Diaphorina citri psyllid: psy9934


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MSTPLPCNPKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRSLTMSTPLPCNPKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRCNNILYIRGAEEGDEEGEMRE
cccccccccHHHHHHccccEEEEEEcccEEEEEEEEEEcccCEEEEccEEEEEccccccccccEEEEEEccccccccccHHHHHHccccEEEEEEcccEEEEEEEEEECcCEEEEEccEEEEEccEEccccccEEEEcccEEEEEccccccccccccc
******C***PFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRSLTMSTPLPCNPKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRCNNILYIRG************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTPLPCNPKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRSLTMSTPLPCNPKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRCNNILYIRGAEEGDEEGEMRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Small nuclear ribonucleoprotein F Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.confidentQ3T0Z8
Small nuclear ribonucleoprotein F Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.confidentP62307
Small nuclear ribonucleoprotein F Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.confidentP62306

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005689 [CC]U12-type spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005683 [CC]U7 snRNPprobableGO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034660 [BP]ncRNA metabolic processprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0000387 [BP]spliceosomal snRNP assemblyprobableGO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:0034622, GO:0071840, GO:0006139, GO:0071826, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0022618, GO:1901360, GO:0022613, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0044085, GO:0006396, GO:0006397
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0006369 [BP]termination of RNA polymerase II transcriptionprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0046540 [CC]U4/U6 x U5 tri-snRNP complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0007052 [BP]mitotic spindle organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0008334 [BP]histone mRNA metabolic processprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005685 [CC]U1 snRNPprobableGO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005682 [CC]U5 snRNPprobableGO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S6N, chain F
Confidence level:very confident
Coverage over the Query: 75-147
View the alignment between query and template
View the model in PyMOL
Template: 1TH7, chain A
Confidence level:very confident
Coverage over the Query: 1-77
View the alignment between query and template
View the model in PyMOL