Diaphorina citri psyllid: psy9932


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MLLTVFPKEQILIVNGDRLIEDPVPELQRIERFLNLEPHINHDNFYFNHTKGFYCLKDNSMERCLRESKGRKHVRVHPKV
ccccccccccEEEECccccccccHHHHHHHHHHHcccccccccccEEcccccCEEECccccccccccccccccccccccc
MLLTVFPKEQILIVNGDRLIEDPVPELQRIERFLNLEPHINHDNFYFNHTKGFYCLKDNSM*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLTVFPKEQILIVNGDRLIEDPVPELQRIERFLNLEPHINHDNFYFNHTKGFYCLKDNSMERCLRESKGRKHVRVHPKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heparan sulfate glucosamine 3-O-sulfotransferase 1 Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to position 3 of glucosamine residues in heparan. Catalyzes the rate limiting step in the biosynthesis of heparan sulfate (HSact). This modification is a crucial step in the biosynthesis of anticoagulant heparan sulfate as it completes the structure of the antithrombin pentasaccharide binding site.confidentO14792
Heparan sulfate glucosamine 3-O-sulfotransferase 1 Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to position 3 of glucosamine residues in heparan. Catalyzes the rate limiting step in the biosynthesis of heparan sulfate (HSact). This modification is a crucial step in the biosynthesis of anticoagulant heparan sulfate as it completes the structure of the antithrombin pentasaccharide binding site.confidentQ9ESG5
Heparan sulfate glucosamine 3-O-sulfotransferase 1 Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to position 3 of glucosamine residues in heparan. Catalyzes the rate limiting step in the biosynthesis of heparan sulfate (HSact). This modification is a crucial step in the biosynthesis of anticoagulant heparan sulfate as it completes the structure of the antithrombin pentasaccharide binding site.confidentO35310

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008146 [MF]sulfotransferase activityprobableGO:0003824, GO:0016740, GO:0016782, GO:0003674
GO:0019213 [MF]deacetylase activityprobableGO:0016787, GO:0003674, GO:0003824
GO:0016020 [CC]membraneprobableGO:0005575
GO:0044431 [CC]Golgi apparatus partprobableGO:0005737, GO:0005794, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0046596 [BP]regulation of viral entry into host cellprobableGO:0040012, GO:0050792, GO:2000241, GO:0050794, GO:0043903, GO:0043900, GO:0065007, GO:0008150, GO:0050789
GO:0006477 [BP]protein sulfationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0051923, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0006790, GO:0044237, GO:0008152, GO:0008150
GO:0015015 [BP]heparan sulfate proteoglycan biosynthetic process, enzymatic modificationprobableGO:0030201, GO:0044249, GO:0044281, GO:0034645, GO:0009100, GO:0009101, GO:1901576, GO:0044710, GO:0044260, GO:0071704, GO:0009987, GO:0030166, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0043436, GO:0044238, GO:0006082, GO:0044272, GO:1901137, GO:1901135, GO:0044237, GO:0043170, GO:0015012, GO:0006029, GO:0006790, GO:0019538
GO:0050819 [BP]negative regulation of coagulationprobableGO:0051241, GO:0008150, GO:0065007, GO:0051239, GO:0048519, GO:0050818, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UAN, chain A
Confidence level:very confident
Coverage over the Query: 1-80
View the alignment between query and template
View the model in PyMOL