Query         psy9931
Match_columns 237
No_of_seqs    4 out of 6
Neff          1.6 
Searched_HMMs 46136
Date          Fri Aug 16 23:18:22 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9931.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9931hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG2991 Uncharacterized protei  13.6      66  0.0014   25.2   0.1   12  158-169    43-54  (77)
  2 COG0178 UvrA Excinuclease ATPa  11.2 1.3E+02  0.0028   32.1   1.4   13  147-159   888-900 (935)
  3 PF04835 Pox_A9:  A9 protein co   9.4      54  0.0012   24.2  -1.5   11  200-210    12-22  (54)
  4 KOG0121|consensus                7.7      90   0.002   27.0  -1.0   40  113-152    73-112 (153)
  5 PF14354 Lar_restr_allev:  Rest   6.4 1.7E+02  0.0036   19.5  -0.1    8   35-42      3-10  (61)
  6 PF06185 YecM:  YecM protein;     5.4 3.1E+02  0.0068   23.9   1.0    9  170-178   168-176 (185)
  7 cd00251 Mth_Ecto The ectodomai   5.0 3.1E+02  0.0067   23.2   0.7   13   50-62     54-67  (176)
  8 PRK11700 hypothetical protein;   4.6 3.5E+02  0.0077   23.8   0.8   10  169-178   167-176 (187)
  9 cd07268 Glo_EDI_BRP_like_4 Thi   4.1 4.1E+02  0.0089   22.7   0.8   10  170-179   131-140 (149)
 10 COG2100 Predicted Fe-S oxidore   3.2 5.6E+02   0.012   25.3   0.9   18  138-155   121-142 (414)

No 1  
>COG2991 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=13.59  E-value=66  Score=25.20  Aligned_cols=12  Identities=50%  Similarity=1.373  Sum_probs=10.0

Q ss_pred             CccccCCCCCcc
Q psy9931         158 SECSCDKPCSTS  169 (237)
Q Consensus       158 ~~~~~~~~~~~~  169 (237)
                      -+|+||+||.|.
T Consensus        43 K~CdC~~pCDt~   54 (77)
T COG2991          43 KVCDCDEPCDTH   54 (77)
T ss_pred             hhcCCCCchHHH
Confidence            589999999863


No 2  
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]
Probab=11.23  E-value=1.3e+02  Score=32.08  Aligned_cols=13  Identities=46%  Similarity=0.797  Sum_probs=10.6

Q ss_pred             eeeeceeeecCCc
Q psy9931         147 IKCADYVVDKSSE  159 (237)
Q Consensus       147 ~~~~~~~~~~~~~  159 (237)
                      ||.||||+|-..|
T Consensus       888 Ik~AD~IIDLGPe  900 (935)
T COG0178         888 IKTADWIIDLGPE  900 (935)
T ss_pred             EeecCEEEEcCCC
Confidence            8999999997654


No 3  
>PF04835 Pox_A9:  A9 protein conserved region;  InterPro: IPR006920 This entry represents a family of Chordopoxvirus A9 proteins. Chordopoxvirus belongs to the family Poxviridae and is the cause of vertebrate infections [].
Probab=9.37  E-value=54  Score=24.20  Aligned_cols=11  Identities=73%  Similarity=1.286  Sum_probs=5.2

Q ss_pred             eEEEEeeccce
Q psy9931         200 FCCVKLRPTSF  210 (237)
Q Consensus       200 ~c~vklrpts~  210 (237)
                      ||+-|+||.||
T Consensus        12 fce~k~R~NsF   22 (54)
T PF04835_consen   12 FCENKLRPNSF   22 (54)
T ss_pred             HHHhhcCCchH
Confidence            34445555444


No 4  
>KOG0121|consensus
Probab=7.75  E-value=90  Score=27.00  Aligned_cols=40  Identities=25%  Similarity=0.255  Sum_probs=22.2

Q ss_pred             EeeeeeeeeEEEeeecceeEEeeeeccceEEEeEeeeece
Q psy9931         113 VKLSPTSFCYVKLRPTSFCCVKLRPTSFCCVKLRIKCADY  152 (237)
Q Consensus       113 VhLs~cs~CsVhL~~~S~CsVhL~~cS~CsVhL~~~~~~~  152 (237)
                      ++++||+||-|.+.-..-=++-|+-=|.=....|+--+||
T Consensus        73 ~kktpCGFCFVeyy~~~dA~~AlryisgtrLddr~ir~D~  112 (153)
T KOG0121|consen   73 FKKTPCGFCFVEYYSRDDAEDALRYISGTRLDDRPIRIDW  112 (153)
T ss_pred             CCcCccceEEEEEecchhHHHHHHHhccCcccccceeeec
Confidence            5677777777766555444444443343344555555555


No 5  
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=6.41  E-value=1.7e+02  Score=19.50  Aligned_cols=8  Identities=50%  Similarity=1.190  Sum_probs=3.8

Q ss_pred             ecccceee
Q psy9931          35 LHPTSFCC   42 (237)
Q Consensus        35 L~~cs~C~   42 (237)
                      |.||.|||
T Consensus         3 LkPCPFCG   10 (61)
T PF14354_consen    3 LKPCPFCG   10 (61)
T ss_pred             CcCCCCCC
Confidence            44444444


No 6  
>PF06185 YecM:  YecM protein;  InterPro: IPR010393 This family consists of several bacterial YecM proteins of unknown function.; PDB: 1K4N_A.
Probab=5.36  E-value=3.1e+02  Score=23.91  Aligned_cols=9  Identities=56%  Similarity=0.885  Sum_probs=6.2

Q ss_pred             eeEeEeeee
Q psy9931         170 FCCIKVHPI  178 (237)
Q Consensus       170 ~~~~~~~~~  178 (237)
                      .=|||+||-
T Consensus       168 ~icIK~HP~  176 (185)
T PF06185_consen  168 GICIKFHPH  176 (185)
T ss_dssp             S-EEEEESS
T ss_pred             CEEEEEcCc
Confidence            457888885


No 7  
>cd00251 Mth_Ecto The ectodomain of Methuselah (Mth); Mth mutants have a 35% increase in average lifespan and increased resistance to several forms of stress, including heat, starvation, and oxidative damage; The protein affected by this mutation is related to G protein-coupled receptors of the secretin receptor family; Mth, like secretin receptor family members, has a large N-terminal ectodomain, which may constitute the ligand binding site.
Probab=5.03  E-value=3.1e+02  Score=23.24  Aligned_cols=13  Identities=54%  Similarity=1.359  Sum_probs=9.3

Q ss_pred             eeEEeeeec-ceeE
Q psy9931          50 FCCVKLRPT-SFCC   62 (237)
Q Consensus        50 ~Csvkl~~c-s~Cc   62 (237)
                      -|-|||+|| ++||
T Consensus        54 gCvC~lr~Cir~CC   67 (176)
T cd00251          54 GCVCKLKPCIRFCC   67 (176)
T ss_pred             eEeeecCCeeeECC
Confidence            567788887 6666


No 8  
>PRK11700 hypothetical protein; Provisional
Probab=4.61  E-value=3.5e+02  Score=23.79  Aligned_cols=10  Identities=50%  Similarity=0.810  Sum_probs=7.6

Q ss_pred             ceeEeEeeee
Q psy9931         169 SFCCIKVHPI  178 (237)
Q Consensus       169 ~~~~~~~~~~  178 (237)
                      ..-|||+||.
T Consensus       167 ~~vcIK~HP~  176 (187)
T PRK11700        167 GGICIKFHPH  176 (187)
T ss_pred             CCEEEEEcCc
Confidence            4568999985


No 9  
>cd07268 Glo_EDI_BRP_like_4 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=4.15  E-value=4.1e+02  Score=22.74  Aligned_cols=10  Identities=50%  Similarity=0.793  Sum_probs=7.8

Q ss_pred             eeEeEeeeee
Q psy9931         170 FCCIKVHPII  179 (237)
Q Consensus       170 ~~~~~~~~~~  179 (237)
                      .-|||+||.-
T Consensus       131 ~i~IK~HP~s  140 (149)
T cd07268         131 GICIKLHPHS  140 (149)
T ss_pred             CEEEEEcCcC
Confidence            5789999953


No 10 
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only]
Probab=3.16  E-value=5.6e+02  Score=25.25  Aligned_cols=18  Identities=50%  Similarity=0.818  Sum_probs=0.0

Q ss_pred             ccceEEEe----Eeeeeceeee
Q psy9931         138 TSFCCVKL----RIKCADYVVD  155 (237)
Q Consensus       138 cS~CsVhL----~~~~~~~~~~  155 (237)
                      |-||||.+    |..-+||+||
T Consensus       121 CIfCSVdeGp~SrtR~~dy~Vd  142 (414)
T COG2100         121 CIFCSVDEGPYSRTRKLDYVVD  142 (414)
T ss_pred             eEEEeccCCcccceeccceEec


Done!