Query psy9931
Match_columns 237
No_of_seqs 4 out of 6
Neff 1.6
Searched_HMMs 46136
Date Fri Aug 16 23:18:22 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy9931.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9931hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 COG2991 Uncharacterized protei 13.6 66 0.0014 25.2 0.1 12 158-169 43-54 (77)
2 COG0178 UvrA Excinuclease ATPa 11.2 1.3E+02 0.0028 32.1 1.4 13 147-159 888-900 (935)
3 PF04835 Pox_A9: A9 protein co 9.4 54 0.0012 24.2 -1.5 11 200-210 12-22 (54)
4 KOG0121|consensus 7.7 90 0.002 27.0 -1.0 40 113-152 73-112 (153)
5 PF14354 Lar_restr_allev: Rest 6.4 1.7E+02 0.0036 19.5 -0.1 8 35-42 3-10 (61)
6 PF06185 YecM: YecM protein; 5.4 3.1E+02 0.0068 23.9 1.0 9 170-178 168-176 (185)
7 cd00251 Mth_Ecto The ectodomai 5.0 3.1E+02 0.0067 23.2 0.7 13 50-62 54-67 (176)
8 PRK11700 hypothetical protein; 4.6 3.5E+02 0.0077 23.8 0.8 10 169-178 167-176 (187)
9 cd07268 Glo_EDI_BRP_like_4 Thi 4.1 4.1E+02 0.0089 22.7 0.8 10 170-179 131-140 (149)
10 COG2100 Predicted Fe-S oxidore 3.2 5.6E+02 0.012 25.3 0.9 18 138-155 121-142 (414)
No 1
>COG2991 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=13.59 E-value=66 Score=25.20 Aligned_cols=12 Identities=50% Similarity=1.373 Sum_probs=10.0
Q ss_pred CccccCCCCCcc
Q psy9931 158 SECSCDKPCSTS 169 (237)
Q Consensus 158 ~~~~~~~~~~~~ 169 (237)
-+|+||+||.|.
T Consensus 43 K~CdC~~pCDt~ 54 (77)
T COG2991 43 KVCDCDEPCDTH 54 (77)
T ss_pred hhcCCCCchHHH
Confidence 589999999863
No 2
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]
Probab=11.23 E-value=1.3e+02 Score=32.08 Aligned_cols=13 Identities=46% Similarity=0.797 Sum_probs=10.6
Q ss_pred eeeeceeeecCCc
Q psy9931 147 IKCADYVVDKSSE 159 (237)
Q Consensus 147 ~~~~~~~~~~~~~ 159 (237)
||.||||+|-..|
T Consensus 888 Ik~AD~IIDLGPe 900 (935)
T COG0178 888 IKTADWIIDLGPE 900 (935)
T ss_pred EeecCEEEEcCCC
Confidence 8999999997654
No 3
>PF04835 Pox_A9: A9 protein conserved region; InterPro: IPR006920 This entry represents a family of Chordopoxvirus A9 proteins. Chordopoxvirus belongs to the family Poxviridae and is the cause of vertebrate infections [].
Probab=9.37 E-value=54 Score=24.20 Aligned_cols=11 Identities=73% Similarity=1.286 Sum_probs=5.2
Q ss_pred eEEEEeeccce
Q psy9931 200 FCCVKLRPTSF 210 (237)
Q Consensus 200 ~c~vklrpts~ 210 (237)
||+-|+||.||
T Consensus 12 fce~k~R~NsF 22 (54)
T PF04835_consen 12 FCENKLRPNSF 22 (54)
T ss_pred HHHhhcCCchH
Confidence 34445555444
No 4
>KOG0121|consensus
Probab=7.75 E-value=90 Score=27.00 Aligned_cols=40 Identities=25% Similarity=0.255 Sum_probs=22.2
Q ss_pred EeeeeeeeeEEEeeecceeEEeeeeccceEEEeEeeeece
Q psy9931 113 VKLSPTSFCYVKLRPTSFCCVKLRPTSFCCVKLRIKCADY 152 (237)
Q Consensus 113 VhLs~cs~CsVhL~~~S~CsVhL~~cS~CsVhL~~~~~~~ 152 (237)
++++||+||-|.+.-..-=++-|+-=|.=....|+--+||
T Consensus 73 ~kktpCGFCFVeyy~~~dA~~AlryisgtrLddr~ir~D~ 112 (153)
T KOG0121|consen 73 FKKTPCGFCFVEYYSRDDAEDALRYISGTRLDDRPIRIDW 112 (153)
T ss_pred CCcCccceEEEEEecchhHHHHHHHhccCcccccceeeec
Confidence 5677777777766555444444443343344555555555
No 5
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar
Probab=6.41 E-value=1.7e+02 Score=19.50 Aligned_cols=8 Identities=50% Similarity=1.190 Sum_probs=3.8
Q ss_pred ecccceee
Q psy9931 35 LHPTSFCC 42 (237)
Q Consensus 35 L~~cs~C~ 42 (237)
|.||.|||
T Consensus 3 LkPCPFCG 10 (61)
T PF14354_consen 3 LKPCPFCG 10 (61)
T ss_pred CcCCCCCC
Confidence 44444444
No 6
>PF06185 YecM: YecM protein; InterPro: IPR010393 This family consists of several bacterial YecM proteins of unknown function.; PDB: 1K4N_A.
Probab=5.36 E-value=3.1e+02 Score=23.91 Aligned_cols=9 Identities=56% Similarity=0.885 Sum_probs=6.2
Q ss_pred eeEeEeeee
Q psy9931 170 FCCIKVHPI 178 (237)
Q Consensus 170 ~~~~~~~~~ 178 (237)
.=|||+||-
T Consensus 168 ~icIK~HP~ 176 (185)
T PF06185_consen 168 GICIKFHPH 176 (185)
T ss_dssp S-EEEEESS
T ss_pred CEEEEEcCc
Confidence 457888885
No 7
>cd00251 Mth_Ecto The ectodomain of Methuselah (Mth); Mth mutants have a 35% increase in average lifespan and increased resistance to several forms of stress, including heat, starvation, and oxidative damage; The protein affected by this mutation is related to G protein-coupled receptors of the secretin receptor family; Mth, like secretin receptor family members, has a large N-terminal ectodomain, which may constitute the ligand binding site.
Probab=5.03 E-value=3.1e+02 Score=23.24 Aligned_cols=13 Identities=54% Similarity=1.359 Sum_probs=9.3
Q ss_pred eeEEeeeec-ceeE
Q psy9931 50 FCCVKLRPT-SFCC 62 (237)
Q Consensus 50 ~Csvkl~~c-s~Cc 62 (237)
-|-|||+|| ++||
T Consensus 54 gCvC~lr~Cir~CC 67 (176)
T cd00251 54 GCVCKLKPCIRFCC 67 (176)
T ss_pred eEeeecCCeeeECC
Confidence 567788887 6666
No 8
>PRK11700 hypothetical protein; Provisional
Probab=4.61 E-value=3.5e+02 Score=23.79 Aligned_cols=10 Identities=50% Similarity=0.810 Sum_probs=7.6
Q ss_pred ceeEeEeeee
Q psy9931 169 SFCCIKVHPI 178 (237)
Q Consensus 169 ~~~~~~~~~~ 178 (237)
..-|||+||.
T Consensus 167 ~~vcIK~HP~ 176 (187)
T PRK11700 167 GGICIKFHPH 176 (187)
T ss_pred CCEEEEEcCc
Confidence 4568999985
No 9
>cd07268 Glo_EDI_BRP_like_4 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=4.15 E-value=4.1e+02 Score=22.74 Aligned_cols=10 Identities=50% Similarity=0.793 Sum_probs=7.8
Q ss_pred eeEeEeeeee
Q psy9931 170 FCCIKVHPII 179 (237)
Q Consensus 170 ~~~~~~~~~~ 179 (237)
.-|||+||.-
T Consensus 131 ~i~IK~HP~s 140 (149)
T cd07268 131 GICIKLHPHS 140 (149)
T ss_pred CEEEEEcCcC
Confidence 5789999953
No 10
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only]
Probab=3.16 E-value=5.6e+02 Score=25.25 Aligned_cols=18 Identities=50% Similarity=0.818 Sum_probs=0.0
Q ss_pred ccceEEEe----Eeeeeceeee
Q psy9931 138 TSFCCVKL----RIKCADYVVD 155 (237)
Q Consensus 138 cS~CsVhL----~~~~~~~~~~ 155 (237)
|-||||.+ |..-+||+||
T Consensus 121 CIfCSVdeGp~SrtR~~dy~Vd 142 (414)
T COG2100 121 CIFCSVDEGPYSRTRKLDYVVD 142 (414)
T ss_pred eEEEeccCCcccceeccceEec
Done!