Diaphorina citri psyllid: psy9882


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MTTVNHYPFGKVPCIEINGVQYHQSRAIGRYLARQAGLYGMDGPEMDMKIDMIVDTIDDMRQGKDIIQSYRTLLSQTGGPV
cccccccccccccEEEEccEEEHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
****NHYPFGKVPCIEINGVQYHQSRAIGRYLARQAGLYGMDGPEMDMKIDMIVDTIDDMRQGKDIIQSYRTLLSQT*G**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTVNHYPFGKVPCIEINGVQYHQSRAIGRYLARQAGLYGMDGPEMDMKIDMIVDTIDDMRQGKDIIQSYRTLLSQTGGPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hematopoietic prostaglandin D synthase Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of aryl halides, organic isothiocyanates and alpha,beta-unsaturated carbonyls. Also exhibits low glutathione-peroxidase activity towards cumene hydroperoxide and t-butyl hydroperoxide.confidentO73888

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:0004364 [MF]glutathione transferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0070887 [BP]cellular response to chemical stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0006749 [BP]glutathione metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006575, GO:0043603, GO:0006082, GO:0006520, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0006790, GO:0019752, GO:0008152, GO:0043436, GO:0008150, GO:0006518, GO:0044281
GO:0043295 [MF]glutathione bindingprobableGO:1901681, GO:0043168, GO:0042277, GO:0072341, GO:1900750, GO:0031406, GO:0043167, GO:0003674, GO:0005488, GO:0033218, GO:0016597

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M0U, chain A
Confidence level:very confident
Coverage over the Query: 3-62
View the alignment between query and template
View the model in PyMOL