58


>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the
          Serine/Threonine Kinases, TDY Mitogen-Activated Protein
          Kinases from Plants.  Serine/Threonine Kinases (STKs),
          Plant TDY Mitogen-Activated Protein Kinase (MAPK)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          TDY MAPK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. In plants, MAPKs are associated with
          physiological, developmental, hormonal, and stress
          responses. Some plants show numerous gene duplications
          of MAPKs. Arabidopsis thaliana harbors at least 20
          MAPKs, named AtMPK1-20. Oryza sativa contains at least
          17 MAPKs. There are two subtypes of plant MAPKs based
          on the conserved phosphorylation motif present in the
          activation loop, TEY and TDY. Arabidopsis thaliana
          contains more TEY-type MAPKs than TDY-type, whereas the
          reverse is true for Oryza sativa. This subfamily
          represents the TDY subtype and is composed of Group D
          plant MAPKs including Arabidopsis thaliana MPK18
          (AtMPK18), Oryza sativa Blast- and Wound-induced MAPK1
          (OsBWMK1), OsWJUMK1 (Wound- and JA-Uninducible MAPK1),
          Zea mays MPK6, and the Medicago sativa TDY1 gene
          product. OsBWMK1 enhances resistance to pathogenic
          infections. It mediates stress-activated defense
          responses by activating a transcription factor that
          affects the expression of stress-related genes. AtMPK18
          is involved in microtubule-related functions.
          Length = 338

 Score = 25.1 bits (55), Expect = 4.8
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 7/48 (14%)

Query: 4  FATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTA--LREIKLLSV 49
          +  V  A D  T   VA+KKI      D  + ++     LREIKLL +
Sbjct: 13 YGVVCSAIDTHTGEKVAIKKIN-----DVFEHVSDATRILREIKLLRL 55


>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 7.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek7 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek7 is required for mitotic
          spindle formation and cytokinesis. It is enriched in
          the centrosome and is critical for microtubule
          nucleation. Nek7 is activated by Nek9 during mitosis,
          and may regulate the p70 ribosomal S6 kinase.
          Length = 267

 Score = 24.6 bits (53), Expect = 5.7
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 3  HFATVFKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIKLL 47
           F+ V++A  +   + VA+KK+++    DAK       ++EI LL
Sbjct: 14 QFSEVYRATCLLDGVPVALKKVQIFDLMDAK--ARADCIKEIDLL 56


>gnl|CDD|176901 cd08892, SRPBCC_Aha1, Putative hydrophobic ligand-binding SRPBCC
           domain of the Hsp90 co-chaperone Aha1 and related
           proteins.  This subfamily includes the C-terminal SRPBCC
           (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of
           Aha1, and related domains. Proteins in this group belong
           to the SRPBCC domain superfamily of proteins which bind
           hydrophobic ligands. SRPBCC domains have a deep
           hydrophobic ligand-binding pocket. Aha1 is one of
           several co-chaperones, which regulate the dimeric
           chaperone Hsp90. Hsp90, Aha1, and other accessory
           proteins interact in a chaperone cycle driven by ATP
           binding and hydrolysis. Aha1 promotes dimerization of
           the N-terminal domains of Hsp90, and stimulates its low
           intrinsic ATPase activity. One Aha1 molecule binds per
           Hsp90 dimer. The N- and C- terminal domains of Aha1
           cooperatively bind across the dimer interface of Hsp90.
           The C-terminal domain of Aha1 binds the N-terminal Hsp90
           ATPase domain. Aha1 may regulate the dwell time of Hsp90
           with client proteins. Aha1 may act as either a negative
           or positive regulator of chaperone-dependent activation,
           depending on the client protein; for example, it acts as
           a negative regulator in the case of Saccharomyces
           cerevisiae MAL63 MAL-activator, and acts as a positive
           regulator in the case of glucocorticoid receptor and
           v-Src kinase. The mechanisms by which these opposing
           functions are achieved are unclear. Aha1 is upregulated
           in a number of tumor lines co-incident with the
           activation of several signaling kinases.
          Length = 126

 Score = 24.1 bits (53), Expect = 6.9
 Identities = 12/46 (26%), Positives = 21/46 (45%), Gaps = 3/46 (6%)

Query: 3   HFATV---FKARDIETDMIVAVKKIKLGTHADAKDGINRTALREIK 45
           H++TV   F  +D ET++ +    +  G     ++G  R     IK
Sbjct: 76  HYSTVTLTFTEKDDETELKLTQTGVPAGEEERTREGWERYYFESIK 121


>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
          Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
          Serine/threonine kinases (STKs), MAP/ERK kinase kinase
          4 (MEKK4) subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The MEKK4 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MEKK4 is a
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK or MKKK or MAP3K), that phosphorylates and
          activates MAPK kinases (MAPKKs or MKKs or MAP2Ks),
          which in turn phosphorylate and activate MAPKs during
          signaling cascades that are important in mediating
          cellular responses to extracellular signals. MEKK4
          activates the c-Jun N-terminal kinase (JNK) and p38
          MAPK signaling pathways by directly activating their
          respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. JNK and p38
          are collectively known as stress-activated MAPKs, as
          they are activated in response to a variety of
          environmental stresses and pro-inflammatory cytokines.
          MEKK4 also plays roles in the re-polarization of the
          actin cytoskeleton in response to osmotic stress, in
          the proper closure of the neural tube, in
          cardiovascular development, and in immune responses.
          Length = 264

 Score = 24.2 bits (53), Expect = 7.3
 Identities = 8/23 (34%), Positives = 17/23 (73%)

Query: 4  FATVFKARDIETDMIVAVKKIKL 26
          F  V+ A +++T  ++AVK+I++
Sbjct: 13 FGKVYTAVNLDTGELMAVKEIRI 35


>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein
          Serine/Threonine Kinase, Group II p21-activated kinase.
           Serine/threonine kinases (STKs), p21-activated kinase
          (PAK) subfamily, Group II, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The PAK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. PAKs are Rho
          family GTPase-regulated kinases that serve as important
          mediators in the function of Cdc42 (cell division cycle
          42) and Rac. PAKs from higher eukaryotes are classified
          into two groups (I and II), according to their
          biochemical and structural features. Group II PAKs,
          also called non-conventional PAKs, include PAK4, PAK5,
          and PAK6. Group II PAKs contain PBD (p21-binding
          domain) and catalytic domains, but lack other motifs
          found in group I PAKs, such as an AID (autoinhibitory
          domain) and SH3 binding sites. Since group II PAKs do
          not contain an obvious AID, they may be regulated
          differently from group I PAKs. While group I PAKs
          interact with the SH3 containing proteins Nck, Grb2 and
          PIX, no such binding has been demonstrated for group II
          PAKs. Some known substrates of group II PAKs are also
          substrates of group I PAKs such as Raf, BAD, LIMK and
          GEFH1. Unique group II substrates include MARK/Par-1
          and PDZ-RhoGEF. Group II PAKs play important roles in
          filopodia formation, neuron extension, cytoskeletal
          organization, and cell survival.
          Length = 285

 Score = 24.3 bits (53), Expect = 9.1
 Identities = 10/21 (47%), Positives = 11/21 (52%)

Query: 6  TVFKARDIETDMIVAVKKIKL 26
           V  A D  T   VAVKK+ L
Sbjct: 34 IVCIATDKSTGRQVAVKKMDL 54


>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of
          Microtubule-associated serine/threonine kinase-like
          proteins.  Serine/Threonine Kinases (STKs),
          Microtubule-associated serine/threonine (MAST) kinase
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MAST kinase subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The MAST kinase subfamily
          includes MAST kinases, MAST-like (MASTL) kinases, and
          fungal kinases with similarity to Saccharomyces
          cerevisiae Rim15 and Schizosaccharomyces pombe cek1.
          MAST kinases contain an N-terminal domain of unknown
          function, a central catalytic domain, and a C-terminal
          PDZ domain that mediates protein-protein interactions.
          MASTL kinases carry only a catalytic domain which
          contains a long insert relative to other kinases. The
          fungal kinases in this subfamily harbor other domains
          in addition to a central catalytic domain, which also
          contains an insert relative to MAST kinases like MASTL.
          Rim15 contains a C-terminal signal receiver (REC)
          domain while cek1 contains an N-terminal PAS domain.
          MAST kinases are cytoskeletal associated kinases of
          unknown function that are also expressed at
          neuromuscular junctions and postsynaptic densities. The
          fungal proteins Rim15 and cek1 are involved in the
          regulation of meiosis and mitosis, respectively.
          Length = 265

 Score = 24.1 bits (53), Expect = 9.6
 Identities = 9/22 (40%), Positives = 12/22 (54%)

Query: 4  FATVFKARDIETDMIVAVKKIK 25
          +  VF A+   T  I A+K IK
Sbjct: 6  YGRVFLAKKKSTGDIYAIKVIK 27


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.324    0.135    0.370 

Gapped
Lambda     K      H
   0.267   0.0807    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,763,992
Number of extensions: 290989
Number of successful extensions: 403
Number of sequences better than 10.0: 1
Number of HSP's gapped: 375
Number of HSP's successfully gapped: 91
Length of query: 78
Length of database: 10,937,602
Length adjustment: 47
Effective length of query: 31
Effective length of database: 8,852,964
Effective search space: 274441884
Effective search space used: 274441884
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (24.0 bits)