Diaphorina citri psyllid: psy9937


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MERIFCAFDRLGSLVCRELLHNTFDLVTEEILMERIFCAFDRLCDGVIHLDEWVLGLSCFLRGTNEELIKFTFLIYDLNNDGFITREEMFQLLRGTNEELIKFTFLIYDLNNDGFITREEMFQLLRYSRNQSYNRLDLNVGTLCVVQGP
ccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHcHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccccccccccccccc
M*RIFCAFDRLGSLVCRELLHNTFDLVTEEILMERIFCAFDRLCDGVIHLDEWVLGLSCFLRGTNEELIKFTFLIYDLNNDGFITREEMFQLLRGTNEELIKFTFLIYDLNNDGFITREEMFQLLRYSRNQSYNRLDLNVGTLCVV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERIFCAFDRLGSLVCRELLHNTFDLVTEEILMERIFCAFDRLCDGVIHLDEWVLGLSCFLRGTNEELIKFTFLIYDLNNDGFITREEMFQLLRGTNEELIKFTFLIYDLNNDGFITREEMFQLLRYSRNQSYNRLDLNVGTLCVVQGP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcineurin subunit B Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.confidentQ6FLU4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0033192 [MF]calmodulin-dependent protein phosphatase activityprobableGO:0016787, GO:0016791, GO:0004723, GO:0004722, GO:0004721, GO:0042578, GO:0003824, GO:0003674, GO:0016788
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0016740 [MF]transferase activityprobableGO:0003824, GO:0003674
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0016247 [MF]channel regulator activityprobableGO:0003674
GO:0006470 [BP]protein dephosphorylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BJF, chain A
Confidence level:very confident
Coverage over the Query: 7-136
View the alignment between query and template
View the model in PyMOL