Diaphorina citri psyllid: psy9888


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MCTAVGAFYWLTDPDTSNCSFCQSLWNHPFFAISSAILNLKAFERRLTEVIACSGPSTKRWRLVLAFISMCTAVGAFYWLTDPDTSNCSFCQSLWNHPFFAISSAILIILFLLGIHKRVIAPSIITSRARLVLTDFNMSCDDSGKLILKPRPSTLS
cccEEccEEEccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcEEEccccccccccHHHHHHccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccEEECccccccc
MCTAVGAFYWLTDPDTSNCSFCQSLWNHPFFAISSAILNLKAFERRLTEVIACSGPSTKRWRLVLAFISMCTAVGAFYWLTDPDTSNCSFCQSLWNHPFFAISSAILIILFLLGIHKRVIAPSIITSRARLVLTDFNMSCDDSGKLI**PR*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCTAVGAFYWLTDPDTSNCSFCQSLWNHPFFAISSAILNLKAFERRLTEVIACSGPSTKRWRLVLAFISMCTAVGAFYWLTDPDTSNCSFCQSLWNHPFFAISSAILIILFLLGIHKRVIAPSIITSRARLVLTDFNMSCDDSGKLILKPRPSTLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear envelope phosphatase-regulatory subunit 1 Forms with the serine/threonine protein phosphatase CTDNEP1 an active complex which dephosphorylates and may activate LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol.confidentQ3UJ81
Nuclear envelope phosphatase-regulatory subunit 1 Forms with the serine/threonine protein phosphatase CTDNEP1 an active complex which dephosphorylates and may activate LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol.confidentQ3ZBP2
Nuclear envelope phosphatase-regulatory subunit 1 May form with the serine/threonine protein phosphatase ctdnep1 an active complex dephosphorylating and activating lipins. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol.confidentQ5M8F7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0071595 [CC]Nem1-Spo7 phosphatase complexprobableGO:0043234, GO:0008287, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0042175, GO:0012505, GO:0044425
GO:0035307 [BP]positive regulation of protein dephosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0035303, GO:0035304, GO:0035306, GO:0032268, GO:0031401, GO:0048522
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0034504 [BP]protein localization to nucleusprobableGO:0008104, GO:0070727, GO:0034613, GO:0044763, GO:0033365, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0010867 [BP]positive regulation of triglyceride biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031323, GO:0046890, GO:0050789, GO:0090208, GO:0031328, GO:0065007, GO:0048518, GO:0045834, GO:0010866, GO:0090207, GO:0019216, GO:0009889, GO:0050794, GO:0008150, GO:0046889, GO:0080090, GO:0048522
GO:0006629 [BP]lipid metabolic processprobableGO:0044238, GO:0044710, GO:0008150, GO:0008152, GO:0071704
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted