Diaphorina citri psyllid: psy9913

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31

MQACEFASGKPGKSPEVPEVKTESQIRLMHESCKLARFVLDCIAEHIKVNMTTNELDVFAHELIINNGAYPSPLNYKGYPKSICTSVNNVACHGIPDSRPLEDGDIVNVDVTVYLNGYHGDCSATFCVGEVDASGKFLVNVAQQALHAAISVVKPGEYFSTIGSIIENVAKQNKLRVVPEILGHGIGSYFHGAPDIFHTKNDYPGKMEPGSIIENVAKHNKLRVVPEILGHGIGSYFHGPPDIFHTKNDYPGKMEPGMTFTIEPVLTNGNGQVTMLEDGWTIVTEDDSRTAQFEHTVLVTYDGYKVLTY

ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccEEEcccccccccccccEEEEEEEEEEccEEcccccEEECccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccEEcccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEcccEEcccccccEEcccccCEEEccccccccccEEEEECccccEEccc

*QACEF*************VKTESQIRLMHESCKLARFVLDCIAEHIKVNMTTNELDVFAHELIINNGAYPSPLNYKGYPKSICTSVNNVACHGIPDSRPLEDGDIVNVDVTVYLNGYHGDCSATFCVGEVDASGKFLVNVAQQALHAAISVVKPGEYFSTIGSIIENVAKQNKLRVVPEILGHGIGSYFHGAPDIFHTKNDYPGKMEPGSIIENVAKHNKLRVVPEILGHGIGSYFHGPPDIFHTKNDYPGKMEPGMTFTIEPVLTNGNGQVTMLEDGWTIVTEDDSRTAQFEHTVLVTYDGYKVLTY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Methionine aminopeptidase 2	Removes the N-terminal methionine from nascent proteins, when the penultimate amino acid is alanine or proline, but enzyme activity is remarkably low when the second residue is phenylalanine or leucine. With glycine at the second position, Map is more active with a tetrapeptide than with a tripeptide.	confident	P0A5J2
Methionine aminopeptidase	Removes the N-terminal methionine from nascent proteins.	confident	P0A5J3
Methionine aminopeptidase	Removes the N-terminal methionine from nascent proteins.	confident	O84859

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0070006 [MF]	metalloaminopeptidase activity	probable	GO:0004177, GO:0016787, GO:0003824, GO:0008238, GO:0070011, GO:0003674, GO:0008233, GO:0008235, GO:0008237
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031365 [BP]	N-terminal protein amino acid modification	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0030145 [MF]	manganese ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0050897 [MF]	cobalt ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0016151 [MF]	nickel cation binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005506 [MF]	iron ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0035551 [BP]	protein initiator methionine removal involved in protein maturation	probable	GO:0044267, GO:0009987, GO:0044260, GO:0051604, GO:0044238, GO:0019538, GO:0043412, GO:0070084, GO:0006464, GO:0043170, GO:0071704, GO:0010467, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0016485
GO:0009737 [BP]	response to abscisic acid stimulus	probable	GO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0009725, GO:0042221, GO:0097305, GO:0010033
GO:0006555 [BP]	methionine metabolic process	probable	GO:0044238, GO:0044710, GO:0000096, GO:1901564, GO:0006082, GO:0019752, GO:0006520, GO:0044237, GO:0071704, GO:0006807, GO:0006790, GO:0009066, GO:0008152, GO:0043436, GO:0008150, GO:0009987, GO:1901605, GO:0044281

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.4.-.-	Acting on peptide bonds (peptide hydrolases).	probable
3.4.11.-	Aminopeptidases.	probable
3.4.11.18	Methionyl aminopeptidase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S6B, chain A
Confidence level:very confident
Coverage over the Query: 15-179,227-309
View the alignment between query and template
View the model in PyMOL

Template: 2G6P, chain A
Confidence level:very confident
Coverage over the Query: 1-212,260-308
View the alignment between query and template
View the model in PyMOL