Diaphorina citri psyllid: psy9948


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MFAILVSGRLVQTNYELVAENRFLFTIPEADTINHIAVFMTGTTPFPEGTGGMVYFNWPEPDSPSNWKLLGVIANEKPSSIFKISNLKSTENTLVNGCTSVALYNPFGQQPISRNAQIGISVEPIEVVNQHLASKSNESLSNFVQFCQKMVTSFVNYISSFSTTQASMVPNPNETYVPISSVQNWYQNFERKLALNPNFWQSL
cEEEEEccccccccEEEEcccCEEEEccccccccEEEEEEccccccccccEEEEEEEccccccccccEEEEEEccccccEEEEEcccccccccccccccccccccccccccccccEEEEEEEccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEECHHHHHHHHHHHHHHHHcccccHHcc
MFAILVSGRLVQTNYELVAENRFLFTIPEADTINHIAVFMTGTTPFPEGTGGMVYFNWPEPDSPSNWKLLGVIANEKPSSIFKISNL*****************N*F*QQPISRNAQIGISVEPIEVVNQHLASK*NESLSNFVQFCQKMVTSFVNYISSFSTTQASMVPNPNETYVPISSVQNWYQNFERKLALNPNFWQSL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAILVSGRLVQTNYELVAENRFLFTIPEADTINHIAVFMTGTTPFPEGTGGMVYFNWPEPDSPSNWKLLGVIANEKPSSIFKISNLKSTENTLVNGCTSVALYNPFGQQPISRNAQIGISVEPIEVVNQHLASKSNESLSNFVQFCQKMVTSFVNYISSFSTTQASMVPNPNETYVPISSVQNWYQNFERKLALNPNFWQSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein OPI10 homolog very confidentQ7PRB5
Protein Hikeshi Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. Does not translocate ADP-bound HSP70 proteins into the nucleus.confidentQ53FT3
Protein Hikeshi Acts as a specific nuclear import carrier for hsp70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound hsp70 proteins into the nucleus. hsp70 proteins import is required to protect cells from heat shock damages.confidentQ568T4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0034605 [BP]cellular response to heatprobableGO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0009266, GO:0009408, GO:0044699
GO:0006606 [BP]protein import into nucleusprobableGO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0006810, GO:0071702, GO:0016482, GO:0017038, GO:0034613, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008565 [MF]protein transporter activityprobableGO:0005215, GO:0022892, GO:0003674
GO:0030544 [MF]Hsp70 protein bindingprobableGO:0031072, GO:0003674, GO:0005488, GO:0005515
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006020 [BP]inositol metabolic processprobableGO:0044238, GO:0044710, GO:0005975, GO:0009987, GO:0019751, GO:0044237, GO:0006066, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0044262, GO:1901615
GO:0007030 [BP]Golgi organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0030324 [BP]lung developmentprobableGO:0060541, GO:0032502, GO:0030323, GO:0044707, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0035295, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted