Query         psy9958
Match_columns 181
No_of_seqs    251 out of 1636
Neff          8.9 
Searched_HMMs 46136
Date          Sat Aug 17 00:00:07 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9958.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9958hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.8 2.1E-21 4.6E-26  148.9   1.1   82    2-94    182-263 (279)
  2 KOG2462|consensus               99.7 8.6E-18 1.9E-22  129.2   2.2   59    1-68    207-265 (279)
  3 KOG3623|consensus               99.5 2.1E-15 4.6E-20  128.5   3.1   91    5-104   890-980 (1007)
  4 KOG3623|consensus               99.4 1.1E-13 2.4E-18  118.2   2.4   55    4-67    917-971 (1007)
  5 KOG3576|consensus               99.4   2E-13 4.4E-18  100.9   1.4   74    6-88    114-187 (267)
  6 KOG3576|consensus               99.3 1.2E-13 2.7E-18  102.0  -2.8   75    1-84    137-222 (267)
  7 PHA02768 hypothetical protein;  99.2 9.1E-12   2E-16   73.8   1.9   44    9-63      5-48  (55)
  8 KOG1074|consensus               99.2 7.2E-12 1.6E-16  108.6   2.0   64    2-70    626-692 (958)
  9 KOG1074|consensus               99.1 1.4E-11 3.1E-16  106.8   1.2   79    8-95    604-693 (958)
 10 PHA00733 hypothetical protein   99.1 1.9E-10 4.2E-15   81.0   4.3   53    7-70     71-123 (128)
 11 PHA00732 hypothetical protein   98.8 3.2E-09 6.9E-14   68.4   2.2   48    9-70      1-48  (79)
 12 KOG3608|consensus               98.8 1.9E-09 4.1E-14   86.0   0.8   72    7-79    235-324 (467)
 13 PF13465 zf-H2C2_2:  Zinc-finge  98.7 5.2E-09 1.1E-13   53.1   1.7   26   24-58      1-26  (26)
 14 PHA00733 hypothetical protein   98.7 1.2E-09 2.6E-14   77.0  -1.5   78    7-92     38-117 (128)
 15 PHA02768 hypothetical protein;  98.7 5.6E-09 1.2E-13   61.9   0.6   43   45-89      4-46  (55)
 16 PF05605 zf-Di19:  Drought indu  98.6 5.2E-08 1.1E-12   58.3   3.9   53    9-71      2-54  (54)
 17 KOG3608|consensus               98.6 1.3E-08 2.8E-13   81.4   0.4   77    3-89    286-367 (467)
 18 PHA00616 hypothetical protein   98.6 3.5E-08 7.6E-13   55.8   2.0   34    9-51      1-34  (44)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.5 1.5E-08 3.2E-13   51.4  -0.4   21    1-21      6-26  (26)
 20 PHA00616 hypothetical protein   98.5 2.9E-08 6.2E-13   56.1   0.7   33   46-78      1-33  (44)
 21 PLN03086 PRLI-interacting fact  98.5 3.8E-08 8.2E-13   84.3   1.7   67    5-85    449-515 (567)
 22 KOG3993|consensus               98.4 8.9E-08 1.9E-12   78.1   1.4   63   10-72    296-382 (500)
 23 COG5189 SFP1 Putative transcri  98.3 1.8E-07   4E-12   73.8   1.9   62    6-67    346-419 (423)
 24 PLN03086 PRLI-interacting fact  98.3 1.9E-07 4.2E-12   80.0   1.2   68    8-87    477-554 (567)
 25 PF00096 zf-C2H2:  Zinc finger,  98.2   1E-06 2.2E-11   43.1   1.7   22   10-31      1-22  (23)
 26 PF00096 zf-C2H2:  Zinc finger,  98.1 8.5E-07 1.8E-11   43.4   0.7   23   47-69      1-23  (23)
 27 PF13894 zf-C2H2_4:  C2H2-type   98.0 4.1E-06   9E-11   41.0   2.0   23   10-32      1-23  (24)
 28 PF12756 zf-C2H2_2:  C2H2 type   97.9 5.5E-06 1.2E-10   55.2   2.1   60   11-70      1-74  (100)
 29 KOG3993|consensus               97.9 1.6E-06 3.4E-11   71.0  -0.9   76   10-94    268-376 (500)
 30 PF13894 zf-C2H2_4:  C2H2-type   97.9 5.1E-06 1.1E-10   40.6   1.2   24   47-70      1-24  (24)
 31 PF13912 zf-C2H2_6:  C2H2-type   97.8 7.3E-06 1.6E-10   41.6   1.0   24    9-32      1-24  (27)
 32 PF13912 zf-C2H2_6:  C2H2-type   97.7 1.1E-05 2.3E-10   41.0   0.7   26   46-71      1-26  (27)
 33 PF09237 GAGA:  GAGA factor;  I  97.6 2.4E-05 5.2E-10   45.3   1.0   33   42-74     20-52  (54)
 34 PHA00732 hypothetical protein   97.6 1.1E-05 2.3E-10   52.0  -0.5   38   46-86      1-39  (79)
 35 smart00355 ZnF_C2H2 zinc finge  97.4  0.0001 2.2E-09   36.3   1.8   24   47-70      1-24  (26)
 36 smart00355 ZnF_C2H2 zinc finge  97.3 0.00018 3.9E-09   35.4   1.7   23   10-32      1-23  (26)
 37 PF09237 GAGA:  GAGA factor;  I  97.0 0.00076 1.6E-08   39.1   2.8   30    5-34     20-49  (54)
 38 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00064 1.4E-08   33.3   1.8   23   10-33      1-23  (24)
 39 PF12874 zf-met:  Zinc-finger o  96.9 0.00043 9.2E-09   34.2   1.1   22   10-31      1-22  (25)
 40 PF13909 zf-H2C2_5:  C2H2-type   96.8 0.00039 8.5E-09   34.1   0.5   24   47-71      1-24  (24)
 41 PF12874 zf-met:  Zinc-finger o  96.8 0.00041 8.8E-09   34.3   0.3   23   47-69      1-23  (25)
 42 KOG2893|consensus               96.8 0.00036 7.8E-09   53.5   0.2   51    7-71      9-60  (341)
 43 COG5189 SFP1 Putative transcri  96.7 0.00072 1.6E-08   53.9   1.5   55   43-97    346-421 (423)
 44 PF12171 zf-C2H2_jaz:  Zinc-fin  96.4 0.00093   2E-08   33.8   0.1   22   47-68      2-23  (27)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  96.2 0.00089 1.9E-08   33.8  -0.6   22   10-31      2-23  (27)
 46 COG5048 FOG: Zn-finger [Genera  95.8  0.0018 3.9E-08   53.5  -0.9   62    8-78    288-355 (467)
 47 PF13913 zf-C2HC_2:  zinc-finge  95.7   0.008 1.7E-07   29.8   1.7   21   47-68      3-23  (25)
 48 PF05605 zf-Di19:  Drought indu  95.1  0.0043 9.4E-08   36.8  -0.5   39   46-85      2-42  (54)
 49 smart00451 ZnF_U1 U1-like zinc  95.1   0.014   3E-07   31.0   1.5   23    9-31      3-25  (35)
 50 PRK04860 hypothetical protein;  95.0  0.0038 8.2E-08   45.6  -1.2   38   45-86    118-155 (160)
 51 KOG1146|consensus               94.9   0.018   4E-07   53.8   2.6   66    3-68    459-540 (1406)
 52 PF09986 DUF2225:  Uncharacteri  94.8  0.0075 1.6E-07   46.3  -0.0   53    7-59      3-61  (214)
 53 PF06524 NOA36:  NOA36 protein;  94.8   0.015 3.3E-07   45.3   1.5   26    5-31    138-163 (314)
 54 PF13913 zf-C2HC_2:  zinc-finge  94.7    0.02 4.4E-07   28.3   1.4   21   10-31      3-23  (25)
 55 smart00451 ZnF_U1 U1-like zinc  94.7   0.019 4.2E-07   30.5   1.4   24   45-68      2-25  (35)
 56 COG4049 Uncharacterized protei  94.3   0.028   6E-07   33.3   1.5   29    5-33     13-41  (65)
 57 KOG2186|consensus               94.0   0.034 7.5E-07   43.1   2.0   50    9-70      3-52  (276)
 58 PF06524 NOA36:  NOA36 protein;  94.0   0.031 6.7E-07   43.6   1.6   29   42-70    205-233 (314)
 59 PF12756 zf-C2H2_2:  C2H2 type   93.8   0.048   1E-06   35.8   2.1   25    9-33     50-74  (100)
 60 cd00350 rubredoxin_like Rubred  92.7   0.074 1.6E-06   28.1   1.4   24   10-54      2-25  (33)
 61 PF09538 FYDLN_acid:  Protein o  92.2   0.087 1.9E-06   35.9   1.6   30   10-59     10-39  (108)
 62 COG4049 Uncharacterized protei  92.2   0.046 9.9E-07   32.4   0.2   30   42-71     13-42  (65)
 63 PF15269 zf-C2H2_7:  Zinc-finge  92.1    0.17 3.6E-06   28.6   2.4   34   35-68      8-42  (54)
 64 PF12013 DUF3505:  Protein of u  92.0    0.34 7.5E-06   32.9   4.4   63    8-71     10-109 (109)
 65 PRK04860 hypothetical protein;  91.1    0.12 2.6E-06   37.8   1.4   31   21-60    127-157 (160)
 66 cd00729 rubredoxin_SM Rubredox  90.4    0.19   4E-06   26.8   1.4   25    9-54      2-26  (34)
 67 KOG4124|consensus               89.4   0.099 2.1E-06   42.5  -0.2   61    7-67    347-419 (442)
 68 PF04959 ARS2:  Arsenite-resist  89.1    0.23 5.1E-06   38.0   1.6   29   45-73     76-104 (214)
 69 TIGR02300 FYDLN_acid conserved  89.0    0.26 5.6E-06   34.4   1.6   35    9-63      9-43  (129)
 70 KOG2071|consensus               88.9    0.27 5.9E-06   42.7   2.1   27    7-33    416-442 (579)
 71 PF02892 zf-BED:  BED zinc fing  88.8    0.33 7.2E-06   27.2   1.8   24    7-30     14-41  (45)
 72 KOG2785|consensus               88.8    0.24 5.1E-06   40.8   1.5   61    9-69      3-91  (390)
 73 TIGR02098 MJ0042_CXXC MJ0042 f  87.6    0.26 5.5E-06   26.7   0.8   34   10-57      3-36  (38)
 74 KOG4173|consensus               87.6    0.44 9.6E-06   36.1   2.2   68    8-87     78-159 (253)
 75 PRK00464 nrdR transcriptional   87.4   0.079 1.7E-06   38.5  -1.8   19   45-63     27-45  (154)
 76 PF05443 ROS_MUCR:  ROS/MUCR tr  87.3    0.34 7.4E-06   34.2   1.4   22   10-34     73-94  (132)
 77 KOG4173|consensus               86.6   0.094   2E-06   39.6  -1.8   58   11-68    108-168 (253)
 78 KOG2785|consensus               86.2    0.49 1.1E-05   39.0   2.0   62    8-69    165-243 (390)
 79 PF05443 ROS_MUCR:  ROS/MUCR tr  85.9    0.45 9.7E-06   33.7   1.4   27   46-75     72-98  (132)
 80 PF13717 zinc_ribbon_4:  zinc-r  85.7    0.41 8.9E-06   25.8   0.9   34   10-57      3-36  (36)
 81 smart00614 ZnF_BED BED zinc fi  85.6     0.6 1.3E-05   27.0   1.7   22   46-67     18-44  (50)
 82 COG2888 Predicted Zn-ribbon RN  85.4    0.59 1.3E-05   28.1   1.5   32    9-54     27-58  (61)
 83 smart00531 TFIIE Transcription  85.3    0.59 1.3E-05   33.6   1.8   38    7-57     97-134 (147)
 84 PRK14890 putative Zn-ribbon RN  85.3    0.58 1.3E-05   28.1   1.5   31    9-54     25-56  (59)
 85 PF04959 ARS2:  Arsenite-resist  85.1    0.21 4.5E-06   38.3  -0.6   29    5-33     73-101 (214)
 86 KOG2231|consensus               84.8    0.69 1.5E-05   41.1   2.3   21   48-68    184-204 (669)
 87 COG1997 RPL43A Ribosomal prote  84.4    0.41 8.9E-06   31.1   0.6   35    8-61     34-68  (89)
 88 PF09538 FYDLN_acid:  Protein o  84.3    0.51 1.1E-05   32.2   1.1   31   46-87      9-39  (108)
 89 PF13719 zinc_ribbon_5:  zinc-r  84.1    0.52 1.1E-05   25.5   0.9   34   10-57      3-36  (37)
 90 PHA00626 hypothetical protein   84.0    0.29 6.3E-06   29.0  -0.2   16   44-59     21-36  (59)
 91 COG5048 FOG: Zn-finger [Genera  83.5    0.69 1.5E-05   38.0   1.8   60    7-75     31-92  (467)
 92 PRK00398 rpoP DNA-directed RNA  82.4    0.76 1.6E-05   26.0   1.1   31    8-57      2-32  (46)
 93 PRK06266 transcription initiat  79.4     1.1 2.3E-05   33.4   1.4   35    7-59    115-149 (178)
 94 PF14353 CpXC:  CpXC protein     78.5    0.67 1.4E-05   32.4   0.0   47   11-67      3-59  (128)
 95 KOG1146|consensus               78.4     1.1 2.4E-05   42.6   1.4   63    7-71   1282-1353(1406)
 96 smart00734 ZnF_Rad18 Rad18-lik  78.1     1.8   4E-05   21.4   1.6   19   48-67      3-21  (26)
 97 COG5236 Uncharacterized conser  77.9     1.6 3.5E-05   35.7   2.0   47   11-67    222-272 (493)
 98 PRK09678 DNA-binding transcrip  77.8    0.57 1.2E-05   29.5  -0.4   41   10-61      2-44  (72)
 99 KOG2231|consensus               77.4     1.3 2.9E-05   39.4   1.5   51   11-74    184-240 (669)
100 PF09723 Zn-ribbon_8:  Zinc rib  77.4    0.54 1.2E-05   26.2  -0.6   29   10-54      6-34  (42)
101 TIGR00373 conserved hypothetic  76.9     1.2 2.6E-05   32.4   1.0   20    6-25    106-125 (158)
102 COG4957 Predicted transcriptio  76.7     1.2 2.7E-05   31.3   0.9   22   10-34     77-98  (148)
103 TIGR02605 CxxC_CxxC_SSSS putat  75.9    0.72 1.6E-05   26.7  -0.3   29   10-54      6-34  (52)
104 KOG4167|consensus               74.8     1.1 2.4E-05   40.1   0.4   26    8-33    791-816 (907)
105 KOG3214|consensus               74.7     3.4 7.3E-05   27.6   2.5   17   45-61     46-62  (109)
106 COG4957 Predicted transcriptio  73.4     1.8 3.8E-05   30.6   1.0   25   47-74     77-101 (148)
107 KOG4167|consensus               71.1    0.85 1.8E-05   40.8  -1.2   29   45-73    791-819 (907)
108 COG1996 RPC10 DNA-directed RNA  70.9       2 4.3E-05   24.9   0.7   29    8-55      5-33  (49)
109 COG4530 Uncharacterized protei  69.6     2.3   5E-05   28.9   0.9   32   11-63     11-42  (129)
110 COG1571 Predicted DNA-binding   69.4     2.8   6E-05   35.4   1.5   32   11-62    352-383 (421)
111 KOG2593|consensus               68.2       2 4.4E-05   36.1   0.5   38    5-54    124-161 (436)
112 COG3677 Transposase and inacti  66.9     2.1 4.7E-05   30.1   0.3   19   43-61     50-68  (129)
113 COG3357 Predicted transcriptio  66.6     3.2   7E-05   27.2   1.1   14   45-58     57-70  (97)
114 PF10571 UPF0547:  Uncharacteri  66.4     3.3 7.1E-05   20.6   0.8   10   48-57     16-25  (26)
115 KOG1280|consensus               65.8     5.1 0.00011   32.8   2.3   31    4-34     74-104 (381)
116 PTZ00255 60S ribosomal protein  65.1       2 4.2E-05   28.3  -0.1   17   44-60     52-68  (90)
117 PRK03824 hypA hydrogenase nick  63.3     2.3 5.1E-05   30.1  -0.0   16    7-22     68-83  (135)
118 KOG3408|consensus               63.3     3.8 8.3E-05   28.4   1.0   28   42-69     53-80  (129)
119 PF05191 ADK_lid:  Adenylate ki  63.3     3.2 6.8E-05   22.3   0.5   33   10-59      2-34  (36)
120 KOG2482|consensus               63.0     7.7 0.00017   31.9   2.8   61    9-69    144-218 (423)
121 PF07754 DUF1610:  Domain of un  62.7     5.1 0.00011   19.5   1.1   11   44-54     14-24  (24)
122 KOG2482|consensus               62.7     4.1 8.9E-05   33.4   1.2   62    9-70    195-303 (423)
123 COG2331 Uncharacterized protei  62.6     2.1 4.5E-05   27.1  -0.3   11   10-20     13-23  (82)
124 TIGR00280 L37a ribosomal prote  62.5       2 4.3E-05   28.3  -0.4   18   44-61     51-68  (91)
125 COG5188 PRP9 Splicing factor 3  62.5     6.3 0.00014   32.5   2.3   23    9-31    238-260 (470)
126 PRK12380 hydrogenase nickel in  61.7     4.5 9.8E-05   27.7   1.2   11   10-20     71-81  (113)
127 smart00659 RPOLCX RNA polymera  60.1     4.5 9.8E-05   22.8   0.8   26   10-55      3-28  (44)
128 KOG0696|consensus               59.3     5.1 0.00011   34.2   1.3   60    6-83     70-130 (683)
129 PF02176 zf-TRAF:  TRAF-type zi  59.2     4.5 9.8E-05   23.8   0.7   41    8-58      8-54  (60)
130 COG1655 Uncharacterized protei  58.0     1.8 3.8E-05   33.5  -1.5   26    7-32     17-42  (267)
131 COG1779 C4-type Zn-finger prot  57.9     1.7 3.7E-05   32.7  -1.5   42   10-62     15-59  (201)
132 smart00154 ZnF_AN1 AN1-like Zi  57.7     4.6 9.9E-05   22.1   0.5   14    9-22     12-25  (39)
133 TIGR00100 hypA hydrogenase nic  57.1     6.1 0.00013   27.1   1.2   12   47-58     71-82  (115)
134 PRK03976 rpl37ae 50S ribosomal  56.3     2.7 5.9E-05   27.6  -0.6   15   45-59     53-67  (90)
135 PF10276 zf-CHCC:  Zinc-finger   55.8       4 8.7E-05   22.5   0.1   11    9-19     29-39  (40)
136 PF12907 zf-met2:  Zinc-binding  54.3       6 0.00013   21.9   0.6   24   10-33      2-28  (40)
137 PF10537 WAC_Acf1_DNA_bd:  ATP-  53.9      14 0.00031   24.8   2.6   38    7-54      1-38  (102)
138 KOG3408|consensus               53.4      10 0.00022   26.4   1.7   24    8-31     56-79  (129)
139 PRK00564 hypA hydrogenase nick  53.4     7.5 0.00016   26.8   1.2   10   10-19     72-81  (117)
140 COG5236 Uncharacterized conser  53.3      12 0.00026   30.9   2.4   61   10-70    152-244 (493)
141 COG1198 PriA Primosomal protei  52.8     3.9 8.5E-05   37.1  -0.4   12   43-54    472-483 (730)
142 PF07282 OrfB_Zn_ribbon:  Putat  52.4     7.1 0.00015   23.8   0.8   16   43-58     43-58  (69)
143 PF01155 HypA:  Hydrogenase exp  52.2     7.2 0.00016   26.7   0.9   12   10-21     71-82  (113)
144 PF09986 DUF2225:  Uncharacteri  52.1     6.2 0.00013   30.2   0.6   43   44-86      3-60  (214)
145 COG4888 Uncharacterized Zn rib  51.5     2.4 5.2E-05   28.3  -1.5   12   46-57     46-57  (104)
146 PRK01343 zinc-binding protein;  51.2      17 0.00037   21.7   2.3   26   45-82      8-33  (57)
147 KOG1832|consensus               50.9     9.4  0.0002   35.6   1.6   11   52-62   1305-1315(1516)
148 smart00834 CxxC_CXXC_SSSS Puta  50.7     6.1 0.00013   21.3   0.3   15   46-60      5-19  (41)
149 PF01428 zf-AN1:  AN1-like Zinc  50.0     5.6 0.00012   22.1   0.1   15    8-22     12-26  (43)
150 KOG2071|consensus               49.4      11 0.00024   33.1   1.8   30   43-72    415-444 (579)
151 KOG0978|consensus               49.0     4.9 0.00011   36.1  -0.4   54    9-65    643-697 (698)
152 PRK14873 primosome assembly pr  48.7      12 0.00027   33.7   2.0   10   45-54    421-430 (665)
153 KOG4124|consensus               48.3     8.7 0.00019   31.6   0.9   62    6-72    175-239 (442)
154 smart00440 ZnF_C2C2 C2C2 Zinc   48.3     1.6 3.5E-05   24.0  -2.3   13   45-57     27-39  (40)
155 PRK03681 hypA hydrogenase nick  48.2     9.9 0.00021   26.1   1.1   10   10-19     71-80  (114)
156 PF01363 FYVE:  FYVE zinc finge  47.6     7.6 0.00016   23.7   0.4   11   10-20     10-20  (69)
157 KOG2893|consensus               47.4     7.8 0.00017   30.2   0.5   36   44-84      9-44  (341)
158 TIGR00595 priA primosomal prot  47.1      12 0.00027   32.4   1.8   11   44-54    251-261 (505)
159 PF04780 DUF629:  Protein of un  46.9      13 0.00027   32.0   1.7   27    8-34     56-82  (466)
160 PF08790 zf-LYAR:  LYAR-type C2  46.5     2.7 5.8E-05   21.3  -1.4    9   48-56      2-10  (28)
161 PF03604 DNA_RNApol_7kD:  DNA d  46.1      11 0.00023   19.7   0.8   12   45-56     16-27  (32)
162 TIGR00416 sms DNA repair prote  45.2      11 0.00024   32.3   1.2   12    8-19      6-17  (454)
163 COG1773 Rubredoxin [Energy pro  45.1     8.1 0.00018   22.9   0.2   19    8-26      2-20  (55)
164 PF04423 Rad50_zn_hook:  Rad50   45.0       7 0.00015   22.8  -0.1   12   48-59     22-33  (54)
165 PRK11823 DNA repair protein Ra  43.8      14  0.0003   31.6   1.6   25    7-54      5-29  (446)
166 PF14311 DUF4379:  Domain of un  43.7      15 0.00033   21.4   1.3   12   47-58     29-40  (55)
167 KOG0717|consensus               43.1      13 0.00028   31.8   1.3   22   10-31    293-314 (508)
168 PF04780 DUF629:  Protein of un  43.0      15 0.00032   31.7   1.5   29   43-71     54-83  (466)
169 PF07503 zf-HYPF:  HypF finger;  42.4      10 0.00022   20.2   0.4   31   12-57      2-32  (35)
170 cd00065 FYVE FYVE domain; Zinc  42.0      17 0.00037   21.1   1.3   11   11-21      4-14  (57)
171 PF14446 Prok-RING_1:  Prokaryo  41.6      13 0.00029   21.9   0.8   11   10-20      6-16  (54)
172 PF09845 DUF2072:  Zn-ribbon co  41.0      15 0.00032   25.9   1.0   15   46-60      1-15  (131)
173 PRK00762 hypA hydrogenase nick  40.8      13 0.00028   25.9   0.8   11   10-21     71-81  (124)
174 smart00661 RPOL9 RNA polymeras  40.0      16 0.00034   20.8   1.0   14   45-58     19-32  (52)
175 COG4391 Uncharacterized protei  39.6      10 0.00023   22.9   0.1   12    9-20     48-59  (62)
176 PF13878 zf-C2H2_3:  zinc-finge  39.3      24 0.00053   19.4   1.6   23   10-32     14-38  (41)
177 KOG1832|consensus               38.0      18 0.00038   33.9   1.3   10   15-24   1305-1314(1516)
178 KOG0717|consensus               37.8      16 0.00034   31.4   0.9   22   47-68    293-314 (508)
179 KOG2636|consensus               37.6      19 0.00041   30.7   1.4   23   44-66    399-422 (497)
180 PRK14892 putative transcriptio  37.2     7.9 0.00017   25.9  -0.7   13   46-58     42-54  (99)
181 smart00064 FYVE Protein presen  36.4      20 0.00043   21.7   1.0   12   10-21     11-22  (68)
182 PF11931 DUF3449:  Domain of un  36.4      12 0.00025   28.4   0.0   24   44-67     99-123 (196)
183 PF06220 zf-U1:  U1 zinc finger  35.9      24 0.00053   19.1   1.2   14   45-58      2-15  (38)
184 PF09963 DUF2197:  Uncharacteri  35.8     9.7 0.00021   22.7  -0.4   11   11-21      4-14  (56)
185 KOG2186|consensus               35.7     7.4 0.00016   30.5  -1.2   39   46-86      3-41  (276)
186 KOG2636|consensus               35.7      23  0.0005   30.2   1.6   26    3-28    395-421 (497)
187 PF10013 DUF2256:  Uncharacteri  35.4      18 0.00038   20.2   0.6   17   47-63      9-25  (42)
188 PLN02294 cytochrome c oxidase   35.2      16 0.00035   26.9   0.6   16   43-58    138-153 (174)
189 cd01121 Sms Sms (bacterial rad  35.2      18 0.00039   30.2   0.9    8   10-17      1-8   (372)
190 PRK05580 primosome assembly pr  35.2      26 0.00056   31.7   1.9   12   44-55    419-430 (679)
191 PF02748 PyrI_C:  Aspartate car  34.7      16 0.00034   21.4   0.4   17    6-22     32-48  (52)
192 PF04606 Ogr_Delta:  Ogr/Delta-  34.0     5.3 0.00011   22.7  -1.7   37   11-58      1-39  (47)
193 COG1656 Uncharacterized conser  33.7      33 0.00071   25.2   1.9   21   44-64    128-148 (165)
194 cd00924 Cyt_c_Oxidase_Vb Cytoc  32.9      18 0.00039   24.1   0.4   15   44-58     77-91  (97)
195 PF12760 Zn_Tnp_IS1595:  Transp  32.7     8.8 0.00019   21.6  -0.9   10   45-54     36-45  (46)
196 COG3364 Zn-ribbon containing p  32.4      28 0.00061   23.4   1.3   16   46-61      2-17  (112)
197 PF11672 DUF3268:  Protein of u  32.0      13 0.00027   25.1  -0.4   13    8-20      1-13  (102)
198 COG0068 HypF Hydrogenase matur  31.9      21 0.00045   32.3   0.8   10   45-54    172-181 (750)
199 PF03811 Zn_Tnp_IS1:  InsA N-te  31.6     8.4 0.00018   20.7  -1.1   11   42-52     25-35  (36)
200 CHL00174 accD acetyl-CoA carbo  31.5      17 0.00036   29.4   0.1   14   45-58     56-69  (296)
201 PTZ00448 hypothetical protein;  31.5      31 0.00067   28.7   1.7   23   46-68    314-336 (373)
202 PF13451 zf-trcl:  Probable zin  31.1      19 0.00042   20.8   0.3   14    8-21      3-16  (49)
203 PLN02748 tRNA dimethylallyltra  31.0      30 0.00066   29.8   1.6   26   44-69    416-442 (468)
204 PTZ00303 phosphatidylinositol   30.7      15 0.00033   33.7  -0.3   13   10-22    461-473 (1374)
205 PF12230 PRP21_like_P:  Pre-mRN  30.6      17 0.00036   28.0   0.0   34   44-78    166-199 (229)
206 PRK06260 threonine synthase; V  30.5      28 0.00062   29.1   1.4   11   10-20      4-14  (397)
207 COG5112 UFD2 U1-like Zn-finger  30.3      23 0.00051   24.0   0.7   30   39-68     48-77  (126)
208 PHA02998 RNA polymerase subuni  30.1     8.2 0.00018   28.7  -1.7   42    9-59    143-184 (195)
209 PF06397 Desulfoferrod_N:  Desu  29.8      22 0.00047   19.1   0.4   12    8-19      5-16  (36)
210 PF14447 Prok-RING_4:  Prokaryo  29.2      30 0.00064   20.5   0.9   17   43-59     36-52  (55)
211 KOG2907|consensus               29.1      20 0.00043   24.6   0.2   14   45-58    101-114 (116)
212 PF11789 zf-Nse:  Zinc-finger o  28.9      31 0.00066   20.5   0.9   17    7-23     22-38  (57)
213 COG1592 Rubrerythrin [Energy p  28.7      32  0.0007   25.3   1.2   13   41-53    144-156 (166)
214 TIGR00622 ssl1 transcription f  28.4      49  0.0011   22.7   2.0   49   11-70     57-105 (112)
215 PF14787 zf-CCHC_5:  GAG-polypr  28.4      32  0.0007   18.5   0.9   15   48-62      4-18  (36)
216 PRK05978 hypothetical protein;  28.4      16 0.00034   26.4  -0.5   12   48-59     54-65  (148)
217 TIGR00515 accD acetyl-CoA carb  28.3      34 0.00074   27.5   1.4   13   46-58     45-57  (285)
218 PTZ00448 hypothetical protein;  28.2      34 0.00075   28.5   1.4   24    9-32    314-337 (373)
219 COG4306 Uncharacterized protei  28.1      17 0.00037   25.4  -0.3   16   44-59     66-81  (160)
220 PLN03238 probable histone acet  28.1      42 0.00092   27.0   1.9   26    7-32     46-71  (290)
221 PF07975 C1_4:  TFIIH C1-like d  28.0      11 0.00024   22.0  -1.0   25   45-69     20-44  (51)
222 KOG0782|consensus               27.7      23 0.00049   31.4   0.3   13   48-60    255-267 (1004)
223 COG3464 Transposase and inacti  27.5      16 0.00035   30.8  -0.6   53   10-63     39-94  (402)
224 COG5151 SSL1 RNA polymerase II  26.7      57  0.0012   26.6   2.3   20    9-28    322-341 (421)
225 PF04641 Rtf2:  Rtf2 RING-finge  26.4     5.2 0.00011   31.5  -3.5   17    6-22    110-126 (260)
226 KOG4602|consensus               26.3      20 0.00043   28.3  -0.3   48    8-57    232-279 (318)
227 PRK00420 hypothetical protein;  25.7      39 0.00084   23.2   1.1   16   45-60     39-54  (112)
228 cd00730 rubredoxin Rubredoxin;  25.7      23  0.0005   20.5   0.0   14    9-22      1-14  (50)
229 COG0675 Transposase and inacti  25.4      27 0.00059   27.8   0.4   18   45-62    321-338 (364)
230 PF00301 Rubredoxin:  Rubredoxi  25.1      23 0.00051   20.2  -0.0   16    9-24      1-16  (47)
231 PF01780 Ribosomal_L37ae:  Ribo  25.1      40 0.00087   22.2   1.1   14   45-58     52-65  (90)
232 PTZ00043 cytochrome c oxidase   25.0      30 0.00066   26.8   0.5   15    7-21    179-193 (268)
233 PTZ00064 histone acetyltransfe  24.9      65  0.0014   28.1   2.5   26    7-32    278-303 (552)
234 KOG4727|consensus               24.6      35 0.00077   25.2   0.8   22   10-31     76-97  (193)
235 COG4896 Uncharacterized protei  24.5      28  0.0006   21.1   0.2   14   44-57     29-42  (68)
236 TIGR01206 lysW lysine biosynth  24.2      33 0.00071   20.2   0.5   30   46-83      2-31  (54)
237 PLN00104 MYST -like histone ac  24.2      51  0.0011   28.3   1.7   40    7-50    196-235 (450)
238 PRK05654 acetyl-CoA carboxylas  24.2      57  0.0012   26.3   2.0   12   46-57     46-57  (292)
239 PLN03239 histone acetyltransfe  24.0      54  0.0012   27.2   1.8   25    7-31    104-128 (351)
240 COG1594 RPB9 DNA-directed RNA   24.0      15 0.00032   25.2  -1.2   14   45-58     99-112 (113)
241 COG4338 Uncharacterized protei  23.4      26 0.00055   20.2  -0.1   17   47-63     13-29  (54)
242 COG5188 PRP9 Splicing factor 3  23.2      47   0.001   27.6   1.3   23   44-66    372-395 (470)
243 PF09332 Mcm10:  Mcm10 replicat  22.4      10 0.00022   31.3  -2.6   44    8-58    251-297 (344)
244 PLN03238 probable histone acet  22.0      71  0.0015   25.7   2.1   25   44-68     46-70  (290)
245 KOG0943|consensus               22.0      62  0.0013   31.8   2.0   37   94-130  1731-1767(3015)
246 KOG2593|consensus               22.0      56  0.0012   27.8   1.6   21   43-63    125-145 (436)
247 KOG1280|consensus               21.9      45 0.00098   27.5   1.0   38   44-81     77-116 (381)
248 KOG4118|consensus               21.5      52  0.0011   20.2   1.0   31   45-75     37-67  (74)
249 TIGR00244 transcriptional regu  21.4      41 0.00089   24.2   0.6   19   45-63     27-45  (147)
250 PF08209 Sgf11:  Sgf11 (transcr  21.3      45 0.00097   17.5   0.6   23   45-68      3-25  (33)
251 KOG2807|consensus               21.1 1.1E+02  0.0025   25.1   3.1   60    8-69    289-368 (378)
252 PF04810 zf-Sec23_Sec24:  Sec23  21.0      46   0.001   18.0   0.6   10   45-54     23-32  (40)
253 TIGR00319 desulf_FeS4 desulfof  20.9      39 0.00085   17.5   0.3   13    8-20      6-18  (34)
254 PF15135 UPF0515:  Uncharacteri  20.9      31 0.00067   27.1  -0.1   54    6-59    109-168 (278)
255 cd00974 DSRD Desulforedoxin (D  20.9      41 0.00088   17.4   0.4   13    8-20      3-15  (34)
256 COG1326 Uncharacterized archae  20.6      83  0.0018   23.8   2.1   14   44-57     28-41  (201)
257 PRK06450 threonine synthase; V  20.6      54  0.0012   26.9   1.2   10   10-19      4-13  (338)
258 PF01096 TFIIS_C:  Transcriptio  20.6      34 0.00073   18.5   0.0   11   10-20     29-39  (39)
259 PRK12722 transcriptional activ  20.6      42 0.00091   25.2   0.5    9   45-53    153-161 (187)
260 COG1675 TFA1 Transcription ini  20.1      71  0.0015   23.8   1.7   14    7-20    111-124 (176)
261 KOG1842|consensus               20.1      50  0.0011   28.3   0.9   28   45-72     14-42  (505)
262 cd01410 SIRT7 SIRT7: Eukaryoti  20.1      94   0.002   23.5   2.4   18    4-21     90-107 (206)
263 KOG1842|consensus               20.1      61  0.0013   27.8   1.4   27    8-34     14-40  (505)
264 PF05180 zf-DNL:  DNL zinc fing  20.0     7.6 0.00017   24.0  -2.9   41    9-61      4-44  (66)

No 1  
>KOG2462|consensus
Probab=99.82  E-value=2.1e-21  Score=148.94  Aligned_cols=82  Identities=26%  Similarity=0.440  Sum_probs=75.1

Q ss_pred             cccCCCCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcCCCChhHHHHHH
Q psy9958           2 LIHIDQNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHDPDSELIEQQVA   81 (181)
Q Consensus         2 ~~Ht~ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~~~~   81 (181)
                      |+|+  -|++|.+|||.|.+.+.|+.|+|+|         +|+|||.|+.|+|+|.-++||+.||++|.+.++|.|..|+
T Consensus       182 rTH~--l~c~C~iCGKaFSRPWLLQGHiRTH---------TGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~  250 (279)
T KOG2462|consen  182 RTHT--LPCECGICGKAFSRPWLLQGHIRTH---------TGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCG  250 (279)
T ss_pred             hccC--CCcccccccccccchHHhhcccccc---------cCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchh
Confidence            5666  7899999999999999999999998         8999999999999999999999999999999999999999


Q ss_pred             Hhhhcccceeeec
Q psy9958          82 LKLGRQKKVHIID   94 (181)
Q Consensus        82 ~~~~~~~~~~~~~   94 (181)
                      +.|.+..-+..|.
T Consensus       251 KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  251 KSFALKSYLNKHS  263 (279)
T ss_pred             hHHHHHHHHHHhh
Confidence            9998886555544


No 2  
>KOG2462|consensus
Probab=99.68  E-value=8.6e-18  Score=129.18  Aligned_cols=59  Identities=31%  Similarity=0.699  Sum_probs=56.1

Q ss_pred             CcccCCCCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHh
Q psy9958           1 MLIHIDQNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTL   68 (181)
Q Consensus         1 ~~~Ht~ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~   68 (181)
                      +|+|||||||.|..|+|.|..+++|+.||++|         ++.|+|+|..|+|+|..++.|.+|...
T Consensus       207 iRTHTGEKPF~C~hC~kAFADRSNLRAHmQTH---------S~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  207 IRTHTGEKPFSCPHCGKAFADRSNLRAHMQTH---------SDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cccccCCCCccCCcccchhcchHHHHHHHHhh---------cCCccccCcchhhHHHHHHHHHHhhhh
Confidence            68999999999999999999999999999999         788999999999999999999999753


No 3  
>KOG3623|consensus
Probab=99.54  E-value=2.1e-15  Score=128.48  Aligned_cols=91  Identities=24%  Similarity=0.443  Sum_probs=82.0

Q ss_pred             CCCCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcCCCChhHHHHHHHhh
Q psy9958           5 IDQNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHDPDSELIEQQVALKL   84 (181)
Q Consensus         5 t~ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~~~~~~~   84 (181)
                      +...+|.|+.|+|.|...+.|.+|.--|         +|.+||+|.+|.|.|+++-.|..|+|+|.|++||.|..|+++|
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEH---------sGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRF  960 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEH---------SGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRF  960 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhh---------cCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhc
Confidence            3456899999999999999999998777         8999999999999999999999999999999999999999999


Q ss_pred             hcccceeeecCcccccCCCC
Q psy9958          85 GRQKKVHIIDGHKVEVIPDD  104 (181)
Q Consensus        85 ~~~~~~~~~~~~~~~~~~~~  104 (181)
                      ...-....|..|....-...
T Consensus       961 SHSGSYSQHMNHRYSYCKpy  980 (1007)
T KOG3623|consen  961 SHSGSYSQHMNHRYSYCKPY  980 (1007)
T ss_pred             ccccchHhhhccchhcccch
Confidence            98888777888877665443


No 4  
>KOG3623|consensus
Probab=99.39  E-value=1.1e-13  Score=118.20  Aligned_cols=55  Identities=38%  Similarity=0.771  Sum_probs=54.0

Q ss_pred             cCCCCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHH
Q psy9958           4 HIDQNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMT   67 (181)
Q Consensus         4 Ht~ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~   67 (181)
                      |+|+|||+|.+|.|.|+.+-+|..|+|.|         +|+|||.|..|+|+|.+.+.+.+||.
T Consensus       917 HsGqRPyqC~iCkKAFKHKHHLtEHkRLH---------SGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  917 HSGQRPYQCIICKKAFKHKHHLTEHKRLH---------SGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             hcCCCCcccchhhHhhhhhhhhhhhhhhc---------cCCCcchhhhhhhhcccccchHhhhc
Confidence            99999999999999999999999999998         89999999999999999999999996


No 5  
>KOG3576|consensus
Probab=99.35  E-value=2e-13  Score=100.92  Aligned_cols=74  Identities=24%  Similarity=0.437  Sum_probs=66.7

Q ss_pred             CCCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcCCCChhHHHHHHHhhh
Q psy9958           6 DQNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHDPDSELIEQQVALKLG   85 (181)
Q Consensus         6 ~ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~~~~~~~~   85 (181)
                      +...|.|.+|+|.|.-..-|.+|++-|         ...++|.|..|||.|.-.-+|++|+|+|+|-+||.|..|.+.|.
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch---------~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaft  184 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCH---------SDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFT  184 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhc---------cHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHH
Confidence            456799999999999999999999987         56789999999999999999999999999999999999999987


Q ss_pred             ccc
Q psy9958          86 RQK   88 (181)
Q Consensus        86 ~~~   88 (181)
                      .+-
T Consensus       185 qrc  187 (267)
T KOG3576|consen  185 QRC  187 (267)
T ss_pred             hhc
Confidence            653


No 6  
>KOG3576|consensus
Probab=99.29  E-value=1.2e-13  Score=102.03  Aligned_cols=75  Identities=24%  Similarity=0.398  Sum_probs=62.9

Q ss_pred             CcccCCCCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcCC---------
Q psy9958           1 MLIHIDQNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHDP---------   71 (181)
Q Consensus         1 ~~~Ht~ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~~---------   71 (181)
                      |+-|+..|.|.|..|||.|.....|++|+|+|         +|.+||+|..|+|+|.++-.|..|.+.-++         
T Consensus       137 ~kch~~vkr~lct~cgkgfndtfdlkrh~rth---------tgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yayke  207 (267)
T KOG3576|consen  137 LKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTH---------TGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKE  207 (267)
T ss_pred             hhhccHHHHHHHhhccCcccchhhhhhhhccc---------cCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHH
Confidence            45688899999999999999999999999998         789999999999999999999999765433         


Q ss_pred             --CChhHHHHHHHhh
Q psy9958          72 --DSELIEQQVALKL   84 (181)
Q Consensus        72 --~~~~~~~~~~~~~   84 (181)
                        .+.|.|..|+...
T Consensus       208 rr~kl~vcedcg~t~  222 (267)
T KOG3576|consen  208 RRAKLYVCEDCGYTS  222 (267)
T ss_pred             hhhheeeecccCCCC
Confidence              3445677776543


No 7  
>PHA02768 hypothetical protein; Provisional
Probab=99.18  E-value=9.1e-12  Score=73.76  Aligned_cols=44  Identities=18%  Similarity=0.446  Sum_probs=39.8

Q ss_pred             ceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHH
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLL   63 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~   63 (181)
                      -|.|+.||+.|.+.++|.+|+++|         +  ++|+|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H---------~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKH---------N--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhc---------C--CcccCCcccceecccceeE
Confidence            389999999999999999999998         3  7999999999999888775


No 8  
>KOG1074|consensus
Probab=99.18  E-value=7.2e-12  Score=108.63  Aligned_cols=64  Identities=30%  Similarity=0.656  Sum_probs=32.8

Q ss_pred             cccCCCCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCC---cccccCCCchhHHHHHHhcC
Q psy9958           2 LIHIDQNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCP---ECKKAFRHKGNLLRHMTLHD   70 (181)
Q Consensus         2 ~~Ht~ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~---~C~k~F~~~~~l~~H~~~h~   70 (181)
                      |+|||||||+|++||+.|.++.+|+.||..|...    + .-...|.|+   +|-+.|...-.|..|+++|.
T Consensus       626 rtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~----p-~~R~q~ScP~~~ic~~kftn~V~lpQhIriH~  692 (958)
T KOG1074|consen  626 RTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAK----P-PARVQFSCPSTFICQKKFTNAVTLPQHIRIHL  692 (958)
T ss_pred             hcccCcCccccccccchhccccchhhcccccccC----c-cccccccCCchhhhcccccccccccceEEeec
Confidence            4555555555555555555555555555554321    0 111345555   55555555555555555554


No 9  
>KOG1074|consensus
Probab=99.12  E-value=1.4e-11  Score=106.85  Aligned_cols=79  Identities=27%  Similarity=0.436  Sum_probs=65.6

Q ss_pred             CceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcCCCChh----HHH---HH
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHDPDSEL----IEQ---QV   80 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~----~~~---~~   80 (181)
                      -|-.|-+|-+....++.|+.|.|+|         +|++||+|.+||+.|.++.||+.||.+|....++    .|.   .|
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtH---------tGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic  674 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTH---------TGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFIC  674 (958)
T ss_pred             Cccceeeeeecccchhhhhhhhhcc---------cCcCccccccccchhccccchhhcccccccCccccccccCCchhhh
Confidence            3678999999999999999999998         8999999999999999999999999998766543    566   67


Q ss_pred             HHhhhcc----cceeeecC
Q psy9958          81 ALKLGRQ----KKVHIIDG   95 (181)
Q Consensus        81 ~~~~~~~----~~~~~~~~   95 (181)
                      ..+|...    .++++|.+
T Consensus       675 ~~kftn~V~lpQhIriH~~  693 (958)
T KOG1074|consen  675 QKKFTNAVTLPQHIRIHLG  693 (958)
T ss_pred             cccccccccccceEEeecC
Confidence            7766443    45666553


No 10 
>PHA00733 hypothetical protein
Probab=99.05  E-value=1.9e-10  Score=81.00  Aligned_cols=53  Identities=32%  Similarity=0.689  Sum_probs=27.1

Q ss_pred             CCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcC
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHD   70 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~   70 (181)
                      .+||.|+.|++.|.....|..|++.+           ..+|.|..|++.|.....|..|++.++
T Consensus        71 ~kPy~C~~Cgk~Fss~s~L~~H~r~h-----------~~~~~C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733         71 VSPYVCPLCLMPFSSSVSLKQHIRYT-----------EHSKVCPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             CCCccCCCCCCcCCCHHHHHHHHhcC-----------CcCccCCCCCCccCCHHHHHHHHHHhc
Confidence            45555555555555555555555432           134555555555555555555554433


No 11 
>PHA00732 hypothetical protein
Probab=98.78  E-value=3.2e-09  Score=68.41  Aligned_cols=48  Identities=31%  Similarity=0.544  Sum_probs=40.6

Q ss_pred             ceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcC
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHD   70 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~   70 (181)
                      ||.|..|++.|.+...|+.|++.+|           .++.|+.|+++|.   .|..|.+++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H-----------~~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNH-----------TLTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhccc-----------CCCccCCCCCEeC---ChhhhhcccC
Confidence            7899999999999999999998543           2468999999998   5888986553


No 12 
>KOG3608|consensus
Probab=98.76  E-value=1.9e-09  Score=85.99  Aligned_cols=72  Identities=28%  Similarity=0.504  Sum_probs=39.5

Q ss_pred             CCceecccchhhccChhhHHHHHHHhcCC------------------CCCCCCCCCCcccCCcccccCCCchhHHHHHHh
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLYHNP------------------HYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTL   68 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~hh~~------------------~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~   68 (181)
                      ..+|.|..|.|+|.+...|+.|++.|-+-                  +.+..|++.|||+|..|.++|.+.+.|.+|..+
T Consensus       235 ~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~  314 (467)
T KOG3608|consen  235 TNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQV  314 (467)
T ss_pred             CCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHh
Confidence            44555555555555555555555554210                  111333556666666666666666666666665


Q ss_pred             cCCCChhHHHH
Q psy9958          69 HDPDSELIEQQ   79 (181)
Q Consensus        69 h~~~~~~~~~~   79 (181)
                      |. +..|.|..
T Consensus       315 HS-~~~y~C~h  324 (467)
T KOG3608|consen  315 HS-KTVYQCEH  324 (467)
T ss_pred             cc-ccceecCC
Confidence            55 44555544


No 13 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.73  E-value=5.2e-09  Score=53.08  Aligned_cols=26  Identities=42%  Similarity=0.754  Sum_probs=22.7

Q ss_pred             hHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCC
Q psy9958          24 LLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRH   58 (181)
Q Consensus        24 ~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~   58 (181)
                      +|.+|+++|         ++++||.|+.|+++|.+
T Consensus         1 ~l~~H~~~H---------~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTH---------TGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHH---------SSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhc---------CCCCCCCCCCCcCeeCc
Confidence            588999998         78999999999999864


No 14 
>PHA00733 hypothetical protein
Probab=98.71  E-value=1.2e-09  Score=76.95  Aligned_cols=78  Identities=14%  Similarity=0.164  Sum_probs=62.0

Q ss_pred             CCceecccchhhccChhhHHHH--HHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcCCCChhHHHHHHHhh
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRH--VNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHDPDSELIEQQVALKL   84 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H--~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~~~~~~~   84 (181)
                      ++++.|.+|.+.|.....|..|  ++.+.      +..+.+||.|..|++.|.+...|..|++.|  ..++.|..|+..|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~------~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F  109 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLL------TSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEF  109 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhc------ccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCcc
Confidence            6889999999999999888877  32221      114578999999999999999999999976  3468999999888


Q ss_pred             hcccceee
Q psy9958          85 GRQKKVHI   92 (181)
Q Consensus        85 ~~~~~~~~   92 (181)
                      .....+..
T Consensus       110 ~~~~sL~~  117 (128)
T PHA00733        110 RNTDSTLD  117 (128)
T ss_pred             CCHHHHHH
Confidence            76655433


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=98.66  E-value=5.6e-09  Score=61.89  Aligned_cols=43  Identities=16%  Similarity=0.349  Sum_probs=36.5

Q ss_pred             CcccCCcccccCCCchhHHHHHHhcCCCChhHHHHHHHhhhcccc
Q psy9958          45 KTHKCPECKKAFRHKGNLLRHMTLHDPDSELIEQQVALKLGRQKK   89 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~   89 (181)
                      .-|.|+.||+.|.+.++|..|+++|+  +++.|..|++.|.+...
T Consensus         4 ~~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~   46 (55)
T PHA02768          4 LGYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGE   46 (55)
T ss_pred             cccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccce
Confidence            35899999999999999999999999  67888888887765443


No 16 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.62  E-value=5.2e-08  Score=58.31  Aligned_cols=53  Identities=25%  Similarity=0.521  Sum_probs=42.6

Q ss_pred             ceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcCC
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHDP   71 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~~   71 (181)
                      .|.|++|++. .....|..|....|.       ...+.+.|++|...+.  .+|..|+..+++
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~-------~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHR-------SESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCc-------CCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            5899999995 456789999988875       3456899999998765  499999987653


No 17 
>KOG3608|consensus
Probab=98.57  E-value=1.3e-08  Score=81.35  Aligned_cols=77  Identities=19%  Similarity=0.348  Sum_probs=65.5

Q ss_pred             ccCCCCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCc--ccccCCCchhHHHHHHhcC-CC--ChhHH
Q psy9958           3 IHIDQNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPE--CKKAFRHKGNLLRHMTLHD-PD--SELIE   77 (181)
Q Consensus         3 ~Ht~ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~--C~k~F~~~~~l~~H~~~h~-~~--~~~~~   77 (181)
                      .|+..|||+|+.|+++|.+.+.|.+|...|         + +..|.|..  |..+|+....+.+|++.++ +.  .+|.|
T Consensus       286 rHs~dkpfKCd~Cd~~c~~esdL~kH~~~H---------S-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~C  355 (467)
T KOG3608|consen  286 RHSKDKPFKCDECDTRCVRESDLAKHVQVH---------S-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYAC  355 (467)
T ss_pred             hhccCCCccccchhhhhccHHHHHHHHHhc---------c-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceee
Confidence            488999999999999999999999999987         3 67899988  9999999999999988765 44  45778


Q ss_pred             HHHHHhhhcccc
Q psy9958          78 QQVALKLGRQKK   89 (181)
Q Consensus        78 ~~~~~~~~~~~~   89 (181)
                      -.|..-|.+...
T Consensus       356 H~Cdr~ft~G~~  367 (467)
T KOG3608|consen  356 HCCDRFFTSGKS  367 (467)
T ss_pred             ecchhhhccchh
Confidence            888777765544


No 18 
>PHA00616 hypothetical protein
Probab=98.56  E-value=3.5e-08  Score=55.77  Aligned_cols=34  Identities=26%  Similarity=0.432  Sum_probs=27.3

Q ss_pred             ceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCc
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPE   51 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~   51 (181)
                      ||+|..||+.|..++.|.+|++.||         +++++.|..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~h---------g~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVH---------KQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhc---------CCCccceeE
Confidence            6888888888888888888888884         567877764


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.51  E-value=1.5e-08  Score=51.39  Aligned_cols=21  Identities=33%  Similarity=0.849  Sum_probs=19.2

Q ss_pred             CcccCCCCceecccchhhccC
Q psy9958           1 MLIHIDQNPYLCDHCDQTFRQ   21 (181)
Q Consensus         1 ~~~Ht~ekp~~C~~C~k~f~~   21 (181)
                      |++|+|+|||.|++|++.|.+
T Consensus         6 ~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    6 MRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHSSSSSEEESSSSEEESS
T ss_pred             hhhcCCCCCCCCCCCcCeeCc
Confidence            578999999999999999974


No 20 
>PHA00616 hypothetical protein
Probab=98.51  E-value=2.9e-08  Score=56.11  Aligned_cols=33  Identities=21%  Similarity=0.462  Sum_probs=30.5

Q ss_pred             cccCCcccccCCCchhHHHHHHhcCCCChhHHH
Q psy9958          46 THKCPECKKAFRHKGNLLRHMTLHDPDSELIEQ   78 (181)
Q Consensus        46 ~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~   78 (181)
                      ||+|+.||+.|..++.|.+|++.|++.+++.+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            689999999999999999999999999888653


No 21 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.51  E-value=3.8e-08  Score=84.27  Aligned_cols=67  Identities=19%  Similarity=0.484  Sum_probs=55.7

Q ss_pred             CCCCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcCCCChhHHHHHHHhh
Q psy9958           5 IDQNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHDPDSELIEQQVALKL   84 (181)
Q Consensus         5 t~ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~~~~~~~   84 (181)
                      .-++.+.|+.|++.|. ...|..|++.+|           ++|.|+ ||+.| .+..|..|+++|.+.+++.|..|.+.+
T Consensus       449 el~~H~~C~~Cgk~f~-~s~LekH~~~~H-----------kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v  514 (567)
T PLN03086        449 EAKNHVHCEKCGQAFQ-QGEMEKHMKVFH-----------EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMV  514 (567)
T ss_pred             ccccCccCCCCCCccc-hHHHHHHHHhcC-----------CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCcc
Confidence            3467789999999996 678999999874           788999 99755 568999999999999999999888766


Q ss_pred             h
Q psy9958          85 G   85 (181)
Q Consensus        85 ~   85 (181)
                      .
T Consensus       515 ~  515 (567)
T PLN03086        515 Q  515 (567)
T ss_pred             c
Confidence            3


No 22 
>KOG3993|consensus
Probab=98.41  E-value=8.9e-08  Score=78.10  Aligned_cols=63  Identities=27%  Similarity=0.522  Sum_probs=43.6

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCC-----CCC-------------------CCCCcccCCcccccCCCchhHHHH
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYV-----PPS-------------------PKEKTHKCPECKKAFRHKGNLLRH   65 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~-----~~~-------------------~~~~~~~C~~C~k~F~~~~~l~~H   65 (181)
                      |+|+.|+|.|+...+|..|+|+|.-..-.     ++.                   .....|.|..|+|.|.+...|+.|
T Consensus       296 YrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKH  375 (500)
T KOG3993|consen  296 YRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKH  375 (500)
T ss_pred             ecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHh
Confidence            78888888888888888888876422110     000                   112358888888888888888888


Q ss_pred             HHhcCCC
Q psy9958          66 MTLHDPD   72 (181)
Q Consensus        66 ~~~h~~~   72 (181)
                      +.+|+..
T Consensus       376 qlthq~~  382 (500)
T KOG3993|consen  376 QLTHQRA  382 (500)
T ss_pred             HHhhhcc
Confidence            7777644


No 23 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.35  E-value=1.8e-07  Score=73.82  Aligned_cols=62  Identities=27%  Similarity=0.568  Sum_probs=49.1

Q ss_pred             CCCceeccc--chhhccChhhHHHHHHHhcCCCCCCC----------CCCCCcccCCcccccCCCchhHHHHHH
Q psy9958           6 DQNPYLCDH--CDQTFRQKQLLKRHVNLYHNPHYVPP----------SPKEKTHKCPECKKAFRHKGNLLRHMT   67 (181)
Q Consensus         6 ~ekp~~C~~--C~k~f~~~~~L~~H~~~hh~~~~~~~----------~~~~~~~~C~~C~k~F~~~~~l~~H~~   67 (181)
                      ++|||+|++  |.|.|+....|+.|+..-|......+          ..+.|||.|.+|+|+|+.-..|+.|++
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            469999998  99999999999999875452211100          133599999999999999999999865


No 24 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.30  E-value=1.9e-07  Score=79.98  Aligned_cols=68  Identities=12%  Similarity=0.210  Sum_probs=57.1

Q ss_pred             CceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCC----------chhHHHHHHhcCCCChhHH
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRH----------KGNLLRHMTLHDPDSELIE   77 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~----------~~~l~~H~~~h~~~~~~~~   77 (181)
                      +|+.|+ |++.| .+..|..|+++|         ...+++.|..|++.|..          .+.|..|...+ +.+++.|
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~th---------Cp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C  544 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQAST---------CPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPC  544 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhcc---------CCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEc
Confidence            899999 99766 568999999887         57899999999999952          35899999885 9999999


Q ss_pred             HHHHHhhhcc
Q psy9958          78 QQVALKLGRQ   87 (181)
Q Consensus        78 ~~~~~~~~~~   87 (181)
                      ..|++.+..+
T Consensus       545 ~~Cgk~Vrlr  554 (567)
T PLN03086        545 DSCGRSVMLK  554 (567)
T ss_pred             cccCCeeeeh
Confidence            9998766544


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.17  E-value=1e-06  Score=43.10  Aligned_cols=22  Identities=41%  Similarity=0.816  Sum_probs=13.7

Q ss_pred             eecccchhhccChhhHHHHHHH
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNL   31 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~   31 (181)
                      |+|+.|++.|.++..|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666654


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.11  E-value=8.5e-07  Score=43.39  Aligned_cols=23  Identities=57%  Similarity=0.964  Sum_probs=21.5

Q ss_pred             ccCCcccccCCCchhHHHHHHhc
Q psy9958          47 HKCPECKKAFRHKGNLLRHMTLH   69 (181)
Q Consensus        47 ~~C~~C~k~F~~~~~l~~H~~~h   69 (181)
                      |.|+.|++.|.++..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999875


No 27 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.00  E-value=4.1e-06  Score=40.98  Aligned_cols=23  Identities=30%  Similarity=0.751  Sum_probs=12.9

Q ss_pred             eecccchhhccChhhHHHHHHHh
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLY   32 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~h   32 (181)
                      |.|++|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666554


No 28 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.92  E-value=5.5e-06  Score=55.21  Aligned_cols=60  Identities=27%  Similarity=0.512  Sum_probs=22.2

Q ss_pred             ecccchhhccChhhHHHHHHHhcCCCCC-----------CCC---CCCCcccCCcccccCCCchhHHHHHHhcC
Q psy9958          11 LCDHCDQTFRQKQLLKRHVNLYHNPHYV-----------PPS---PKEKTHKCPECKKAFRHKGNLLRHMTLHD   70 (181)
Q Consensus        11 ~C~~C~k~f~~~~~L~~H~~~hh~~~~~-----------~~~---~~~~~~~C~~C~k~F~~~~~l~~H~~~h~   70 (181)
                      .|.+|+..|.....|..|+...|+....           ...   .-...|.|..|++.|.....|..||+.+.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             ------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CccccccccccccccccccccccccccccccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCcc
Confidence            4999999999999999999887754211           000   11236899999999999999999999754


No 29 
>KOG3993|consensus
Probab=97.91  E-value=1.6e-06  Score=71.02  Aligned_cols=76  Identities=25%  Similarity=0.460  Sum_probs=61.7

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcCCC-----------------
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHDPD-----------------   72 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~~~-----------------   72 (181)
                      |.|..|.-.|.....|..|.-.-         ..-.-|+|+.|+|.|+...||..|.|+|...                 
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~R---------IV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~  338 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPR---------IVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVET  338 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCe---------eEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhh
Confidence            89999999999999999995322         1235799999999999999999999998521                 


Q ss_pred             ----------------ChhHHHHHHHhhhcccceeeec
Q psy9958          73 ----------------SELIEQQVALKLGRQKKVHIID   94 (181)
Q Consensus        73 ----------------~~~~~~~~~~~~~~~~~~~~~~   94 (181)
                                      ..|.|..|+++|.++.-++.|.
T Consensus       339 rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHq  376 (500)
T KOG3993|consen  339 RAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQ  376 (500)
T ss_pred             hhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhH
Confidence                            1256999999999987766664


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.90  E-value=5.1e-06  Score=40.63  Aligned_cols=24  Identities=46%  Similarity=0.930  Sum_probs=20.3

Q ss_pred             ccCCcccccCCCchhHHHHHHhcC
Q psy9958          47 HKCPECKKAFRHKGNLLRHMTLHD   70 (181)
Q Consensus        47 ~~C~~C~k~F~~~~~l~~H~~~h~   70 (181)
                      |.|++|++.|.+...|..|+++|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999998874


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.82  E-value=7.3e-06  Score=41.61  Aligned_cols=24  Identities=33%  Similarity=0.742  Sum_probs=17.2

Q ss_pred             ceecccchhhccChhhHHHHHHHh
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLY   32 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~h   32 (181)
                      ||.|..|++.|.....|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            567777777777777777777665


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.73  E-value=1.1e-05  Score=40.99  Aligned_cols=26  Identities=31%  Similarity=0.540  Sum_probs=23.9

Q ss_pred             cccCCcccccCCCchhHHHHHHhcCC
Q psy9958          46 THKCPECKKAFRHKGNLLRHMTLHDP   71 (181)
Q Consensus        46 ~~~C~~C~k~F~~~~~l~~H~~~h~~   71 (181)
                      ||.|..|++.|.....|..|++.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            68999999999999999999998764


No 33 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.60  E-value=2.4e-05  Score=45.31  Aligned_cols=33  Identities=27%  Similarity=0.566  Sum_probs=23.0

Q ss_pred             CCCCcccCCcccccCCCchhHHHHHHhcCCCCh
Q psy9958          42 PKEKTHKCPECKKAFRHKGNLLRHMTLHDPDSE   74 (181)
Q Consensus        42 ~~~~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~   74 (181)
                      ..+.|..|++|+..+.+..+|++|+.++|+.++
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            346788999999999999999999988887765


No 34 
>PHA00732 hypothetical protein
Probab=97.60  E-value=1.1e-05  Score=52.03  Aligned_cols=38  Identities=21%  Similarity=0.158  Sum_probs=32.5

Q ss_pred             cccCCcccccCCCchhHHHHHHh-cCCCChhHHHHHHHhhhc
Q psy9958          46 THKCPECKKAFRHKGNLLRHMTL-HDPDSELIEQQVALKLGR   86 (181)
Q Consensus        46 ~~~C~~C~k~F~~~~~l~~H~~~-h~~~~~~~~~~~~~~~~~   86 (181)
                      ||.|..|++.|.+..+|..|++. |.+   +.|..|+..|.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~~   39 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYRR   39 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeCC
Confidence            68999999999999999999985 654   478899888863


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.41  E-value=0.0001  Score=36.33  Aligned_cols=24  Identities=46%  Similarity=0.934  Sum_probs=17.2

Q ss_pred             ccCCcccccCCCchhHHHHHHhcC
Q psy9958          47 HKCPECKKAFRHKGNLLRHMTLHD   70 (181)
Q Consensus        47 ~~C~~C~k~F~~~~~l~~H~~~h~   70 (181)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            467777777777777777777553


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.27  E-value=0.00018  Score=35.43  Aligned_cols=23  Identities=35%  Similarity=0.782  Sum_probs=21.4

Q ss_pred             eecccchhhccChhhHHHHHHHh
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLY   32 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~h   32 (181)
                      |.|..|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            68999999999999999999865


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.02  E-value=0.00076  Score=39.14  Aligned_cols=30  Identities=30%  Similarity=0.624  Sum_probs=22.0

Q ss_pred             CCCCceecccchhhccChhhHHHHHHHhcC
Q psy9958           5 IDQNPYLCDHCDQTFRQKQLLKRHVNLYHN   34 (181)
Q Consensus         5 t~ekp~~C~~C~k~f~~~~~L~~H~~~hh~   34 (181)
                      ..+.|..|++|+..+.+..+|++|+..+|.
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            456899999999999999999999988764


No 38 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.93  E-value=0.00064  Score=33.29  Aligned_cols=23  Identities=43%  Similarity=0.788  Sum_probs=13.1

Q ss_pred             eecccchhhccChhhHHHHHHHhc
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYH   33 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh   33 (181)
                      |+|+.|+.... +..|.+|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56666666665 666666666654


No 39 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.93  E-value=0.00043  Score=34.22  Aligned_cols=22  Identities=27%  Similarity=0.860  Sum_probs=13.7

Q ss_pred             eecccchhhccChhhHHHHHHH
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNL   31 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~   31 (181)
                      |.|.+|++.|.+...|+.|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666554


No 40 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.83  E-value=0.00039  Score=34.08  Aligned_cols=24  Identities=46%  Similarity=0.880  Sum_probs=19.2

Q ss_pred             ccCCcccccCCCchhHHHHHHhcCC
Q psy9958          47 HKCPECKKAFRHKGNLLRHMTLHDP   71 (181)
Q Consensus        47 ~~C~~C~k~F~~~~~l~~H~~~h~~   71 (181)
                      |+|+.|+.... ...|..|++.|++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            68999999998 9999999998653


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.77  E-value=0.00041  Score=34.30  Aligned_cols=23  Identities=26%  Similarity=0.609  Sum_probs=20.9

Q ss_pred             ccCCcccccCCCchhHHHHHHhc
Q psy9958          47 HKCPECKKAFRHKGNLLRHMTLH   69 (181)
Q Consensus        47 ~~C~~C~k~F~~~~~l~~H~~~h   69 (181)
                      |.|.+|++.|.....|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            67999999999999999998754


No 42 
>KOG2893|consensus
Probab=96.77  E-value=0.00036  Score=53.48  Aligned_cols=51  Identities=29%  Similarity=0.634  Sum_probs=42.2

Q ss_pred             CCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHH-HHhcCC
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRH-MTLHDP   71 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H-~~~h~~   71 (181)
                      .||| |.+|++-|.....|..|++             .|.|+|.+|-|.+.+--.|..| |++|..
T Consensus         9 ~kpw-cwycnrefddekiliqhqk-------------akhfkchichkkl~sgpglsihcmqvhke   60 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQK-------------AKHFKCHICHKKLFSGPGLSIHCMQVHKE   60 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhh-------------hccceeeeehhhhccCCCceeehhhhhhh
Confidence            3566 9999999999999999965             4789999999988888888888 666643


No 43 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.71  E-value=0.00072  Score=53.91  Aligned_cols=55  Identities=22%  Similarity=0.370  Sum_probs=44.3

Q ss_pred             CCCcccCCc--ccccCCCchhHHHHHHh-c------------------CCCChhHHHHHHHhhhcccceeeecCcc
Q psy9958          43 KEKTHKCPE--CKKAFRHKGNLLRHMTL-H------------------DPDSELIEQQVALKLGRQKKVHIIDGHK   97 (181)
Q Consensus        43 ~~~~~~C~~--C~k~F~~~~~l~~H~~~-h------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~   97 (181)
                      ++|||+|++  |.|.|+....|+.|+.. |                  ...+||.|..|.++.+....++.|.++.
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~Hs  421 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKHS  421 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccccc
Confidence            359999998  99999999999999863 2                  1348899999999987777776666553


No 44 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.38  E-value=0.00093  Score=33.76  Aligned_cols=22  Identities=32%  Similarity=0.640  Sum_probs=14.6

Q ss_pred             ccCCcccccCCCchhHHHHHHh
Q psy9958          47 HKCPECKKAFRHKGNLLRHMTL   68 (181)
Q Consensus        47 ~~C~~C~k~F~~~~~l~~H~~~   68 (181)
                      |.|..|++.|.....|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4566777777777777666653


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.18  E-value=0.00089  Score=33.83  Aligned_cols=22  Identities=36%  Similarity=0.887  Sum_probs=20.4

Q ss_pred             eecccchhhccChhhHHHHHHH
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNL   31 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~   31 (181)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999999875


No 46 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.78  E-value=0.0018  Score=53.47  Aligned_cols=62  Identities=32%  Similarity=0.547  Sum_probs=55.7

Q ss_pred             CceecccchhhccChhhHHHHHH--HhcCCCCCCCCCCC--CcccCC--cccccCCCchhHHHHHHhcCCCChhHHH
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVN--LYHNPHYVPPSPKE--KTHKCP--ECKKAFRHKGNLLRHMTLHDPDSELIEQ   78 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~--~hh~~~~~~~~~~~--~~~~C~--~C~k~F~~~~~l~~H~~~h~~~~~~~~~   78 (181)
                      .++.|..|...|.....|.+|.+  .|         .++  +++.|+  .|++.|.+...+..|..+|.......+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h---------~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNH---------SGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             cCCCCccccCCcccccccccccccccc---------ccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            57999999999999999999999  55         677  999999  7999999999999999999988776544


No 47 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.71  E-value=0.008  Score=29.79  Aligned_cols=21  Identities=29%  Similarity=0.719  Sum_probs=13.4

Q ss_pred             ccCCcccccCCCchhHHHHHHh
Q psy9958          47 HKCPECKKAFRHKGNLLRHMTL   68 (181)
Q Consensus        47 ~~C~~C~k~F~~~~~l~~H~~~   68 (181)
                      ..|+.||+.| ....|.+|+++
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3577777777 45666677553


No 48 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=95.11  E-value=0.0043  Score=36.80  Aligned_cols=39  Identities=18%  Similarity=0.431  Sum_probs=28.9

Q ss_pred             cccCCcccccCCCchhHHHHHHh-cCCC-ChhHHHHHHHhhh
Q psy9958          46 THKCPECKKAFRHKGNLLRHMTL-HDPD-SELIEQQVALKLG   85 (181)
Q Consensus        46 ~~~C~~C~k~F~~~~~l~~H~~~-h~~~-~~~~~~~~~~~~~   85 (181)
                      .|.|+.|++. .....|..|... |..+ +.+.|+.|...+.
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~   42 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT   42 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh
Confidence            5899999994 556889999765 5443 4578888886543


No 49 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.09  E-value=0.014  Score=31.04  Aligned_cols=23  Identities=22%  Similarity=0.577  Sum_probs=15.6

Q ss_pred             ceecccchhhccChhhHHHHHHH
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNL   31 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~   31 (181)
                      +|.|.+|++.|.....+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46677777777777677776654


No 50 
>PRK04860 hypothetical protein; Provisional
Probab=94.99  E-value=0.0038  Score=45.64  Aligned_cols=38  Identities=16%  Similarity=0.235  Sum_probs=30.3

Q ss_pred             CcccCCcccccCCCchhHHHHHHhcCCCChhHHHHHHHhhhc
Q psy9958          45 KTHKCPECKKAFRHKGNLLRHMTLHDPDSELIEQQVALKLGR   86 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~   86 (181)
                      -+|.|. |++   ....+.+|.++|.+.++|.|..|...+..
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            468887 887   67778899999999999988888766543


No 51 
>KOG1146|consensus
Probab=94.92  E-value=0.018  Score=53.83  Aligned_cols=66  Identities=21%  Similarity=0.319  Sum_probs=51.7

Q ss_pred             ccCCCCceecccchhhccChhhHHHHHHHhcCCC------CCCCC----------CCCCcccCCcccccCCCchhHHHHH
Q psy9958           3 IHIDQNPYLCDHCDQTFRQKQLLKRHVNLYHNPH------YVPPS----------PKEKTHKCPECKKAFRHKGNLLRHM   66 (181)
Q Consensus         3 ~Ht~ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~------~~~~~----------~~~~~~~C~~C~k~F~~~~~l~~H~   66 (181)
                      +|+-.|-|+|+.|+..|+....|-.|||..|-..      +..++          .+.++|.|..|..+|..+.+|..|+
T Consensus       459 L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihl  538 (1406)
T KOG1146|consen  459 LHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHL  538 (1406)
T ss_pred             eecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHH
Confidence            3556688999999999999999999999854210      00000          2357899999999999999999998


Q ss_pred             Hh
Q psy9958          67 TL   68 (181)
Q Consensus        67 ~~   68 (181)
                      ..
T Consensus       539 qS  540 (1406)
T KOG1146|consen  539 QS  540 (1406)
T ss_pred             HH
Confidence            64


No 52 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=94.84  E-value=0.0075  Score=46.25  Aligned_cols=53  Identities=17%  Similarity=0.464  Sum_probs=34.1

Q ss_pred             CCceecccchhhccChhhHHHHHHHhc-CCCCCCCCCCCCc-----ccCCcccccCCCc
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLYH-NPHYVPPSPKEKT-----HKCPECKKAFRHK   59 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~hh-~~~~~~~~~~~~~-----~~C~~C~k~F~~~   59 (181)
                      +|...|++|++.|..+..+....+.-. ...+.+.-.+..|     +.|+.||.+|...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            467899999999999877766665421 1111111123333     4899999987755


No 53 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=94.78  E-value=0.015  Score=45.27  Aligned_cols=26  Identities=19%  Similarity=0.316  Sum_probs=14.1

Q ss_pred             CCCCceecccchhhccChhhHHHHHHH
Q psy9958           5 IDQNPYLCDHCDQTFRQKQLLKRHVNL   31 (181)
Q Consensus         5 t~ekp~~C~~C~k~f~~~~~L~~H~~~   31 (181)
                      .|.|.|+|.+|.. |...-.--.|+..
T Consensus       138 hGGrif~CsfC~~-flCEDDQFEHQAs  163 (314)
T PF06524_consen  138 HGGRIFKCSFCDN-FLCEDDQFEHQAS  163 (314)
T ss_pred             CCCeEEEeecCCC-eeeccchhhhhhh
Confidence            4567788888763 3333333444443


No 54 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.73  E-value=0.02  Score=28.31  Aligned_cols=21  Identities=24%  Similarity=0.632  Sum_probs=17.5

Q ss_pred             eecccchhhccChhhHHHHHHH
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNL   31 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~   31 (181)
                      ..|+.||+.| ....|.+|+..
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4799999999 56779999764


No 55 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.72  E-value=0.019  Score=30.45  Aligned_cols=24  Identities=17%  Similarity=0.315  Sum_probs=21.0

Q ss_pred             CcccCCcccccCCCchhHHHHHHh
Q psy9958          45 KTHKCPECKKAFRHKGNLLRHMTL   68 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l~~H~~~   68 (181)
                      .+|.|.+|++.|.....+..|++.
T Consensus         2 ~~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        2 GGFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             cCeEccccCCccCCHHHHHHHHCh
Confidence            368899999999999999999764


No 56 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.31  E-value=0.028  Score=33.26  Aligned_cols=29  Identities=31%  Similarity=0.527  Sum_probs=16.9

Q ss_pred             CCCCceecccchhhccChhhHHHHHHHhc
Q psy9958           5 IDQNPYLCDHCDQTFRQKQLLKRHVNLYH   33 (181)
Q Consensus         5 t~ekp~~C~~C~k~f~~~~~L~~H~~~hh   33 (181)
                      .|+..+.|+.|+..|.......+|....|
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            34555666666666666666666655444


No 57 
>KOG2186|consensus
Probab=94.03  E-value=0.034  Score=43.12  Aligned_cols=50  Identities=16%  Similarity=0.472  Sum_probs=40.4

Q ss_pred             ceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcC
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHD   70 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~   70 (181)
                      .|.|.+||...+.. .|-+|+...+          ...|.|.-|++.|-+ ..+..|.+--+
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCr----------n~~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCR----------NAYFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhcc----------CCeeEEeeccccccc-chhhhhhhhcc
Confidence            48999999998865 5788988874          378999999999998 66788875433


No 58 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=93.95  E-value=0.031  Score=43.60  Aligned_cols=29  Identities=24%  Similarity=0.409  Sum_probs=23.2

Q ss_pred             CCCCcccCCcccccCCCchhHHHHHHhcC
Q psy9958          42 PKEKTHKCPECKKAFRHKGNLLRHMTLHD   70 (181)
Q Consensus        42 ~~~~~~~C~~C~k~F~~~~~l~~H~~~h~   70 (181)
                      .+.+++.|+.||.-......|..-.|+|.
T Consensus       205 ~k~k~~PCPKCg~et~eTkdLSmStR~hk  233 (314)
T PF06524_consen  205 EKGKPIPCPKCGYETQETKDLSMSTRSHK  233 (314)
T ss_pred             ccCCCCCCCCCCCcccccccceeeeecch
Confidence            34689999999998888888887777663


No 59 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=93.76  E-value=0.048  Score=35.84  Aligned_cols=25  Identities=32%  Similarity=0.804  Sum_probs=22.1

Q ss_pred             ceecccchhhccChhhHHHHHHHhc
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLYH   33 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~hh   33 (181)
                      .|.|.+|++.|.+...|..|++.++
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCcc
Confidence            6999999999999999999999763


No 60 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.75  E-value=0.074  Score=28.12  Aligned_cols=24  Identities=29%  Similarity=0.843  Sum_probs=17.5

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccc
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKK   54 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k   54 (181)
                      |+|.+||..+...                     ..++.|+.||.
T Consensus         2 ~~C~~CGy~y~~~---------------------~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGE---------------------EAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCC---------------------cCCCcCcCCCC
Confidence            7888898655432                     26789999985


No 61 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.21  E-value=0.087  Score=35.93  Aligned_cols=30  Identities=23%  Similarity=0.653  Sum_probs=23.1

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCc
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHK   59 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~   59 (181)
                      ..|+.||++|.-.                    +..|..|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYDL--------------------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL--------------------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC--------------------CCCCccCCCCCCccCcc
Confidence            4799999988752                    23677899999988865


No 62 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=92.18  E-value=0.046  Score=32.36  Aligned_cols=30  Identities=27%  Similarity=0.643  Sum_probs=25.9

Q ss_pred             CCCCcccCCcccccCCCchhHHHHHHhcCC
Q psy9958          42 PKEKTHKCPECKKAFRHKGNLLRHMTLHDP   71 (181)
Q Consensus        42 ~~~~~~~C~~C~k~F~~~~~l~~H~~~h~~   71 (181)
                      .|+.-+.|+.|++.|.....+.+|....|+
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            578889999999999999999999765444


No 63 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=92.13  E-value=0.17  Score=28.62  Aligned_cols=34  Identities=35%  Similarity=0.729  Sum_probs=26.1

Q ss_pred             CCCCCCCCC-CCcccCCcccccCCCchhHHHHHHh
Q psy9958          35 PHYVPPSPK-EKTHKCPECKKAFRHKGNLLRHMTL   68 (181)
Q Consensus        35 ~~~~~~~~~-~~~~~C~~C~k~F~~~~~l~~H~~~   68 (181)
                      ++|++.+.| .-.|+|-.|..+...++.|-.||+-
T Consensus         8 phyiprp~gkp~~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen    8 PHYIPRPPGKPFKYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             CCcCCCCCCCCccceeecCCcccchHHHHHHHHHH
Confidence            356654444 3468899999999999999999974


No 64 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=92.01  E-value=0.34  Score=32.86  Aligned_cols=63  Identities=17%  Similarity=0.374  Sum_probs=44.3

Q ss_pred             CceecccchhhccChhhHHHHHHHhcCCC------------------------CCCCCCC---------CCcccC----C
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNLYHNPH------------------------YVPPSPK---------EKTHKC----P   50 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~hh~~~------------------------~~~~~~~---------~~~~~C----~   50 (181)
                      +-..|..|.....- +.+..|++..|...                        ...+...         -.-|.|    .
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~~~~   88 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQCDPP   88 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeecCCC
Confidence            55779999988776 77899988544221                        0011111         123789    9


Q ss_pred             cccccCCCchhHHHHHHhcCC
Q psy9958          51 ECKKAFRHKGNLLRHMTLHDP   71 (181)
Q Consensus        51 ~C~k~F~~~~~l~~H~~~h~~   71 (181)
                      .|+..+.+...+..|++.+|+
T Consensus        89 ~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   89 HCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCcEeccHHHHHHHHHHhcC
Confidence            999999999999999988764


No 65 
>PRK04860 hypothetical protein; Provisional
Probab=91.06  E-value=0.12  Score=37.81  Aligned_cols=31  Identities=23%  Similarity=0.521  Sum_probs=25.7

Q ss_pred             ChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCch
Q psy9958          21 QKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKG   60 (181)
Q Consensus        21 ~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~   60 (181)
                      ....+++|.++|         ++.++|.|..|++.|....
T Consensus       127 ~~~~~rrH~ri~---------~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        127 HQLTVRRHNRVV---------RGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             eeCHHHHHHHHh---------cCCccEECCCCCceeEEec
Confidence            346789999998         6889999999999987654


No 66 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.41  E-value=0.19  Score=26.79  Aligned_cols=25  Identities=28%  Similarity=0.747  Sum_probs=17.7

Q ss_pred             ceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccc
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKK   54 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k   54 (181)
                      .|+|.+||..+...                     ..|..|+.||.
T Consensus         2 ~~~C~~CG~i~~g~---------------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE---------------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC---------------------cCCCcCcCCCC
Confidence            58899998655421                     25678999986


No 67 
>KOG4124|consensus
Probab=89.43  E-value=0.099  Score=42.52  Aligned_cols=61  Identities=28%  Similarity=0.537  Sum_probs=44.7

Q ss_pred             CCceeccc--chhhccChhhHHHHHHHhcCCCCC------CCCCC----CCcccCCcccccCCCchhHHHHHH
Q psy9958           7 QNPYLCDH--CDQTFRQKQLLKRHVNLYHNPHYV------PPSPK----EKTHKCPECKKAFRHKGNLLRHMT   67 (181)
Q Consensus         7 ekp~~C~~--C~k~f~~~~~L~~H~~~hh~~~~~------~~~~~----~~~~~C~~C~k~F~~~~~l~~H~~   67 (181)
                      .+||+|.+  |.+.++....|+.|...-|...+-      .+|++    .|+|.|++|.++++.-..|..|..
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~~  419 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHRT  419 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCceee
Confidence            57899987  999999999999887655543221      33433    588999999988887777666543


No 68 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=89.05  E-value=0.23  Score=38.00  Aligned_cols=29  Identities=24%  Similarity=0.598  Sum_probs=16.3

Q ss_pred             CcccCCcccccCCCchhHHHHHHhcCCCC
Q psy9958          45 KTHKCPECKKAFRHKGNLLRHMTLHDPDS   73 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l~~H~~~h~~~~   73 (181)
                      ..|.|++|+|.|.-.....+|+...|.++
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            45666666666666666666666555543


No 69 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.98  E-value=0.26  Score=34.38  Aligned_cols=35  Identities=14%  Similarity=0.280  Sum_probs=25.7

Q ss_pred             ceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHH
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLL   63 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~   63 (181)
                      ...|+.||++|.-.                    +..|..|+.||..|.-...++
T Consensus         9 Kr~Cp~cg~kFYDL--------------------nk~p~vcP~cg~~~~~~~~~~   43 (129)
T TIGR02300         9 KRICPNTGSKFYDL--------------------NRRPAVSPYTGEQFPPEEALK   43 (129)
T ss_pred             cccCCCcCcccccc--------------------CCCCccCCCcCCccCcchhhc
Confidence            35799999998742                    236889999999987664443


No 70 
>KOG2071|consensus
Probab=88.92  E-value=0.27  Score=42.70  Aligned_cols=27  Identities=19%  Similarity=0.569  Sum_probs=23.5

Q ss_pred             CCceecccchhhccChhhHHHHHHHhc
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLYH   33 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~hh   33 (181)
                      .+|-.|..||.+|........||..|-
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            567899999999999999888888764


No 71 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=88.83  E-value=0.33  Score=27.22  Aligned_cols=24  Identities=25%  Similarity=0.557  Sum_probs=11.3

Q ss_pred             CCceecccchhhccCh----hhHHHHHH
Q psy9958           7 QNPYLCDHCDQTFRQK----QLLKRHVN   30 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~----~~L~~H~~   30 (181)
                      .....|.+|++.++..    ++|.+|++
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            3445666666666553    55666653


No 72 
>KOG2785|consensus
Probab=88.80  E-value=0.24  Score=40.81  Aligned_cols=61  Identities=18%  Similarity=0.380  Sum_probs=45.6

Q ss_pred             ceecccchhhccChhhHHHHHHHh-cCCCCC--------------------------CC-CCCCCcccCCcccccCCCch
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLY-HNPHYV--------------------------PP-SPKEKTHKCPECKKAFRHKG   60 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~h-h~~~~~--------------------------~~-~~~~~~~~C~~C~k~F~~~~   60 (181)
                      -|.|.-|...|......+.|+++- |.++..                          .+ ..+..++.|..|.|.|....
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~   82 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPK   82 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChh
Confidence            489999999999998888898752 211100                          11 23456889999999999999


Q ss_pred             hHHHHHHhc
Q psy9958          61 NLLRHMTLH   69 (181)
Q Consensus        61 ~l~~H~~~h   69 (181)
                      ....|++..
T Consensus        83 a~~~hl~Sk   91 (390)
T KOG2785|consen   83 AHENHLKSK   91 (390)
T ss_pred             hHHHHHHHh
Confidence            999998653


No 73 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=87.64  E-value=0.26  Score=26.71  Aligned_cols=34  Identities=18%  Similarity=0.489  Sum_probs=24.1

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCC
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFR   57 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~   57 (181)
                      +.|+.|+..|.-......              .......|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~~--------------~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLG--------------ANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHcC--------------CCCCEEECCCCCCEEE
Confidence            679999999887654321              1223678999998875


No 74 
>KOG4173|consensus
Probab=87.62  E-value=0.44  Score=36.06  Aligned_cols=68  Identities=21%  Similarity=0.331  Sum_probs=47.9

Q ss_pred             Cceeccc--chhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcC----------CCChh
Q psy9958           8 NPYLCDH--CDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHD----------PDSEL   75 (181)
Q Consensus         8 kp~~C~~--C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~----------~~~~~   75 (181)
                      +.|.|++  |-..|........|..+-|+            -.|..|.+.|.+..-|..|+.-.|          |.-.|
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~------------~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy  145 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHG------------NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMY  145 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhccc------------chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHH
Confidence            4578887  88888888877777655432            269999999999999999875432          44456


Q ss_pred             HH--HHHHHhhhcc
Q psy9958          76 IE--QQVALKLGRQ   87 (181)
Q Consensus        76 ~~--~~~~~~~~~~   87 (181)
                      .|  ..|..+|...
T Consensus       146 ~ClvEgCt~KFkT~  159 (253)
T KOG4173|consen  146 QCLVEGCTEKFKTS  159 (253)
T ss_pred             HHHHHhhhhhhhhh
Confidence            65  3566666443


No 75 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=87.38  E-value=0.079  Score=38.49  Aligned_cols=19  Identities=21%  Similarity=0.496  Sum_probs=14.7

Q ss_pred             CcccCCcccccCCCchhHH
Q psy9958          45 KTHKCPECKKAFRHKGNLL   63 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l~   63 (181)
                      +.+.|+.||++|.+--.+.
T Consensus        27 ~~~~c~~c~~~f~~~e~~~   45 (154)
T PRK00464         27 RRRECLACGKRFTTFERVE   45 (154)
T ss_pred             eeeeccccCCcceEeEecc
Confidence            3489999999998765543


No 76 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=87.30  E-value=0.34  Score=34.23  Aligned_cols=22  Identities=36%  Similarity=0.845  Sum_probs=13.4

Q ss_pred             eecccchhhccChhhHHHHHHHhcC
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHN   34 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~   34 (181)
                      -.|-.|||.|+.   |++|++.||+
T Consensus        73 i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-
T ss_pred             eEEccCCcccch---HHHHHHHccC
Confidence            468888888874   5888888764


No 77 
>KOG4173|consensus
Probab=86.59  E-value=0.094  Score=39.59  Aligned_cols=58  Identities=21%  Similarity=0.484  Sum_probs=45.1

Q ss_pred             ecccchhhccChhhHHHHHHHhcCCCCC-CCCCCCCcccCCc--ccccCCCchhHHHHHHh
Q psy9958          11 LCDHCDQTFRQKQLLKRHVNLYHNPHYV-PPSPKEKTHKCPE--CKKAFRHKGNLLRHMTL   68 (181)
Q Consensus        11 ~C~~C~k~f~~~~~L~~H~~~hh~~~~~-~~~~~~~~~~C~~--C~k~F~~~~~l~~H~~~   68 (181)
                      .|.+|.+.|.+...|..|+.-.|..-+- .+..|.--|.|-+  |+-.|.+....+.|+-.
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~  168 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIR  168 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHH
Confidence            7999999999999999999876642111 2224566799966  99999999999999644


No 78 
>KOG2785|consensus
Probab=86.24  E-value=0.49  Score=39.01  Aligned_cols=62  Identities=19%  Similarity=0.283  Sum_probs=47.9

Q ss_pred             CceecccchhhccChhhHHHHHHHhcCC-----CCCCCCCC---------CCcccCCccc---ccCCCchhHHHHHHhc
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNLYHNP-----HYVPPSPK---------EKTHKCPECK---KAFRHKGNLLRHMTLH   69 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~hh~~-----~~~~~~~~---------~~~~~C~~C~---k~F~~~~~l~~H~~~h   69 (181)
                      -|--|-+|++.|+....-..||..+|+.     .|+.-..|         ..-|.|-.|+   +.|.+-...+.||.-.
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhc
Confidence            4567999999999999999999999864     22211111         3457899999   9999999999999753


No 79 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=85.87  E-value=0.45  Score=33.65  Aligned_cols=27  Identities=33%  Similarity=0.520  Sum_probs=17.7

Q ss_pred             cccCCcccccCCCchhHHHHHHhcCCCChh
Q psy9958          46 THKCPECKKAFRHKGNLLRHMTLHDPDSEL   75 (181)
Q Consensus        46 ~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~   75 (181)
                      ...|-.|||.|..   |++|++.|+|-.+-
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~gltp~   98 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGLTPE   98 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S-HH
T ss_pred             eeEEccCCcccch---HHHHHHHccCCCHH
Confidence            4579999999986   69999999887653


No 80 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=85.75  E-value=0.41  Score=25.79  Aligned_cols=34  Identities=21%  Similarity=0.598  Sum_probs=24.6

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCC
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFR   57 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~   57 (181)
                      ..|+.|+..|.-......              .+....+|+.|+..|.
T Consensus         3 i~Cp~C~~~y~i~d~~ip--------------~~g~~v~C~~C~~~f~   36 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKIP--------------PKGRKVRCSKCGHVFF   36 (36)
T ss_pred             EECCCCCCEEeCCHHHCC--------------CCCcEEECCCCCCEeC
Confidence            479999998887654321              3456789999998874


No 81 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=85.62  E-value=0.6  Score=26.97  Aligned_cols=22  Identities=36%  Similarity=0.688  Sum_probs=13.6

Q ss_pred             cccCCcccccCCCc-----hhHHHHHH
Q psy9958          46 THKCPECKKAFRHK-----GNLLRHMT   67 (181)
Q Consensus        46 ~~~C~~C~k~F~~~-----~~l~~H~~   67 (181)
                      .-.|..|++.+...     ++|.+|++
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            34567777666554     46777766


No 82 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=85.41  E-value=0.59  Score=28.10  Aligned_cols=32  Identities=16%  Similarity=0.395  Sum_probs=20.6

Q ss_pred             ceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccc
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKK   54 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k   54 (181)
                      .|.|+.||+.-..+-.--   |.           -..+|.|+.||.
T Consensus        27 ~F~CPnCGe~~I~Rc~~C---Rk-----------~g~~Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIYRCAKC---RK-----------LGNPYRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeeehhhhH---HH-----------cCCceECCCcCc
Confidence            488999996655433211   11           147899999985


No 83 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=85.28  E-value=0.59  Score=33.59  Aligned_cols=38  Identities=21%  Similarity=0.537  Sum_probs=22.2

Q ss_pred             CCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCC
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFR   57 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~   57 (181)
                      ..-|.|+.|++.|.....+..   ..         . ...|.|+.||....
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~---~d---------~-~~~f~Cp~Cg~~l~  134 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQL---LD---------M-DGTFTCPRCGEELE  134 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHh---cC---------C-CCcEECCCCCCEEE
Confidence            445888888888775433221   01         1 23488888887543


No 84 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=85.27  E-value=0.58  Score=28.13  Aligned_cols=31  Identities=19%  Similarity=0.627  Sum_probs=18.2

Q ss_pred             ceecccchhh-ccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccc
Q psy9958           9 PYLCDHCDQT-FRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKK   54 (181)
Q Consensus         9 p~~C~~C~k~-f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k   54 (181)
                      .|.|+.||+. ..+-..-+    .           -..+|.|+.||+
T Consensus        25 ~F~CPnCG~~~I~RC~~CR----k-----------~~~~Y~CP~CGF   56 (59)
T PRK14890         25 KFLCPNCGEVIIYRCEKCR----K-----------QSNPYTCPKCGF   56 (59)
T ss_pred             EeeCCCCCCeeEeechhHH----h-----------cCCceECCCCCC
Confidence            4788888876 33222111    1           136888888875


No 85 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=85.09  E-value=0.21  Score=38.29  Aligned_cols=29  Identities=21%  Similarity=0.619  Sum_probs=23.3

Q ss_pred             CCCCceecccchhhccChhhHHHHHHHhc
Q psy9958           5 IDQNPYLCDHCDQTFRQKQLLKRHVNLYH   33 (181)
Q Consensus         5 t~ekp~~C~~C~k~f~~~~~L~~H~~~hh   33 (181)
                      .++..|.|..|+|.|+-...+++|+...|
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcC
Confidence            35667999999999999999999999876


No 86 
>KOG2231|consensus
Probab=84.76  E-value=0.69  Score=41.12  Aligned_cols=21  Identities=29%  Similarity=0.692  Sum_probs=11.7

Q ss_pred             cCCcccccCCCchhHHHHHHh
Q psy9958          48 KCPECKKAFRHKGNLLRHMTL   68 (181)
Q Consensus        48 ~C~~C~k~F~~~~~l~~H~~~   68 (181)
                      .|..|...|.....|.+|++.
T Consensus       184 ~C~~C~~~fld~~el~rH~~~  204 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRF  204 (669)
T ss_pred             cchhhhhhhccHHHHHHhhcc
Confidence            455555555555555555553


No 87 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=84.44  E-value=0.41  Score=31.10  Aligned_cols=35  Identities=20%  Similarity=0.466  Sum_probs=24.6

Q ss_pred             CceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchh
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGN   61 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~   61 (181)
                      .+|.|+.|++.        .+.|.           +..-|.|..||..|.-...
T Consensus        34 ~~~~Cp~C~~~--------~VkR~-----------a~GIW~C~kCg~~fAGgay   68 (89)
T COG1997          34 AKHVCPFCGRT--------TVKRI-----------ATGIWKCRKCGAKFAGGAY   68 (89)
T ss_pred             cCCcCCCCCCc--------ceeee-----------ccCeEEcCCCCCeeccccc
Confidence            46889999854        22232           3567899999999986554


No 88 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=84.25  E-value=0.51  Score=32.17  Aligned_cols=31  Identities=16%  Similarity=0.481  Sum_probs=21.4

Q ss_pred             cccCCcccccCCCchhHHHHHHhcCCCChhHHHHHHHhhhcc
Q psy9958          46 THKCPECKKAFRHKGNLLRHMTLHDPDSELIEQQVALKLGRQ   87 (181)
Q Consensus        46 ~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~   87 (181)
                      ...|+.||++|--   |        +..|..|+.|+..+...
T Consensus         9 KR~Cp~CG~kFYD---L--------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    9 KRTCPSCGAKFYD---L--------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cccCCCCcchhcc---C--------CCCCccCCCCCCccCcc
Confidence            4579999999864   2        22566788888776554


No 89 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=84.13  E-value=0.52  Score=25.53  Aligned_cols=34  Identities=26%  Similarity=0.673  Sum_probs=24.4

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCC
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFR   57 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~   57 (181)
                      ..|+.|+..|.-......              .+.+..+|+.|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~l~--------------~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDKLP--------------AGGRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHHcc--------------cCCcEEECCCCCcEee
Confidence            469999999986653211              2456889999998875


No 90 
>PHA00626 hypothetical protein
Probab=84.01  E-value=0.29  Score=29.00  Aligned_cols=16  Identities=13%  Similarity=0.258  Sum_probs=12.9

Q ss_pred             CCcccCCcccccCCCc
Q psy9958          44 EKTHKCPECKKAFRHK   59 (181)
Q Consensus        44 ~~~~~C~~C~k~F~~~   59 (181)
                      ...|.|+.||..|+..
T Consensus        21 snrYkCkdCGY~ft~~   36 (59)
T PHA00626         21 SDDYVCCDCGYNDSKD   36 (59)
T ss_pred             CcceEcCCCCCeechh
Confidence            3689999999988753


No 91 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=83.55  E-value=0.69  Score=37.99  Aligned_cols=60  Identities=28%  Similarity=0.572  Sum_probs=51.2

Q ss_pred             CCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCc--ccccCCCchhHHHHHHhcCCCChh
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPE--CKKAFRHKGNLLRHMTLHDPDSEL   75 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~--C~k~F~~~~~l~~H~~~h~~~~~~   75 (181)
                      .+++.|..|...|....++.+|.+.+         .+++++.|..  |.+.|.....+.+|.+.++.....
T Consensus        31 ~~~~~~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   92 (467)
T COG5048          31 PRPDSCPNCTDSFSRLEHLTRHIRSH---------TGEKPSQCSYSGCDKSFSRPLELSRHLRTHHNNPSD   92 (467)
T ss_pred             Cchhhcccccccccccchhhhhcccc---------cccCCccccccccccccCCcchhhhhcccccccccc
Confidence            46788999999999999999999998         7899999977  668899999999998887665443


No 92 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=82.36  E-value=0.76  Score=26.04  Aligned_cols=31  Identities=19%  Similarity=0.544  Sum_probs=21.4

Q ss_pred             CceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCC
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFR   57 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~   57 (181)
                      ..|+|+.||..|....                   ....+.|+.||..+.
T Consensus         2 ~~y~C~~CG~~~~~~~-------------------~~~~~~Cp~CG~~~~   32 (46)
T PRK00398          2 AEYKCARCGREVELDE-------------------YGTGVRCPYCGYRIL   32 (46)
T ss_pred             CEEECCCCCCEEEECC-------------------CCCceECCCCCCeEE
Confidence            3689999998776422                   112678999997554


No 93 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=79.41  E-value=1.1  Score=33.42  Aligned_cols=35  Identities=17%  Similarity=0.616  Sum_probs=23.5

Q ss_pred             CCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCc
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHK   59 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~   59 (181)
                      ..-|.|+.|+..|+....+.                  .-|.|+.||......
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~------------------~~F~Cp~Cg~~L~~~  149 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME------------------YGFRCPQCGEMLEEY  149 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh------------------cCCcCCCCCCCCeec
Confidence            34588888888887655431                  357888888765543


No 94 
>PF14353 CpXC:  CpXC protein
Probab=78.46  E-value=0.67  Score=32.36  Aligned_cols=47  Identities=30%  Similarity=0.521  Sum_probs=30.4

Q ss_pred             ecccchhhccChh----------hHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHH
Q psy9958          11 LCDHCDQTFRQKQ----------LLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMT   67 (181)
Q Consensus        11 ~C~~C~k~f~~~~----------~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~   67 (181)
                      .|+.|+..|....          .|+.-+..          ..-..|.|+.||+.|.-...+..|-.
T Consensus         3 tCP~C~~~~~~~v~~~I~~~~~p~l~e~il~----------g~l~~~~CP~Cg~~~~~~~p~lY~D~   59 (128)
T PF14353_consen    3 TCPHCGHEFEFEVWTSINADEDPELKEKILD----------GSLFSFTCPSCGHKFRLEYPLLYHDP   59 (128)
T ss_pred             CCCCCCCeeEEEEEeEEcCcCCHHHHHHHHc----------CCcCEEECCCCCCceecCCCEEEEcC
Confidence            6999998886432          22322221          12357899999999987777766643


No 95 
>KOG1146|consensus
Probab=78.38  E-value=1.1  Score=42.58  Aligned_cols=63  Identities=22%  Similarity=0.388  Sum_probs=46.1

Q ss_pred             CCceecccchhhccChhhHHHHHHHhcCCCCC---------CCCCCCCcccCCcccccCCCchhHHHHHHhcCC
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYV---------PPSPKEKTHKCPECKKAFRHKGNLLRHMTLHDP   71 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~---------~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~~   71 (181)
                      ..+|.|..|.-.|.....|..|.+..-- ...         ..+.-..+| |..|...|.....|..||+.-++
T Consensus      1282 ~~~~~~~~~~~~~~~~~~l~~~~~k~~~-~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~~ 1353 (1406)
T KOG1146|consen 1282 THRYLCRQCKMAFDGEAPLTAHQRKFCF-AGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSSAH 1353 (1406)
T ss_pred             chhHHHHHHHhhhcchhHHHHHHHHHHh-ccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHhhh
Confidence            4679999999999999999999854210 000         111223556 99999999999999999987433


No 96 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=78.06  E-value=1.8  Score=21.42  Aligned_cols=19  Identities=21%  Similarity=0.625  Sum_probs=13.2

Q ss_pred             cCCcccccCCCchhHHHHHH
Q psy9958          48 KCPECKKAFRHKGNLLRHMT   67 (181)
Q Consensus        48 ~C~~C~k~F~~~~~l~~H~~   67 (181)
                      .|++|++.+ ....+..|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            588888877 4466667754


No 97 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=77.91  E-value=1.6  Score=35.73  Aligned_cols=47  Identities=30%  Similarity=0.555  Sum_probs=31.9

Q ss_pred             ecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCccc----ccCCCchhHHHHHH
Q psy9958          11 LCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECK----KAFRHKGNLLRHMT   67 (181)
Q Consensus        11 ~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~----k~F~~~~~l~~H~~   67 (181)
                      .|.+|.+.|..-..|.+|+|..|.          +=|.|..-+    .-|..-..|..|.+
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE----------~ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHE----------ACHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhh----------hhhhhhccCccchhhhhCHHHHHHHhh
Confidence            599999999999999999998764          323332222    14555566666654


No 98 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=77.78  E-value=0.57  Score=29.47  Aligned_cols=41  Identities=20%  Similarity=0.465  Sum_probs=26.2

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCC--cccccCCCchh
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCP--ECKKAFRHKGN   61 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~--~C~k~F~~~~~   61 (181)
                      +.|+.||........-..+..           ..++.+.|.  .||.+|...-.
T Consensus         2 m~CP~Cg~~a~irtSr~~s~~-----------~~~~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITDT-----------TKERYHQCQNVNCSATFITYES   44 (72)
T ss_pred             ccCCCCCCccEEEEChhcChh-----------hheeeeecCCCCCCCEEEEEEE
Confidence            579999876644333222211           346788998  89999886544


No 99 
>KOG2231|consensus
Probab=77.36  E-value=1.3  Score=39.38  Aligned_cols=51  Identities=25%  Similarity=0.499  Sum_probs=39.3

Q ss_pred             ecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcc------cccCCCchhHHHHHHhcCCCCh
Q psy9958          11 LCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPEC------KKAFRHKGNLLRHMTLHDPDSE   74 (181)
Q Consensus        11 ~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C------~k~F~~~~~l~~H~~~h~~~~~   74 (181)
                      .|.+|...|-....|.+|++.+|             |.|.+|      +--|..-..|..|-|.+|--..
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h-------------~~chfC~~~~~~neyy~~~~dLe~HfR~~HflCE  240 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH-------------EFCHFCDYKTGQNEYYNDYDDLEEHFRKGHFLCE  240 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce-------------eheeecCcccccchhcccchHHHHHhhhcCcccc
Confidence            59999999999999999998764             456666      3467777888888887665444


No 100
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=77.36  E-value=0.54  Score=26.20  Aligned_cols=29  Identities=31%  Similarity=0.865  Sum_probs=21.3

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccc
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKK   54 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k   54 (181)
                      |+|..||..|.....+.                ...+..|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~----------------~~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSIS----------------EDDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEcC----------------CCCCCcCCCCCC
Confidence            88999999998654322                135678999987


No 101
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=76.92  E-value=1.2  Score=32.42  Aligned_cols=20  Identities=10%  Similarity=0.323  Sum_probs=12.5

Q ss_pred             CCCceecccchhhccChhhH
Q psy9958           6 DQNPYLCDHCDQTFRQKQLL   25 (181)
Q Consensus         6 ~ekp~~C~~C~k~f~~~~~L   25 (181)
                      +..-|.|+.|+..|+....+
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAM  125 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHH
Confidence            34457777777777665554


No 102
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=76.68  E-value=1.2  Score=31.33  Aligned_cols=22  Identities=27%  Similarity=0.470  Sum_probs=17.8

Q ss_pred             eecccchhhccChhhHHHHHHHhcC
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHN   34 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~   34 (181)
                      ..|-.|||.|+   .|++|..+|++
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccC
Confidence            46888999998   58999988864


No 103
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=75.86  E-value=0.72  Score=26.74  Aligned_cols=29  Identities=31%  Similarity=0.791  Sum_probs=19.5

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccc
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKK   54 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k   54 (181)
                      |+|..||..|.....+.                ...+-.|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~----------------~~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMS----------------DDPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEecC----------------CCCCCCCCCCCC
Confidence            88999999888532211                124557999986


No 104
>KOG4167|consensus
Probab=74.83  E-value=1.1  Score=40.07  Aligned_cols=26  Identities=15%  Similarity=0.404  Sum_probs=20.4

Q ss_pred             CceecccchhhccChhhHHHHHHHhc
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNLYH   33 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~hh   33 (181)
                      ..|.|..|+|.|-.-..+..||++|.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            35888888888888777888888873


No 105
>KOG3214|consensus
Probab=74.67  E-value=3.4  Score=27.59  Aligned_cols=17  Identities=18%  Similarity=0.501  Sum_probs=12.2

Q ss_pred             CcccCCcccccCCCchh
Q psy9958          45 KTHKCPECKKAFRHKGN   61 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~   61 (181)
                      ....|.+|+.+|...-+
T Consensus        46 G~~sC~iC~esFqt~it   62 (109)
T KOG3214|consen   46 GKASCRICEESFQTTIT   62 (109)
T ss_pred             ceeeeeehhhhhccchH
Confidence            34578889888887544


No 106
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=73.41  E-value=1.8  Score=30.57  Aligned_cols=25  Identities=36%  Similarity=0.424  Sum_probs=21.2

Q ss_pred             ccCCcccccCCCchhHHHHHHhcCCCCh
Q psy9958          47 HKCPECKKAFRHKGNLLRHMTLHDPDSE   74 (181)
Q Consensus        47 ~~C~~C~k~F~~~~~l~~H~~~h~~~~~   74 (181)
                      ..|-.|||.|.+   |++|+.+|.+-.+
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCCCH
Confidence            468899999985   9999999987655


No 107
>KOG4167|consensus
Probab=71.06  E-value=0.85  Score=40.77  Aligned_cols=29  Identities=28%  Similarity=0.432  Sum_probs=25.4

Q ss_pred             CcccCCcccccCCCchhHHHHHHhcCCCC
Q psy9958          45 KTHKCPECKKAFRHKGNLLRHMTLHDPDS   73 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l~~H~~~h~~~~   73 (181)
                      .-|.|..|+|.|.-...+..||++|.-..
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr~q~  819 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHRQQE  819 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHHHHH
Confidence            45899999999999999999999996543


No 108
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=70.91  E-value=2  Score=24.86  Aligned_cols=29  Identities=21%  Similarity=0.598  Sum_probs=19.4

Q ss_pred             CceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCccccc
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKA   55 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~   55 (181)
                      .-|+|-.||+.|..   +                .......|+.||..
T Consensus         5 ~~Y~C~~Cg~~~~~---~----------------~~~~~irCp~Cg~r   33 (49)
T COG1996           5 MEYKCARCGREVEL---D----------------QETRGIRCPYCGSR   33 (49)
T ss_pred             EEEEhhhcCCeeeh---h----------------hccCceeCCCCCcE
Confidence            45889999988821   0                12356789999853


No 109
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=69.56  E-value=2.3  Score=28.90  Aligned_cols=32  Identities=9%  Similarity=0.139  Sum_probs=22.9

Q ss_pred             ecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHH
Q psy9958          11 LCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLL   63 (181)
Q Consensus        11 ~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~   63 (181)
                      .|+.|++.|...                    ...|..|+.||++|.. +.|.
T Consensus        11 idPetg~KFYDL--------------------NrdPiVsPytG~s~P~-s~fe   42 (129)
T COG4530          11 IDPETGKKFYDL--------------------NRDPIVSPYTGKSYPR-SYFE   42 (129)
T ss_pred             cCccccchhhcc--------------------CCCccccCcccccchH-HHHH
Confidence            588888888642                    2368899999999943 4444


No 110
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=69.45  E-value=2.8  Score=35.38  Aligned_cols=32  Identities=16%  Similarity=0.469  Sum_probs=23.2

Q ss_pred             ecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhH
Q psy9958          11 LCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNL   62 (181)
Q Consensus        11 ~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l   62 (181)
                      +|+.||.+.+++                    |..-|+|+.||+++....-.
T Consensus       352 ~Cp~Cg~~m~S~--------------------G~~g~rC~kCg~~~~~~~~~  383 (421)
T COG1571         352 VCPRCGGRMKSA--------------------GRNGFRCKKCGTRARETLIK  383 (421)
T ss_pred             CCCccCCchhhc--------------------CCCCcccccccccCCccccc
Confidence            699999765532                    33489999999988876443


No 111
>KOG2593|consensus
Probab=68.20  E-value=2  Score=36.10  Aligned_cols=38  Identities=18%  Similarity=0.549  Sum_probs=26.6

Q ss_pred             CCCCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccc
Q psy9958           5 IDQNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKK   54 (181)
Q Consensus         5 t~ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k   54 (181)
                      +...-|.|+.|.+.|.....|+.   .-         ...-.|.|..|+-
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L---~~---------~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQL---LD---------NETGEFHCENCGG  161 (436)
T ss_pred             cccccccCCccccchhhhHHHHh---hc---------ccCceEEEecCCC
Confidence            44566999999999987666553   21         2246789999974


No 112
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=66.90  E-value=2.1  Score=30.08  Aligned_cols=19  Identities=21%  Similarity=0.511  Sum_probs=15.0

Q ss_pred             CCCcccCCcccccCCCchh
Q psy9958          43 KEKTHKCPECKKAFRHKGN   61 (181)
Q Consensus        43 ~~~~~~C~~C~k~F~~~~~   61 (181)
                      +...|.|..|++.|.....
T Consensus        50 ~~qRyrC~~C~~tf~~~~~   68 (129)
T COG3677          50 GHQRYKCKSCGSTFTVETG   68 (129)
T ss_pred             cccccccCCcCcceeeecc
Confidence            3578999999999886543


No 113
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=66.55  E-value=3.2  Score=27.20  Aligned_cols=14  Identities=29%  Similarity=0.857  Sum_probs=7.5

Q ss_pred             CcccCCcccccCCC
Q psy9958          45 KTHKCPECKKAFRH   58 (181)
Q Consensus        45 ~~~~C~~C~k~F~~   58 (181)
                      +|-.|..||+.|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            34455555555554


No 114
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=66.35  E-value=3.3  Score=20.57  Aligned_cols=10  Identities=40%  Similarity=1.052  Sum_probs=8.4

Q ss_pred             cCCcccccCC
Q psy9958          48 KCPECKKAFR   57 (181)
Q Consensus        48 ~C~~C~k~F~   57 (181)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5899999885


No 115
>KOG1280|consensus
Probab=65.84  E-value=5.1  Score=32.83  Aligned_cols=31  Identities=23%  Similarity=0.361  Sum_probs=25.0

Q ss_pred             cCCCCceecccchhhccChhhHHHHHHHhcC
Q psy9958           4 HIDQNPYLCDHCDQTFRQKQLLKRHVNLYHN   34 (181)
Q Consensus         4 Ht~ekp~~C~~C~k~f~~~~~L~~H~~~hh~   34 (181)
                      |-....|.|++|++.--+...|..|....|-
T Consensus        74 ~y~~qSftCPyC~~~Gfte~~f~~Hv~s~Hp  104 (381)
T KOG1280|consen   74 HYDPQSFTCPYCGIMGFTERQFGTHVLSQHP  104 (381)
T ss_pred             ccccccccCCcccccccchhHHHHHhhhcCc
Confidence            3345579999999988888889999887764


No 116
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=65.07  E-value=2  Score=28.27  Aligned_cols=17  Identities=24%  Similarity=0.479  Sum_probs=12.3

Q ss_pred             CCcccCCcccccCCCch
Q psy9958          44 EKTHKCPECKKAFRHKG   60 (181)
Q Consensus        44 ~~~~~C~~C~k~F~~~~   60 (181)
                      ...|.|..|++.|.--.
T Consensus        52 ~GIW~C~~C~~~~AGGA   68 (90)
T PTZ00255         52 VGIWRCKGCKKTVAGGA   68 (90)
T ss_pred             eEEEEcCCCCCEEeCCc
Confidence            35688888888877543


No 117
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=63.35  E-value=2.3  Score=30.10  Aligned_cols=16  Identities=19%  Similarity=0.565  Sum_probs=12.7

Q ss_pred             CCceecccchhhccCh
Q psy9958           7 QNPYLCDHCDQTFRQK   22 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~   22 (181)
                      ...|.|..||+.|...
T Consensus        68 p~~~~C~~CG~~~~~~   83 (135)
T PRK03824         68 EAVLKCRNCGNEWSLK   83 (135)
T ss_pred             ceEEECCCCCCEEecc
Confidence            3568999999888764


No 118
>KOG3408|consensus
Probab=63.26  E-value=3.8  Score=28.37  Aligned_cols=28  Identities=25%  Similarity=0.458  Sum_probs=24.0

Q ss_pred             CCCCcccCCcccccCCCchhHHHHHHhc
Q psy9958          42 PKEKTHKCPECKKAFRHKGNLLRHMTLH   69 (181)
Q Consensus        42 ~~~~~~~C~~C~k~F~~~~~l~~H~~~h   69 (181)
                      +|..-|-|..|.+-|.....|..|.++.
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhcc
Confidence            4556689999999999999999998764


No 119
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=63.26  E-value=3.2  Score=22.34  Aligned_cols=33  Identities=15%  Similarity=0.531  Sum_probs=20.5

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCc
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHK   59 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~   59 (181)
                      +.|+.||+.|.....                 +-...-.|..||-.+.++
T Consensus         2 r~C~~Cg~~Yh~~~~-----------------pP~~~~~Cd~cg~~L~qR   34 (36)
T PF05191_consen    2 RICPKCGRIYHIEFN-----------------PPKVEGVCDNCGGELVQR   34 (36)
T ss_dssp             EEETTTTEEEETTTB-------------------SSTTBCTTTTEBEBEE
T ss_pred             cCcCCCCCccccccC-----------------CCCCCCccCCCCCeeEeC
Confidence            578889988874321                 223455788888765443


No 120
>KOG2482|consensus
Probab=62.98  E-value=7.7  Score=31.86  Aligned_cols=61  Identities=25%  Similarity=0.397  Sum_probs=41.3

Q ss_pred             ceecccchhhccC-hhhHHHHHHHhcCCCCCCCC-------------CCCCcccCCcccccCCCchhHHHHHHhc
Q psy9958           9 PYLCDHCDQTFRQ-KQLLKRHVNLYHNPHYVPPS-------------PKEKTHKCPECKKAFRHKGNLLRHMTLH   69 (181)
Q Consensus         9 p~~C~~C~k~f~~-~~~L~~H~~~hh~~~~~~~~-------------~~~~~~~C~~C~k~F~~~~~l~~H~~~h   69 (181)
                      .-+|-.|...+.. ++....|+-..|.-..-.|.             ..-..+.|-.|.|.|+.+..|+.|||..
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhc
Confidence            3568889886654 56677776655543211111             1113578999999999999999999863


No 121
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=62.75  E-value=5.1  Score=19.51  Aligned_cols=11  Identities=27%  Similarity=0.751  Sum_probs=8.1

Q ss_pred             CCcccCCcccc
Q psy9958          44 EKTHKCPECKK   54 (181)
Q Consensus        44 ~~~~~C~~C~k   54 (181)
                      ..+|.|+.||+
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            46788888874


No 122
>KOG2482|consensus
Probab=62.69  E-value=4.1  Score=33.38  Aligned_cols=62  Identities=23%  Similarity=0.443  Sum_probs=44.8

Q ss_pred             ceecccchhhccChhhHHHHHHHhcCC---------------CCC-------CC-----------------------CCC
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLYHNP---------------HYV-------PP-----------------------SPK   43 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~hh~~---------------~~~-------~~-----------------------~~~   43 (181)
                      .+.|-+|.|.|+.+..|+.|||.....               +|.       .+                       ..+
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~  274 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDD  274 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCC
Confidence            578999999999999999999974321               011       00                       011


Q ss_pred             CCc--ccCCcccccCCCchhHHHHHHhcC
Q psy9958          44 EKT--HKCPECKKAFRHKGNLLRHMTLHD   70 (181)
Q Consensus        44 ~~~--~~C~~C~k~F~~~~~l~~H~~~h~   70 (181)
                      ..+  ..|-.|....-....|..||++-|
T Consensus       275 a~a~~v~CLfC~~~~en~~~l~eHmk~vH  303 (423)
T KOG2482|consen  275 AEALSVVCLFCTNFYENPVFLFEHMKIVH  303 (423)
T ss_pred             CCccceEEEeeccchhhHHHHHHHHHHHH
Confidence            112  489999999999999999998643


No 123
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=62.64  E-value=2.1  Score=27.12  Aligned_cols=11  Identities=36%  Similarity=1.081  Sum_probs=7.5

Q ss_pred             eecccchhhcc
Q psy9958          10 YLCDHCDQTFR   20 (181)
Q Consensus        10 ~~C~~C~k~f~   20 (181)
                      |+|..|+..|.
T Consensus        13 Y~c~~cg~~~d   23 (82)
T COG2331          13 YECTECGNRFD   23 (82)
T ss_pred             EeecccchHHH
Confidence            67777776664


No 124
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=62.54  E-value=2  Score=28.27  Aligned_cols=18  Identities=17%  Similarity=0.407  Sum_probs=12.8

Q ss_pred             CCcccCCcccccCCCchh
Q psy9958          44 EKTHKCPECKKAFRHKGN   61 (181)
Q Consensus        44 ~~~~~C~~C~k~F~~~~~   61 (181)
                      ...|.|..|++.|.--..
T Consensus        51 ~GIW~C~~C~~~~AGGAy   68 (91)
T TIGR00280        51 TGIWTCRKCGAKFAGGAY   68 (91)
T ss_pred             eEEEEcCCCCCEEeCCcc
Confidence            356888888888776443


No 125
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=62.51  E-value=6.3  Score=32.47  Aligned_cols=23  Identities=17%  Similarity=0.550  Sum_probs=18.9

Q ss_pred             ceecccchhhccChhhHHHHHHH
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNL   31 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~   31 (181)
                      -+-|..|++.|++...+..|...
T Consensus       238 ~~YC~~C~r~f~~~~VFe~Hl~g  260 (470)
T COG5188         238 KVYCVKCGREFSRSKVFEYHLEG  260 (470)
T ss_pred             ceeeHhhhhHhhhhHHHHHHHhh
Confidence            36699999999998888888654


No 126
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=61.71  E-value=4.5  Score=27.71  Aligned_cols=11  Identities=27%  Similarity=0.577  Sum_probs=6.2

Q ss_pred             eecccchhhcc
Q psy9958          10 YLCDHCDQTFR   20 (181)
Q Consensus        10 ~~C~~C~k~f~   20 (181)
                      +.|..|++.|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PRK12380         71 AWCWDCSQVVE   81 (113)
T ss_pred             EEcccCCCEEe
Confidence            55666665444


No 127
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=60.06  E-value=4.5  Score=22.79  Aligned_cols=26  Identities=27%  Similarity=0.751  Sum_probs=18.5

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCccccc
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKA   55 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~   55 (181)
                      |.|..||..|...                    ...+..|+.||..
T Consensus         3 Y~C~~Cg~~~~~~--------------------~~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK--------------------SKDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC--------------------CCCceECCCCCce
Confidence            7899999877743                    1246789999864


No 128
>KOG0696|consensus
Probab=59.35  E-value=5.1  Score=34.17  Aligned_cols=60  Identities=17%  Similarity=0.266  Sum_probs=44.8

Q ss_pred             CCCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHH-HHhcCCCChhHHHHHHHh
Q psy9958           6 DQNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRH-MTLHDPDSELIEQQVALK   83 (181)
Q Consensus         6 ~ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H-~~~h~~~~~~~~~~~~~~   83 (181)
                      |+.=|+|++|.        +..|.|-|          .-..|.|+--+|.+.+-....+| .++|+=..|.-|..|+.-
T Consensus        70 gKQGfQCqvC~--------fvvHkrCh----------efVtF~CPGadkg~dtDdpr~kHkf~~~tYssPTFCDhCGsL  130 (683)
T KOG0696|consen   70 GKQGFQCQVCC--------FVVHKRCH----------EFVTFSCPGADKGPDTDDPRSKHKFKIHTYSSPTFCDHCGSL  130 (683)
T ss_pred             ccCceeeeEEe--------ehhhhhhc----------ceEEEECCCCCCCCCCCCcccccceeeeecCCCchhhhHHHH
Confidence            34557888884        66787876          34688999989999888888888 466777777777777753


No 129
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=59.22  E-value=4.5  Score=23.85  Aligned_cols=41  Identities=22%  Similarity=0.553  Sum_probs=23.7

Q ss_pred             Cceeccc--chhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCc----ccccCCC
Q psy9958           8 NPYLCDH--CDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPE----CKKAFRH   58 (181)
Q Consensus         8 kp~~C~~--C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~----C~k~F~~   58 (181)
                      .+-.|+.  |...+.+ ..|..|+...         =..++..|+.    |...|..
T Consensus         8 ~~v~C~~~cc~~~i~r-~~l~~H~~~~---------C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIPR-KELDDHLENE---------CPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             SEEE-TT--S-BEEEC-CCHHHHHHTT---------STTSEEE-SS----S--EEEH
T ss_pred             CEeeCCCCCcccceeH-HHHHHHHHcc---------CCCCcEECCCCCCCCCCccch
Confidence            4567887  5555664 4689998743         2356778888    8877654


No 130
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=58.00  E-value=1.8  Score=33.50  Aligned_cols=26  Identities=12%  Similarity=0.510  Sum_probs=20.6

Q ss_pred             CCceecccchhhccChhhHHHHHHHh
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLY   32 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~h   32 (181)
                      ++.+.|++|+-.|.....+..-+|+-
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRii   42 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRII   42 (267)
T ss_pred             hceeccCcccchhhhhheeccceeEe
Confidence            45688999999999887777666654


No 131
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=57.90  E-value=1.7  Score=32.73  Aligned_cols=42  Identities=31%  Similarity=0.459  Sum_probs=24.9

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCCCCCCCC---CcccCCcccccCCCchhH
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKE---KTHKCPECKKAFRHKGNL   62 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~---~~~~C~~C~k~F~~~~~l   62 (181)
                      -.|++||.      .|..|++.+.-     |+-|+   ..+.|..||++++-...|
T Consensus        15 ~~CPvCg~------~l~~~~~~~~I-----PyFG~V~i~t~~C~~CgYR~~DV~~~   59 (201)
T COG1779          15 IDCPVCGG------TLKAHMYLYDI-----PYFGEVLISTGVCERCGYRSTDVKTL   59 (201)
T ss_pred             ecCCcccc------eeeEEEeeecC-----CccceEEEEEEEccccCCcccceeec
Confidence            46999996      35555554321     11232   245799999887755443


No 132
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=57.71  E-value=4.6  Score=22.09  Aligned_cols=14  Identities=29%  Similarity=0.823  Sum_probs=11.3

Q ss_pred             ceecccchhhccCh
Q psy9958           9 PYLCDHCDQTFRQK   22 (181)
Q Consensus         9 p~~C~~C~k~f~~~   22 (181)
                      ||.|..|++.|=.+
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            88899999888743


No 133
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=57.07  E-value=6.1  Score=27.12  Aligned_cols=12  Identities=17%  Similarity=0.700  Sum_probs=6.0

Q ss_pred             ccCCcccccCCC
Q psy9958          47 HKCPECKKAFRH   58 (181)
Q Consensus        47 ~~C~~C~k~F~~   58 (181)
                      +.|..|++.|..
T Consensus        71 ~~C~~Cg~~~~~   82 (115)
T TIGR00100        71 CECEDCSEEVSP   82 (115)
T ss_pred             EEcccCCCEEec
Confidence            445555555443


No 134
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=56.32  E-value=2.7  Score=27.60  Aligned_cols=15  Identities=20%  Similarity=0.534  Sum_probs=10.8

Q ss_pred             CcccCCcccccCCCc
Q psy9958          45 KTHKCPECKKAFRHK   59 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~   59 (181)
                      ..|.|..|++.|.--
T Consensus        53 GIW~C~~C~~~~AGG   67 (90)
T PRK03976         53 GIWECRKCGAKFAGG   67 (90)
T ss_pred             EEEEcCCCCCEEeCC
Confidence            567788888877654


No 135
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=55.84  E-value=4  Score=22.54  Aligned_cols=11  Identities=27%  Similarity=1.011  Sum_probs=5.6

Q ss_pred             ceecccchhhc
Q psy9958           9 PYLCDHCDQTF   19 (181)
Q Consensus         9 p~~C~~C~k~f   19 (181)
                      +-.|++|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            44555555544


No 136
>PF12907 zf-met2:  Zinc-binding
Probab=54.31  E-value=6  Score=21.86  Aligned_cols=24  Identities=42%  Similarity=0.696  Sum_probs=12.3

Q ss_pred             eecccchhhccCh---hhHHHHHHHhc
Q psy9958          10 YLCDHCDQTFRQK---QLLKRHVNLYH   33 (181)
Q Consensus        10 ~~C~~C~k~f~~~---~~L~~H~~~hh   33 (181)
                      +.|.+|-..|..-   ..|..|....|
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKH   28 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKH   28 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccC
Confidence            4566666544433   34666655443


No 137
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=53.91  E-value=14  Score=24.81  Aligned_cols=38  Identities=16%  Similarity=0.355  Sum_probs=32.5

Q ss_pred             CCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccc
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKK   54 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k   54 (181)
                      +..|.|+.-|..|.........+...          ..+.|.|...|+
T Consensus         1 eeVf~i~~T~EiF~dYe~Y~~R~~~y----------~~~vwtC~~TGk   38 (102)
T PF10537_consen    1 EEVFYIPFTGEIFRDYEEYLKRMILY----------NQRVWTCEITGK   38 (102)
T ss_pred             CceEEeCCCCcccCCHHHHHHHHHHH----------hCCeeEEecCCC
Confidence            35689999999999999988888776          468999999887


No 138
>KOG3408|consensus
Probab=53.42  E-value=10  Score=26.36  Aligned_cols=24  Identities=25%  Similarity=0.587  Sum_probs=21.6

Q ss_pred             CceecccchhhccChhhHHHHHHH
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNL   31 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~   31 (181)
                      -.|-|-.|.+-|.....|..|.++
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHhc
Confidence            458899999999999999999875


No 139
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=53.42  E-value=7.5  Score=26.80  Aligned_cols=10  Identities=30%  Similarity=0.992  Sum_probs=4.9

Q ss_pred             eecccchhhc
Q psy9958          10 YLCDHCDQTF   19 (181)
Q Consensus        10 ~~C~~C~k~f   19 (181)
                      +.|..||+.|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            4455555444


No 140
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=53.28  E-value=12  Score=30.89  Aligned_cols=61  Identities=25%  Similarity=0.368  Sum_probs=40.9

Q ss_pred             eeccc--chhhccChhhHHHHHHHhcCCCCC----------------------CCC-------CCCC-cccCCcccccCC
Q psy9958          10 YLCDH--CDQTFRQKQLLKRHVNLYHNPHYV----------------------PPS-------PKEK-THKCPECKKAFR   57 (181)
Q Consensus        10 ~~C~~--C~k~f~~~~~L~~H~~~hh~~~~~----------------------~~~-------~~~~-~~~C~~C~k~F~   57 (181)
                      |.|+.  |...+.....|+.|.+..|+.-+.                      +.|       .|-| .-.|..|.+.|-
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~FY  231 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHGFVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIYFY  231 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcCcEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccceec
Confidence            66775  777766677788888776643100                      111       1111 226999999999


Q ss_pred             CchhHHHHHHhcC
Q psy9958          58 HKGNLLRHMTLHD   70 (181)
Q Consensus        58 ~~~~l~~H~~~h~   70 (181)
                      .-..|.+|+|..|
T Consensus       232 dDDEL~~HcR~~H  244 (493)
T COG5236         232 DDDELRRHCRLRH  244 (493)
T ss_pred             ChHHHHHHHHhhh
Confidence            9999999998754


No 141
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=52.76  E-value=3.9  Score=37.10  Aligned_cols=12  Identities=33%  Similarity=0.922  Sum_probs=7.3

Q ss_pred             CCCcccCCcccc
Q psy9958          43 KEKTHKCPECKK   54 (181)
Q Consensus        43 ~~~~~~C~~C~k   54 (181)
                      ...|..|+.||.
T Consensus       472 ~~~p~~Cp~Cgs  483 (730)
T COG1198         472 EPIPQSCPECGS  483 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            345666666664


No 142
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=52.38  E-value=7.1  Score=23.85  Aligned_cols=16  Identities=19%  Similarity=0.646  Sum_probs=11.9

Q ss_pred             CCCcccCCcccccCCC
Q psy9958          43 KEKTHKCPECKKAFRH   58 (181)
Q Consensus        43 ~~~~~~C~~C~k~F~~   58 (181)
                      ..+.|.|+.||..+.+
T Consensus        43 ~~r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   43 SGRVFTCPNCGFEMDR   58 (69)
T ss_pred             ccceEEcCCCCCEECc
Confidence            3578889999887654


No 143
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=52.18  E-value=7.2  Score=26.67  Aligned_cols=12  Identities=25%  Similarity=0.753  Sum_probs=7.7

Q ss_pred             eecccchhhccC
Q psy9958          10 YLCDHCDQTFRQ   21 (181)
Q Consensus        10 ~~C~~C~k~f~~   21 (181)
                      +.|..||+.|.-
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            567777777764


No 144
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=52.13  E-value=6.2  Score=30.22  Aligned_cols=43  Identities=19%  Similarity=0.281  Sum_probs=29.0

Q ss_pred             CCcccCCcccccCCCchhHHHHHHhcC----------CCChh-----HHHHHHHhhhc
Q psy9958          44 EKTHKCPECKKAFRHKGNLLRHMTLHD----------PDSEL-----IEQQVALKLGR   86 (181)
Q Consensus        44 ~~~~~C~~C~k~F~~~~~l~~H~~~h~----------~~~~~-----~~~~~~~~~~~   86 (181)
                      .+.+.||+|++.|.++.-+....+.-.          +-.|+     .|+.|+..+..
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~   60 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFE   60 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCcccc
Confidence            467899999999999877776655421          22222     48888876543


No 145
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=51.53  E-value=2.4  Score=28.35  Aligned_cols=12  Identities=33%  Similarity=0.767  Sum_probs=6.8

Q ss_pred             cccCCcccccCC
Q psy9958          46 THKCPECKKAFR   57 (181)
Q Consensus        46 ~~~C~~C~k~F~   57 (181)
                      ...|..||.+|.
T Consensus        46 ~~~Cg~CGls~e   57 (104)
T COG4888          46 TAVCGNCGLSFE   57 (104)
T ss_pred             EEEcccCcceEE
Confidence            345666666554


No 146
>PRK01343 zinc-binding protein; Provisional
Probab=51.24  E-value=17  Score=21.72  Aligned_cols=26  Identities=23%  Similarity=0.419  Sum_probs=17.9

Q ss_pred             CcccCCcccccCCCchhHHHHHHhcCCCChhHHHHHHH
Q psy9958          45 KTHKCPECKKAFRHKGNLLRHMTLHDPDSELIEQQVAL   82 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~~~~~   82 (181)
                      ....|+.|+|.|..            ...+|....|..
T Consensus         8 p~~~CP~C~k~~~~------------~~rPFCS~RC~~   33 (57)
T PRK01343          8 PTRPCPECGKPSTR------------EAYPFCSERCRD   33 (57)
T ss_pred             CCCcCCCCCCcCcC------------CCCcccCHHHhh
Confidence            45679999998752            345776666653


No 147
>KOG1832|consensus
Probab=50.90  E-value=9.4  Score=35.57  Aligned_cols=11  Identities=27%  Similarity=0.842  Sum_probs=4.8

Q ss_pred             ccccCCCchhH
Q psy9958          52 CKKAFRHKGNL   62 (181)
Q Consensus        52 C~k~F~~~~~l   62 (181)
                      |.-+|.+.++.
T Consensus      1305 c~VtFNstG~V 1315 (1516)
T KOG1832|consen 1305 CAVTFNSTGDV 1315 (1516)
T ss_pred             eEEEeccCccc
Confidence            44444444443


No 148
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=50.69  E-value=6.1  Score=21.29  Aligned_cols=15  Identities=20%  Similarity=0.623  Sum_probs=11.5

Q ss_pred             cccCCcccccCCCch
Q psy9958          46 THKCPECKKAFRHKG   60 (181)
Q Consensus        46 ~~~C~~C~k~F~~~~   60 (181)
                      .|+|..||+.|....
T Consensus         5 ~y~C~~Cg~~fe~~~   19 (41)
T smart00834        5 EYRCEDCGHTFEVLQ   19 (41)
T ss_pred             EEEcCCCCCEEEEEE
Confidence            578999999887543


No 149
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=50.03  E-value=5.6  Score=22.12  Aligned_cols=15  Identities=40%  Similarity=1.034  Sum_probs=9.2

Q ss_pred             CceecccchhhccCh
Q psy9958           8 NPYLCDHCDQTFRQK   22 (181)
Q Consensus         8 kp~~C~~C~k~f~~~   22 (181)
                      -||.|..|++.|=.+
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            578899999888643


No 150
>KOG2071|consensus
Probab=49.36  E-value=11  Score=33.07  Aligned_cols=30  Identities=27%  Similarity=0.570  Sum_probs=26.1

Q ss_pred             CCCcccCCcccccCCCchhHHHHHHhcCCC
Q psy9958          43 KEKTHKCPECKKAFRHKGNLLRHMTLHDPD   72 (181)
Q Consensus        43 ~~~~~~C~~C~k~F~~~~~l~~H~~~h~~~   72 (181)
                      ...|.+|..||.+|........||-.|..+
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~dw  444 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHDDW  444 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhhhh
Confidence            356789999999999999999999888654


No 151
>KOG0978|consensus
Probab=49.00  E-value=4.9  Score=36.13  Aligned_cols=54  Identities=22%  Similarity=0.423  Sum_probs=29.9

Q ss_pred             ceecccchhhccChhhH-HHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHH
Q psy9958           9 PYLCDHCDQTFRQKQLL-KRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRH   65 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L-~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H   65 (181)
                      ..+|+.|..+|+...-. -.|..-...   +.+-...+--+||.|+..|....-+..|
T Consensus       643 ~LkCs~Cn~R~Kd~vI~kC~H~FC~~C---vq~r~etRqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  643 LLKCSVCNTRWKDAVITKCGHVFCEEC---VQTRYETRQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             ceeCCCccCchhhHHHHhcchHHHHHH---HHHHHHHhcCCCCCCCCCCCcccccccC
Confidence            35799998777765322 233221100   0000122444799999999877665544


No 152
>PRK14873 primosome assembly protein PriA; Provisional
Probab=48.70  E-value=12  Score=33.69  Aligned_cols=10  Identities=30%  Similarity=1.042  Sum_probs=5.5

Q ss_pred             CcccCCcccc
Q psy9958          45 KTHKCPECKK   54 (181)
Q Consensus        45 ~~~~C~~C~k   54 (181)
                      .|+.|+.||.
T Consensus       421 ~p~~Cp~Cgs  430 (665)
T PRK14873        421 PDWRCPRCGS  430 (665)
T ss_pred             cCccCCCCcC
Confidence            3555666654


No 153
>KOG4124|consensus
Probab=48.26  E-value=8.7  Score=31.65  Aligned_cols=62  Identities=8%  Similarity=0.020  Sum_probs=41.0

Q ss_pred             CCCceeccc--chhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHH-HHhcCCC
Q psy9958           6 DQNPYLCDH--CDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRH-MTLHDPD   72 (181)
Q Consensus         6 ~ekp~~C~~--C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H-~~~h~~~   72 (181)
                      .|++|.|.+  |.++++.-.....|-..-+-    ..-+..+||+|+ |++.+.++..|+.| +..|.+.
T Consensus       175 EE~~~S~~vp~~~~~~~~~Ns~~~~S~~~~~----T~~t~~~p~k~~-~~~~~~T~~~l~~HS~N~~~~~  239 (442)
T KOG4124|consen  175 EEYRVSVVVPAAAAAAAAANSSDMSSDEASS----TAETTGTPKKMP-ESLVMDTSSPLSDHSMNIDVGE  239 (442)
T ss_pred             ccccccccCchhhhhhhcccccccccccccc----ccccccCCccCc-ccccccccchhhhccccCCCCc
Confidence            368888887  77776655444444322211    111456899997 99999999999998 4555554


No 154
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=48.25  E-value=1.6  Score=24.05  Aligned_cols=13  Identities=23%  Similarity=0.608  Sum_probs=10.3

Q ss_pred             CcccCCcccccCC
Q psy9958          45 KTHKCPECKKAFR   57 (181)
Q Consensus        45 ~~~~C~~C~k~F~   57 (181)
                      .-|.|..|+..|+
T Consensus        27 ~fy~C~~C~~~w~   39 (40)
T smart00440       27 VFYVCTKCGHRWR   39 (40)
T ss_pred             EEEEeCCCCCEeC
Confidence            4689999998775


No 155
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=48.19  E-value=9.9  Score=26.06  Aligned_cols=10  Identities=30%  Similarity=0.866  Sum_probs=5.8

Q ss_pred             eecccchhhc
Q psy9958          10 YLCDHCDQTF   19 (181)
Q Consensus        10 ~~C~~C~k~f   19 (181)
                      +.|..|++.|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            5666666533


No 156
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=47.64  E-value=7.6  Score=23.68  Aligned_cols=11  Identities=27%  Similarity=0.649  Sum_probs=5.0

Q ss_pred             eecccchhhcc
Q psy9958          10 YLCDHCDQTFR   20 (181)
Q Consensus        10 ~~C~~C~k~f~   20 (181)
                      -.|..|++.|.
T Consensus        10 ~~C~~C~~~F~   20 (69)
T PF01363_consen   10 SNCMICGKKFS   20 (69)
T ss_dssp             SB-TTT--B-B
T ss_pred             CcCcCcCCcCC
Confidence            45888888885


No 157
>KOG2893|consensus
Probab=47.43  E-value=7.8  Score=30.21  Aligned_cols=36  Identities=22%  Similarity=0.391  Sum_probs=26.8

Q ss_pred             CCcccCCcccccCCCchhHHHHHHhcCCCChhHHHHHHHhh
Q psy9958          44 EKTHKCPECKKAFRHKGNLLRHMTLHDPDSELIEQQVALKL   84 (181)
Q Consensus        44 ~~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~~~~~~~   84 (181)
                      .|+| |=.|++-|.-..-|.+|++..|    |.|-.|-+++
T Consensus         9 ~kpw-cwycnrefddekiliqhqkakh----fkchichkkl   44 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQKAKH----FKCHICHKKL   44 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhhhcc----ceeeeehhhh
Confidence            4565 7789999999999999987543    5566665554


No 158
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=47.12  E-value=12  Score=32.44  Aligned_cols=11  Identities=27%  Similarity=0.893  Sum_probs=6.7

Q ss_pred             CCcccCCcccc
Q psy9958          44 EKTHKCPECKK   54 (181)
Q Consensus        44 ~~~~~C~~C~k   54 (181)
                      ..|+.|+.|+.
T Consensus       251 ~~~~~Cp~C~s  261 (505)
T TIGR00595       251 PIPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCCC
Confidence            34666777764


No 159
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=46.90  E-value=13  Score=32.04  Aligned_cols=27  Identities=19%  Similarity=0.504  Sum_probs=23.9

Q ss_pred             CceecccchhhccChhhHHHHHHHhcC
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNLYHN   34 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~hh~   34 (181)
                      +-+.|+.|.+.|.....+..|+..-|-
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~   82 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHP   82 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhh
Confidence            357899999999999999999997774


No 160
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=46.50  E-value=2.7  Score=21.33  Aligned_cols=9  Identities=44%  Similarity=1.228  Sum_probs=4.4

Q ss_pred             cCCcccccC
Q psy9958          48 KCPECKKAF   56 (181)
Q Consensus        48 ~C~~C~k~F   56 (181)
                      .|.-|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344455555


No 161
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=46.13  E-value=11  Score=19.72  Aligned_cols=12  Identities=33%  Similarity=0.977  Sum_probs=7.9

Q ss_pred             CcccCCcccccC
Q psy9958          45 KTHKCPECKKAF   56 (181)
Q Consensus        45 ~~~~C~~C~k~F   56 (181)
                      -+..|+.||.+-
T Consensus        16 ~~irC~~CG~RI   27 (32)
T PF03604_consen   16 DPIRCPECGHRI   27 (32)
T ss_dssp             STSSBSSSS-SE
T ss_pred             CcEECCcCCCeE
Confidence            456899998653


No 162
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=45.19  E-value=11  Score=32.28  Aligned_cols=12  Identities=25%  Similarity=0.949  Sum_probs=9.0

Q ss_pred             Cceecccchhhc
Q psy9958           8 NPYLCDHCDQTF   19 (181)
Q Consensus         8 kp~~C~~C~k~f   19 (181)
                      ..|.|..||..+
T Consensus         6 ~~y~C~~Cg~~~   17 (454)
T TIGR00416         6 SKFVCQHCGADS   17 (454)
T ss_pred             CeEECCcCCCCC
Confidence            359999999543


No 163
>COG1773 Rubredoxin [Energy production and conversion]
Probab=45.06  E-value=8.1  Score=22.91  Aligned_cols=19  Identities=11%  Similarity=0.352  Sum_probs=14.3

Q ss_pred             CceecccchhhccChhhHH
Q psy9958           8 NPYLCDHCDQTFRQKQLLK   26 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~   26 (181)
                      +.|+|.+||..|.-...--
T Consensus         2 ~~~~C~~CG~vYd~e~Gdp   20 (55)
T COG1773           2 KRWRCSVCGYVYDPEKGDP   20 (55)
T ss_pred             CceEecCCceEeccccCCc
Confidence            4689999999988754433


No 164
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=44.97  E-value=7  Score=22.81  Aligned_cols=12  Identities=25%  Similarity=0.839  Sum_probs=6.5

Q ss_pred             cCCcccccCCCc
Q psy9958          48 KCPECKKAFRHK   59 (181)
Q Consensus        48 ~C~~C~k~F~~~   59 (181)
                      .||+|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999998753


No 165
>PRK11823 DNA repair protein RadA; Provisional
Probab=43.84  E-value=14  Score=31.61  Aligned_cols=25  Identities=28%  Similarity=0.836  Sum_probs=17.8

Q ss_pred             CCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccc
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKK   54 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k   54 (181)
                      ...|.|..||..+.                       .+-++|+.|+.
T Consensus         5 ~~~y~C~~Cg~~~~-----------------------~~~g~Cp~C~~   29 (446)
T PRK11823          5 KTAYVCQECGAESP-----------------------KWLGRCPECGA   29 (446)
T ss_pred             CCeEECCcCCCCCc-----------------------ccCeeCcCCCC
Confidence            45699999995433                       35667888875


No 166
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=43.65  E-value=15  Score=21.36  Aligned_cols=12  Identities=33%  Similarity=1.088  Sum_probs=5.8

Q ss_pred             ccCCcccccCCC
Q psy9958          47 HKCPECKKAFRH   58 (181)
Q Consensus        47 ~~C~~C~k~F~~   58 (181)
                      |+|+.||..|..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            455555444443


No 167
>KOG0717|consensus
Probab=43.11  E-value=13  Score=31.80  Aligned_cols=22  Identities=32%  Similarity=0.721  Sum_probs=18.9

Q ss_pred             eecccchhhccChhhHHHHHHH
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNL   31 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~   31 (181)
                      +-|.+|+|+|++...|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6699999999999899988765


No 168
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=42.96  E-value=15  Score=31.66  Aligned_cols=29  Identities=31%  Similarity=0.583  Sum_probs=23.7

Q ss_pred             CCCcccCCcccccCCCchhHHHHHHh-cCC
Q psy9958          43 KEKTHKCPECKKAFRHKGNLLRHMTL-HDP   71 (181)
Q Consensus        43 ~~~~~~C~~C~k~F~~~~~l~~H~~~-h~~   71 (181)
                      .-+-|.|+.|.+.|.....+..|+.. |.+
T Consensus        54 sWrFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   54 SWRFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             ceeEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            34567999999999999999999864 533


No 169
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=42.36  E-value=10  Score=20.23  Aligned_cols=31  Identities=16%  Similarity=0.475  Sum_probs=16.9

Q ss_pred             cccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCC
Q psy9958          12 CDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFR   57 (181)
Q Consensus        12 C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~   57 (181)
                      |+.|-+-+....+    +|.|           ..+..|..||-.|.
T Consensus         2 C~~C~~Ey~~p~~----RR~~-----------~~~isC~~CGPr~~   32 (35)
T PF07503_consen    2 CDDCLKEYFDPSN----RRFH-----------YQFISCTNCGPRYS   32 (35)
T ss_dssp             -HHHHHHHCSTTS----TTTT------------TT--BTTCC-SCC
T ss_pred             CHHHHHHHcCCCC----Cccc-----------CcCccCCCCCCCEE
Confidence            6777777766554    2222           35668999998765


No 170
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=42.01  E-value=17  Score=21.05  Aligned_cols=11  Identities=27%  Similarity=0.709  Sum_probs=7.7

Q ss_pred             ecccchhhccC
Q psy9958          11 LCDHCDQTFRQ   21 (181)
Q Consensus        11 ~C~~C~k~f~~   21 (181)
                      .|..|++.|..
T Consensus         4 ~C~~C~~~F~~   14 (57)
T cd00065           4 SCMGCGKPFTL   14 (57)
T ss_pred             cCcccCccccC
Confidence            47777777774


No 171
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=41.56  E-value=13  Score=21.92  Aligned_cols=11  Identities=27%  Similarity=0.881  Sum_probs=7.2

Q ss_pred             eecccchhhcc
Q psy9958          10 YLCDHCDQTFR   20 (181)
Q Consensus        10 ~~C~~C~k~f~   20 (181)
                      .+|..|++.|+
T Consensus         6 ~~C~~Cg~~~~   16 (54)
T PF14446_consen    6 CKCPVCGKKFK   16 (54)
T ss_pred             ccChhhCCccc
Confidence            35777777665


No 172
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=40.96  E-value=15  Score=25.93  Aligned_cols=15  Identities=27%  Similarity=0.904  Sum_probs=12.7

Q ss_pred             cccCCcccccCCCch
Q psy9958          46 THKCPECKKAFRHKG   60 (181)
Q Consensus        46 ~~~C~~C~k~F~~~~   60 (181)
                      |++|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            678999999998655


No 173
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=40.85  E-value=13  Score=25.87  Aligned_cols=11  Identities=18%  Similarity=0.289  Sum_probs=6.5

Q ss_pred             eecccchhhccC
Q psy9958          10 YLCDHCDQTFRQ   21 (181)
Q Consensus        10 ~~C~~C~k~f~~   21 (181)
                      +.| .|++.|..
T Consensus        71 ~~C-~Cg~~~~~   81 (124)
T PRK00762         71 IEC-ECGYEGVV   81 (124)
T ss_pred             EEe-eCcCcccc
Confidence            556 66665554


No 174
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=39.99  E-value=16  Score=20.78  Aligned_cols=14  Identities=14%  Similarity=0.330  Sum_probs=10.2

Q ss_pred             CcccCCcccccCCC
Q psy9958          45 KTHKCPECKKAFRH   58 (181)
Q Consensus        45 ~~~~C~~C~k~F~~   58 (181)
                      ..|.|+.||..+.-
T Consensus        19 ~~~vC~~Cg~~~~~   32 (52)
T smart00661       19 RRFVCRKCGYEEPI   32 (52)
T ss_pred             CEEECCcCCCeEEC
Confidence            37889999876544


No 175
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.63  E-value=10  Score=22.92  Aligned_cols=12  Identities=25%  Similarity=0.844  Sum_probs=8.8

Q ss_pred             ceecccchhhcc
Q psy9958           9 PYLCDHCDQTFR   20 (181)
Q Consensus         9 p~~C~~C~k~f~   20 (181)
                      --.|++|+..|+
T Consensus        48 ev~CPYC~t~y~   59 (62)
T COG4391          48 EVVCPYCSTRYR   59 (62)
T ss_pred             cEecCccccEEE
Confidence            346888888776


No 176
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=39.34  E-value=24  Score=19.37  Aligned_cols=23  Identities=17%  Similarity=0.277  Sum_probs=16.5

Q ss_pred             eecccchhhccCh--hhHHHHHHHh
Q psy9958          10 YLCDHCDQTFRQK--QLLKRHVNLY   32 (181)
Q Consensus        10 ~~C~~C~k~f~~~--~~L~~H~~~h   32 (181)
                      -+|+.||-.|...  ..-..|.+.|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            5799999887763  5567776665


No 177
>KOG1832|consensus
Probab=37.96  E-value=18  Score=33.92  Aligned_cols=10  Identities=30%  Similarity=0.494  Sum_probs=4.2

Q ss_pred             chhhccChhh
Q psy9958          15 CDQTFRQKQL   24 (181)
Q Consensus        15 C~k~f~~~~~   24 (181)
                      |.-+|+....
T Consensus      1305 c~VtFNstG~ 1314 (1516)
T KOG1832|consen 1305 CAVTFNSTGD 1314 (1516)
T ss_pred             eEEEeccCcc
Confidence            3334444433


No 178
>KOG0717|consensus
Probab=37.77  E-value=16  Score=31.37  Aligned_cols=22  Identities=27%  Similarity=0.536  Sum_probs=19.8

Q ss_pred             ccCCcccccCCCchhHHHHHHh
Q psy9958          47 HKCPECKKAFRHKGNLLRHMTL   68 (181)
Q Consensus        47 ~~C~~C~k~F~~~~~l~~H~~~   68 (181)
                      +-|.+|+|+|.+...|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6799999999999999999654


No 179
>KOG2636|consensus
Probab=37.56  E-value=19  Score=30.69  Aligned_cols=23  Identities=17%  Similarity=0.491  Sum_probs=17.8

Q ss_pred             CCcccCCccc-ccCCCchhHHHHH
Q psy9958          44 EKTHKCPECK-KAFRHKGNLLRHM   66 (181)
Q Consensus        44 ~~~~~C~~C~-k~F~~~~~l~~H~   66 (181)
                      ..-|.|.+|| +++..+..+.+|.
T Consensus       399 ~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  399 DIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             CcccceeeccCccccCcHHHHHHh
Confidence            4678888888 7888888888885


No 180
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=37.15  E-value=7.9  Score=25.93  Aligned_cols=13  Identities=15%  Similarity=0.317  Sum_probs=9.5

Q ss_pred             cccCCcccccCCC
Q psy9958          46 THKCPECKKAFRH   58 (181)
Q Consensus        46 ~~~C~~C~k~F~~   58 (181)
                      ...|+.||..|.+
T Consensus        42 h~~C~~CG~y~~~   54 (99)
T PRK14892         42 IITCGNCGLYTEF   54 (99)
T ss_pred             eEECCCCCCccCE
Confidence            3479999887665


No 181
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=36.36  E-value=12  Score=28.37  Aligned_cols=24  Identities=17%  Similarity=0.513  Sum_probs=0.0

Q ss_pred             CCcccCCccc-ccCCCchhHHHHHH
Q psy9958          44 EKTHKCPECK-KAFRHKGNLLRHMT   67 (181)
Q Consensus        44 ~~~~~C~~C~-k~F~~~~~l~~H~~   67 (181)
                      .+.|.|.+|| .+|..+..+.+|..
T Consensus        99 ~~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   99 GVEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             -------------------------
T ss_pred             CCeeeeEeCCCcceecHHHHHHhcC
Confidence            4789999999 57888899999964


No 183
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=35.94  E-value=24  Score=19.05  Aligned_cols=14  Identities=36%  Similarity=0.631  Sum_probs=4.8

Q ss_pred             CcccCCcccccCCC
Q psy9958          45 KTHKCPECKKAFRH   58 (181)
Q Consensus        45 ~~~~C~~C~k~F~~   58 (181)
                      ++|-|..|...|..
T Consensus         2 ~ryyCdyC~~~~~~   15 (38)
T PF06220_consen    2 PRYYCDYCKKYLTH   15 (38)
T ss_dssp             -S-B-TTT--B-S-
T ss_pred             cCeecccccceecC
Confidence            45677888777743


No 184
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=35.80  E-value=9.7  Score=22.68  Aligned_cols=11  Identities=27%  Similarity=0.489  Sum_probs=6.2

Q ss_pred             ecccchhhccC
Q psy9958          11 LCDHCDQTFRQ   21 (181)
Q Consensus        11 ~C~~C~k~f~~   21 (181)
                      +|-.|++.+.-
T Consensus         4 kC~lCdk~~~I   14 (56)
T PF09963_consen    4 KCILCDKKEEI   14 (56)
T ss_pred             EEEecCCEEEe
Confidence            46666665544


No 185
>KOG2186|consensus
Probab=35.71  E-value=7.4  Score=30.54  Aligned_cols=39  Identities=13%  Similarity=0.254  Sum_probs=31.0

Q ss_pred             cccCCcccccCCCchhHHHHHHhcCCCChhHHHHHHHhhhc
Q psy9958          46 THKCPECKKAFRHKGNLLRHMTLHDPDSELIEQQVALKLGR   86 (181)
Q Consensus        46 ~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~   86 (181)
                      -|.|..||-...- ..+.+|+...++ .-|.|-.|+..|.+
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~   41 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER   41 (276)
T ss_pred             EEehhhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc
Confidence            4789999987664 567889988777 67888888887766


No 186
>KOG2636|consensus
Probab=35.68  E-value=23  Score=30.19  Aligned_cols=26  Identities=23%  Similarity=0.611  Sum_probs=19.5

Q ss_pred             ccCCCCceecccch-hhccChhhHHHH
Q psy9958           3 IHIDQNPYLCDHCD-QTFRQKQLLKRH   28 (181)
Q Consensus         3 ~Ht~ekp~~C~~C~-k~f~~~~~L~~H   28 (181)
                      .|-=..-|.|.+|| +++.....+.+|
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRH  421 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHH
Confidence            45556679999999 777777777766


No 187
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=35.42  E-value=18  Score=20.19  Aligned_cols=17  Identities=24%  Similarity=0.698  Sum_probs=12.7

Q ss_pred             ccCCcccccCCCchhHH
Q psy9958          47 HKCPECKKAFRHKGNLL   63 (181)
Q Consensus        47 ~~C~~C~k~F~~~~~l~   63 (181)
                      -.|..|++.|.-.....
T Consensus         9 K~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen    9 KICPVCGRPFTWRKKWA   25 (42)
T ss_pred             CcCcccCCcchHHHHHH
Confidence            36999999998765443


No 188
>PLN02294 cytochrome c oxidase subunit Vb
Probab=35.25  E-value=16  Score=26.92  Aligned_cols=16  Identities=38%  Similarity=0.870  Sum_probs=12.8

Q ss_pred             CCCcccCCcccccCCC
Q psy9958          43 KEKTHKCPECKKAFRH   58 (181)
Q Consensus        43 ~~~~~~C~~C~k~F~~   58 (181)
                      ..+|+.|+.||..|.-
T Consensus       138 kGkp~RCpeCG~~fkL  153 (174)
T PLN02294        138 KGKSFECPVCTQYFEL  153 (174)
T ss_pred             CCCceeCCCCCCEEEE
Confidence            3578999999988863


No 189
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=35.17  E-value=18  Score=30.18  Aligned_cols=8  Identities=38%  Similarity=1.327  Sum_probs=4.6

Q ss_pred             eecccchh
Q psy9958          10 YLCDHCDQ   17 (181)
Q Consensus        10 ~~C~~C~k   17 (181)
                      |.|..||.
T Consensus         1 ~~c~~cg~    8 (372)
T cd01121           1 YVCSECGY    8 (372)
T ss_pred             CCCCCCCC
Confidence            55666663


No 190
>PRK05580 primosome assembly protein PriA; Validated
Probab=35.17  E-value=26  Score=31.71  Aligned_cols=12  Identities=33%  Similarity=0.874  Sum_probs=7.9

Q ss_pred             CCcccCCccccc
Q psy9958          44 EKTHKCPECKKA   55 (181)
Q Consensus        44 ~~~~~C~~C~k~   55 (181)
                      ..|+.|+.||..
T Consensus       419 ~~~~~Cp~Cg~~  430 (679)
T PRK05580        419 PIPKACPECGST  430 (679)
T ss_pred             CCCCCCCCCcCC
Confidence            456777777654


No 191
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=34.74  E-value=16  Score=21.37  Aligned_cols=17  Identities=12%  Similarity=0.485  Sum_probs=9.4

Q ss_pred             CCCceecccchhhccCh
Q psy9958           6 DQNPYLCDHCDQTFRQK   22 (181)
Q Consensus         6 ~ekp~~C~~C~k~f~~~   22 (181)
                      +...|+|.+|++.|...
T Consensus        32 ~~~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   32 EPIKLRCHYCERIITED   48 (52)
T ss_dssp             TTCEEEETTT--EEEHH
T ss_pred             CCCEEEeeCCCCEeccc
Confidence            44557777777766543


No 192
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=33.96  E-value=5.3  Score=22.71  Aligned_cols=37  Identities=22%  Similarity=0.457  Sum_probs=23.3

Q ss_pred             ecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCc--ccccCCC
Q psy9958          11 LCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPE--CKKAFRH   58 (181)
Q Consensus        11 ~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~--C~k~F~~   58 (181)
                      .|+.||...........+..           ..+.-|.|.-  ||.+|..
T Consensus         1 ~CP~Cg~~a~ir~S~~~s~~-----------~~~~Y~qC~N~~Cg~tfv~   39 (47)
T PF04606_consen    1 RCPHCGSKARIRTSRQLSPL-----------TRELYCQCTNPECGHTFVA   39 (47)
T ss_pred             CcCCCCCeeEEEEchhhCcc-----------eEEEEEEECCCcCCCEEEE
Confidence            48888876665544443322           3456778866  8888764


No 193
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=33.71  E-value=33  Score=25.21  Aligned_cols=21  Identities=29%  Similarity=0.676  Sum_probs=15.5

Q ss_pred             CCcccCCcccccCCCchhHHH
Q psy9958          44 EKTHKCPECKKAFRHKGNLLR   64 (181)
Q Consensus        44 ~~~~~C~~C~k~F~~~~~l~~   64 (181)
                      ..-|.|+.||+.|=--+.+..
T Consensus       128 ~~f~~C~~CgkiYW~GsHw~~  148 (165)
T COG1656         128 EEFYRCPKCGKIYWKGSHWRR  148 (165)
T ss_pred             cceeECCCCcccccCchHHHH
Confidence            356779999998877666544


No 194
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=32.90  E-value=18  Score=24.14  Aligned_cols=15  Identities=40%  Similarity=1.052  Sum_probs=12.4

Q ss_pred             CCcccCCcccccCCC
Q psy9958          44 EKTHKCPECKKAFRH   58 (181)
Q Consensus        44 ~~~~~C~~C~k~F~~   58 (181)
                      .+++.|..||..|.-
T Consensus        77 g~~~rC~eCG~~fkL   91 (97)
T cd00924          77 GKPKRCPECGHVFKL   91 (97)
T ss_pred             CCceeCCCCCcEEEE
Confidence            479999999988863


No 195
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=32.71  E-value=8.8  Score=21.59  Aligned_cols=10  Identities=30%  Similarity=0.916  Sum_probs=5.9

Q ss_pred             CcccCCcccc
Q psy9958          45 KTHKCPECKK   54 (181)
Q Consensus        45 ~~~~C~~C~k   54 (181)
                      ..|.|..|++
T Consensus        36 ~~~~C~~C~~   45 (46)
T PF12760_consen   36 GRYRCKACRK   45 (46)
T ss_pred             CeEECCCCCC
Confidence            5566666654


No 196
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=32.44  E-value=28  Score=23.42  Aligned_cols=16  Identities=25%  Similarity=0.804  Sum_probs=11.9

Q ss_pred             cccCCcccccCCCchh
Q psy9958          46 THKCPECKKAFRHKGN   61 (181)
Q Consensus        46 ~~~C~~C~k~F~~~~~   61 (181)
                      |+.|..||..|..-+.
T Consensus         2 pH~CtrCG~vf~~g~~   17 (112)
T COG3364           2 PHQCTRCGEVFDDGSE   17 (112)
T ss_pred             CceecccccccccccH
Confidence            6778888888887543


No 197
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=32.01  E-value=13  Score=25.11  Aligned_cols=13  Identities=23%  Similarity=0.715  Sum_probs=9.8

Q ss_pred             Cceecccchhhcc
Q psy9958           8 NPYLCDHCDQTFR   20 (181)
Q Consensus         8 kp~~C~~C~k~f~   20 (181)
                      ||-.|++||..-.
T Consensus         1 ~p~~CpYCg~~~~   13 (102)
T PF11672_consen    1 KPIICPYCGGPAE   13 (102)
T ss_pred             CCcccCCCCCeeE
Confidence            5778999997443


No 198
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=31.92  E-value=21  Score=32.34  Aligned_cols=10  Identities=30%  Similarity=0.969  Sum_probs=7.7

Q ss_pred             CcccCCcccc
Q psy9958          45 KTHKCPECKK   54 (181)
Q Consensus        45 ~~~~C~~C~k   54 (181)
                      .|..|+.||-
T Consensus       172 Qp~aCp~CGP  181 (750)
T COG0068         172 QPIACPKCGP  181 (750)
T ss_pred             ccccCcccCC
Confidence            5778888885


No 199
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=31.63  E-value=8.4  Score=20.70  Aligned_cols=11  Identities=18%  Similarity=0.806  Sum_probs=7.6

Q ss_pred             CCCCcccCCcc
Q psy9958          42 PKEKTHKCPEC   52 (181)
Q Consensus        42 ~~~~~~~C~~C   52 (181)
                      .|...|.|..|
T Consensus        25 ~G~qryrC~~C   35 (36)
T PF03811_consen   25 SGHQRYRCKDC   35 (36)
T ss_pred             CCCEeEecCcC
Confidence            45667777776


No 200
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=31.55  E-value=17  Score=29.44  Aligned_cols=14  Identities=21%  Similarity=0.603  Sum_probs=9.4

Q ss_pred             CcccCCcccccCCC
Q psy9958          45 KTHKCPECKKAFRH   58 (181)
Q Consensus        45 ~~~~C~~C~k~F~~   58 (181)
                      ..+.|+.|+.-|+-
T Consensus        56 ~~~vcp~c~~h~rl   69 (296)
T CHL00174         56 KMNICEQCGYHLKM   69 (296)
T ss_pred             cCCCCCCCCCCcCC
Confidence            34678888876653


No 201
>PTZ00448 hypothetical protein; Provisional
Probab=31.51  E-value=31  Score=28.74  Aligned_cols=23  Identities=13%  Similarity=0.342  Sum_probs=20.4

Q ss_pred             cccCCcccccCCCchhHHHHHHh
Q psy9958          46 THKCPECKKAFRHKGNLLRHMTL   68 (181)
Q Consensus        46 ~~~C~~C~k~F~~~~~l~~H~~~   68 (181)
                      .|.|..|+-.|......+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            68899999999988888899875


No 202
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=31.11  E-value=19  Score=20.80  Aligned_cols=14  Identities=21%  Similarity=0.612  Sum_probs=7.1

Q ss_pred             CceecccchhhccC
Q psy9958           8 NPYLCDHCDQTFRQ   21 (181)
Q Consensus         8 kp~~C~~C~k~f~~   21 (181)
                      +.+.|..||..|.-
T Consensus         3 k~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    3 KTLTCKDCGAEFVF   16 (49)
T ss_pred             eeEEcccCCCeEEE
Confidence            34555555555543


No 203
>PLN02748 tRNA dimethylallyltransferase
Probab=30.99  E-value=30  Score=29.84  Aligned_cols=26  Identities=15%  Similarity=0.225  Sum_probs=22.1

Q ss_pred             CCcccCCcccc-cCCCchhHHHHHHhc
Q psy9958          44 EKTHKCPECKK-AFRHKGNLLRHMTLH   69 (181)
Q Consensus        44 ~~~~~C~~C~k-~F~~~~~l~~H~~~h   69 (181)
                      .+.|.|..|++ .|.....+..|++..
T Consensus       416 ~~~~~Ce~C~~~~~~G~~eW~~Hlksr  442 (468)
T PLN02748        416 WTQYVCEACGNKVLRGAHEWEQHKQGR  442 (468)
T ss_pred             cccccccCCCCcccCCHHHHHHHhcch
Confidence            36788999997 899999999998653


No 204
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=30.71  E-value=15  Score=33.74  Aligned_cols=13  Identities=23%  Similarity=0.567  Sum_probs=9.8

Q ss_pred             eecccchhhccCh
Q psy9958          10 YLCDHCDQTFRQK   22 (181)
Q Consensus        10 ~~C~~C~k~f~~~   22 (181)
                      -.|..|++.|...
T Consensus       461 dtC~~C~kkFfSl  473 (1374)
T PTZ00303        461 DSCPSCGRAFISL  473 (1374)
T ss_pred             CcccCcCCccccc
Confidence            4588999988653


No 205
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=30.62  E-value=17  Score=28.03  Aligned_cols=34  Identities=26%  Similarity=0.326  Sum_probs=0.0

Q ss_pred             CCcccCCcccccCCCchhHHHHHHhcCCCChhHHH
Q psy9958          44 EKTHKCPECKKAFRHKGNLLRHMTLHDPDSELIEQ   78 (181)
Q Consensus        44 ~~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~   78 (181)
                      .+...|++||.... .+.|..|||+..-+..|...
T Consensus       166 ~~~~~cPitGe~IP-~~e~~eHmRi~LlDP~wkEq  199 (229)
T PF12230_consen  166 EKMIICPITGEMIP-ADEMDEHMRIELLDPRWKEQ  199 (229)
T ss_dssp             -----------------------------------
T ss_pred             cccccccccccccc-cccccccccccccccccccc
Confidence            45579999999766 47889999999888777543


No 206
>PRK06260 threonine synthase; Validated
Probab=30.49  E-value=28  Score=29.12  Aligned_cols=11  Identities=18%  Similarity=0.721  Sum_probs=7.1

Q ss_pred             eecccchhhcc
Q psy9958          10 YLCDHCDQTFR   20 (181)
Q Consensus        10 ~~C~~C~k~f~   20 (181)
                      ++|..||+.|.
T Consensus         4 ~~C~~cg~~~~   14 (397)
T PRK06260          4 LKCIECGKEYD   14 (397)
T ss_pred             EEECCCCCCCC
Confidence            56777776554


No 207
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=30.34  E-value=23  Score=23.95  Aligned_cols=30  Identities=30%  Similarity=0.525  Sum_probs=24.1

Q ss_pred             CCCCCCCcccCCcccccCCCchhHHHHHHh
Q psy9958          39 PPSPKEKTHKCPECKKAFRHKGNLLRHMTL   68 (181)
Q Consensus        39 ~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~   68 (181)
                      +.-+|-.-|-|..|.+-|.+...|..|.+.
T Consensus        48 p~lPGlGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          48 PELPGLGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CCCCCCceeeeehhHHHHHHHHHHHHHhcc
Confidence            334556667899999999999999999764


No 208
>PHA02998 RNA polymerase subunit; Provisional
Probab=30.13  E-value=8.2  Score=28.68  Aligned_cols=42  Identities=21%  Similarity=0.447  Sum_probs=22.6

Q ss_pred             ceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCc
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHK   59 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~   59 (181)
                      .-+|+.|+..=....  ...+|..=.       +.-.-|.|..||+.|.-+
T Consensus       143 ~v~CPkCg~~~A~f~--qlQTRSADE-------PmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        143 NTPCPNCKSKNTTPM--MIQTRAADE-------PPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCCceEEE--EEeeccCCC-------CceEEEEcCCCCCccCCc
Confidence            456888874333222  222333211       223457899999887654


No 209
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=29.78  E-value=22  Score=19.14  Aligned_cols=12  Identities=33%  Similarity=0.966  Sum_probs=6.7

Q ss_pred             Cceecccchhhc
Q psy9958           8 NPYLCDHCDQTF   19 (181)
Q Consensus         8 kp~~C~~C~k~f   19 (181)
                      +.|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            468899998655


No 210
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=29.22  E-value=30  Score=20.53  Aligned_cols=17  Identities=29%  Similarity=0.729  Sum_probs=12.4

Q ss_pred             CCCcccCCcccccCCCc
Q psy9958          43 KEKTHKCPECKKAFRHK   59 (181)
Q Consensus        43 ~~~~~~C~~C~k~F~~~   59 (181)
                      +++---|+.|++.|...
T Consensus        36 ~~rYngCPfC~~~~~~~   52 (55)
T PF14447_consen   36 GERYNGCPFCGTPFEFD   52 (55)
T ss_pred             hhhccCCCCCCCcccCC
Confidence            34445799999998764


No 211
>KOG2907|consensus
Probab=29.15  E-value=20  Score=24.58  Aligned_cols=14  Identities=36%  Similarity=0.802  Sum_probs=10.5

Q ss_pred             CcccCCcccccCCC
Q psy9958          45 KTHKCPECKKAFRH   58 (181)
Q Consensus        45 ~~~~C~~C~k~F~~   58 (181)
                      .-|.|+.|++.|..
T Consensus       101 VFYTC~kC~~k~~e  114 (116)
T KOG2907|consen  101 VFYTCPKCKYKFTE  114 (116)
T ss_pred             EEEEcCccceeeec
Confidence            35788888888764


No 212
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=28.93  E-value=31  Score=20.49  Aligned_cols=17  Identities=24%  Similarity=0.681  Sum_probs=9.2

Q ss_pred             CCceecccchhhccChh
Q psy9958           7 QNPYLCDHCDQTFRQKQ   23 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~   23 (181)
                      +.|.+...|+-.|.+..
T Consensus        22 ~~PV~s~~C~H~fek~a   38 (57)
T PF11789_consen   22 EDPVKSKKCGHTFEKEA   38 (57)
T ss_dssp             SSEEEESSS--EEEHHH
T ss_pred             hCCcCcCCCCCeecHHH
Confidence            35666666777777544


No 213
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=28.74  E-value=32  Score=25.30  Aligned_cols=13  Identities=31%  Similarity=0.692  Sum_probs=9.2

Q ss_pred             CCCCCcccCCccc
Q psy9958          41 SPKEKTHKCPECK   53 (181)
Q Consensus        41 ~~~~~~~~C~~C~   53 (181)
                      +.++.|.+||+||
T Consensus       144 ~~ge~P~~CPiCg  156 (166)
T COG1592         144 HEGEAPEVCPICG  156 (166)
T ss_pred             ccCCCCCcCCCCC
Confidence            3557777888887


No 214
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=28.44  E-value=49  Score=22.68  Aligned_cols=49  Identities=20%  Similarity=0.409  Sum_probs=35.8

Q ss_pred             ecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchhHHHHHHhcC
Q psy9958          11 LCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGNLLRHMTLHD   70 (181)
Q Consensus        11 ~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~h~   70 (181)
                      .|--|.+.|........-.  .         ....+|.|+.|...|--.-+.-.|..+|.
T Consensus        57 ~C~~C~~~f~~~~~~~~~~--~---------~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPFDE--L---------KDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             cccCcCCCCCCcccccccc--c---------ccccceeCCCCCCccccccchhhhhhccC
Confidence            4888999998654221110  0         23568999999999999999999988875


No 215
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=28.41  E-value=32  Score=18.46  Aligned_cols=15  Identities=33%  Similarity=0.837  Sum_probs=9.3

Q ss_pred             cCCcccccCCCchhH
Q psy9958          48 KCPECKKAFRHKGNL   62 (181)
Q Consensus        48 ~C~~C~k~F~~~~~l   62 (181)
                      .|+.|+|.|-..+..
T Consensus         4 ~CprC~kg~Hwa~~C   18 (36)
T PF14787_consen    4 LCPRCGKGFHWASEC   18 (36)
T ss_dssp             C-TTTSSSCS-TTT-
T ss_pred             cCcccCCCcchhhhh
Confidence            588888888776664


No 216
>PRK05978 hypothetical protein; Provisional
Probab=28.36  E-value=16  Score=26.43  Aligned_cols=12  Identities=33%  Similarity=1.030  Sum_probs=8.5

Q ss_pred             cCCcccccCCCc
Q psy9958          48 KCPECKKAFRHK   59 (181)
Q Consensus        48 ~C~~C~k~F~~~   59 (181)
                      .|+.||..|...
T Consensus        54 ~C~~CG~~~~~~   65 (148)
T PRK05978         54 HCAACGEDFTHH   65 (148)
T ss_pred             CccccCCccccC
Confidence            588898766544


No 217
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=28.30  E-value=34  Score=27.48  Aligned_cols=13  Identities=31%  Similarity=0.884  Sum_probs=9.2

Q ss_pred             cccCCcccccCCC
Q psy9958          46 THKCPECKKAFRH   58 (181)
Q Consensus        46 ~~~C~~C~k~F~~   58 (181)
                      .+.|+.|+.-|.-
T Consensus        45 ~~vc~~c~~h~rl   57 (285)
T TIGR00515        45 LEVCPKCDHHMRM   57 (285)
T ss_pred             CCCCCCCCCcCcC
Confidence            3578888886663


No 218
>PTZ00448 hypothetical protein; Provisional
Probab=28.15  E-value=34  Score=28.46  Aligned_cols=24  Identities=21%  Similarity=0.468  Sum_probs=21.1

Q ss_pred             ceecccchhhccChhhHHHHHHHh
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLY   32 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~h   32 (181)
                      .|.|..|+-.|......+.|+++.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            588999999999888889998864


No 219
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.12  E-value=17  Score=25.44  Aligned_cols=16  Identities=25%  Similarity=0.547  Sum_probs=12.1

Q ss_pred             CCcccCCcccccCCCc
Q psy9958          44 EKTHKCPECKKAFRHK   59 (181)
Q Consensus        44 ~~~~~C~~C~k~F~~~   59 (181)
                      +.|--|.-||++|...
T Consensus        66 e~psfchncgs~fpwt   81 (160)
T COG4306          66 EPPSFCHNCGSRFPWT   81 (160)
T ss_pred             CCcchhhcCCCCCCcH
Confidence            4566788899988754


No 220
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=28.11  E-value=42  Score=26.98  Aligned_cols=26  Identities=31%  Similarity=0.643  Sum_probs=22.8

Q ss_pred             CCceecccchhhccChhhHHHHHHHh
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLY   32 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~h   32 (181)
                      ..-|.|..|-+-|..+..|.+|+...
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~C   71 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAKC   71 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHhC
Confidence            45699999999999999999998743


No 221
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=27.97  E-value=11  Score=21.97  Aligned_cols=25  Identities=36%  Similarity=0.755  Sum_probs=10.2

Q ss_pred             CcccCCcccccCCCchhHHHHHHhc
Q psy9958          45 KTHKCPECKKAFRHKGNLLRHMTLH   69 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l~~H~~~h   69 (181)
                      ..|.|+.|...|----+.-.|..+|
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CeEECCCCCCccccCcChhhhcccc
Confidence            4566666666665554444444443


No 222
>KOG0782|consensus
Probab=27.66  E-value=23  Score=31.39  Aligned_cols=13  Identities=46%  Similarity=0.910  Sum_probs=7.2

Q ss_pred             cCCcccccCCCch
Q psy9958          48 KCPECKKAFRHKG   60 (181)
Q Consensus        48 ~C~~C~k~F~~~~   60 (181)
                      +|..|||.|.++-
T Consensus       255 kC~~CgKgFQQKf  267 (1004)
T KOG0782|consen  255 KCNTCGKGFQQKF  267 (1004)
T ss_pred             ccchhhhhhhhhe
Confidence            4666666555443


No 223
>COG3464 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=27.55  E-value=16  Score=30.79  Aligned_cols=53  Identities=21%  Similarity=0.358  Sum_probs=29.6

Q ss_pred             eecccchhhccChhhHHHHHHHhcCCCCC---CCCCCCCcccCCcccccCCCchhHH
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNLYHNPHYV---PPSPKEKTHKCPECKKAFRHKGNLL   63 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~hh~~~~~---~~~~~~~~~~C~~C~k~F~~~~~l~   63 (181)
                      +.|+.||......... .++++++-+...   ..+...+.|.|..|++.|.....+.
T Consensus        39 ~~CP~Cg~~~~~~~~~-~~~~I~~L~~~~~~~~L~~r~rR~~c~~c~~~~~~~~~~v   94 (402)
T COG3464          39 HRCPECGQRTIRRHGW-RIRKIQDLPLFEVPVYLFLRKRRYKCCRCGKRFAEKVDFV   94 (402)
T ss_pred             CCCCCCCCcceecccc-ceeeeeecccCCeeEEEEeccceeecccCCCCcccchhhh
Confidence            7899999877333322 222333211000   1113357789999999996554443


No 224
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=26.70  E-value=57  Score=26.64  Aligned_cols=20  Identities=25%  Similarity=0.469  Sum_probs=13.0

Q ss_pred             ceecccchhhccChhhHHHH
Q psy9958           9 PYLCDHCDQTFRQKQLLKRH   28 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H   28 (181)
                      |..|+.|.-......+|.+-
T Consensus       322 Pi~CP~Csl~LilsthLarS  341 (421)
T COG5151         322 PISCPICSLQLILSTHLARS  341 (421)
T ss_pred             CccCcchhHHHHHHHHHHHH
Confidence            56677787766666666543


No 225
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=26.39  E-value=5.2  Score=31.54  Aligned_cols=17  Identities=18%  Similarity=0.567  Sum_probs=12.7

Q ss_pred             CCCceecccchhhccCh
Q psy9958           6 DQNPYLCDHCDQTFRQK   22 (181)
Q Consensus         6 ~ekp~~C~~C~k~f~~~   22 (181)
                      ..-+|.|++.++.|...
T Consensus       110 ~~~~~~CPvt~~~~~~~  126 (260)
T PF04641_consen  110 SEGRFICPVTGKEFNGK  126 (260)
T ss_pred             CCceeECCCCCcccCCc
Confidence            35679999988888543


No 226
>KOG4602|consensus
Probab=26.34  E-value=20  Score=28.31  Aligned_cols=48  Identities=19%  Similarity=0.234  Sum_probs=24.6

Q ss_pred             CceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCC
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFR   57 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~   57 (181)
                      ++..|-+|...-.....+..|....  ..-+-..+.-+.|.|++||.+=.
T Consensus       232 r~l~CvFC~nN~E~~A~y~tH~lkd--~dgRVLCPkLR~YVCPiCGATgD  279 (318)
T KOG4602|consen  232 RPLCCVFCFNNAEEFARYHTHPLKD--KDGRVLCPKLRSYVCPICGATGD  279 (318)
T ss_pred             CceeEEeecCCCchhhheecccccC--CCCcEechhHhhhcCccccccCC
Confidence            4566777754433334444443221  00111123347799999998644


No 227
>PRK00420 hypothetical protein; Validated
Probab=25.73  E-value=39  Score=23.18  Aligned_cols=16  Identities=25%  Similarity=0.366  Sum_probs=10.5

Q ss_pred             CcccCCcccccCCCch
Q psy9958          45 KTHKCPECKKAFRHKG   60 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~   60 (181)
                      ....|+.||....-..
T Consensus        39 g~~~Cp~Cg~~~~v~~   54 (112)
T PRK00420         39 GEVVCPVHGKVYIVKS   54 (112)
T ss_pred             CceECCCCCCeeeecc
Confidence            3557888988655443


No 228
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=25.72  E-value=23  Score=20.51  Aligned_cols=14  Identities=21%  Similarity=0.641  Sum_probs=11.4

Q ss_pred             ceecccchhhccCh
Q psy9958           9 PYLCDHCDQTFRQK   22 (181)
Q Consensus         9 p~~C~~C~k~f~~~   22 (181)
                      .|+|..||+.|.-.
T Consensus         1 ~y~C~~CgyiYd~~   14 (50)
T cd00730           1 KYECRICGYIYDPA   14 (50)
T ss_pred             CcCCCCCCeEECCC
Confidence            37899999988864


No 229
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=25.38  E-value=27  Score=27.82  Aligned_cols=18  Identities=28%  Similarity=0.578  Sum_probs=12.6

Q ss_pred             CcccCCcccccCCCchhH
Q psy9958          45 KTHKCPECKKAFRHKGNL   62 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l   62 (181)
                      +.|.|+.||..+.+--+-
T Consensus       321 r~~~C~~cg~~~~rD~na  338 (364)
T COG0675         321 RLFKCPRCGFVHDRDVNA  338 (364)
T ss_pred             eeEECCCCCCeehhhHHH
Confidence            678898898876654443


No 230
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=25.15  E-value=23  Score=20.19  Aligned_cols=16  Identities=19%  Similarity=0.567  Sum_probs=12.1

Q ss_pred             ceecccchhhccChhh
Q psy9958           9 PYLCDHCDQTFRQKQL   24 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~   24 (181)
                      .|+|.+|+..|.....
T Consensus         1 ky~C~~CgyvYd~~~G   16 (47)
T PF00301_consen    1 KYQCPVCGYVYDPEKG   16 (47)
T ss_dssp             EEEETTTSBEEETTTB
T ss_pred             CcCCCCCCEEEcCCcC
Confidence            4789999988876543


No 231
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=25.12  E-value=40  Score=22.15  Aligned_cols=14  Identities=36%  Similarity=0.738  Sum_probs=8.3

Q ss_pred             CcccCCcccccCCC
Q psy9958          45 KTHKCPECKKAFRH   58 (181)
Q Consensus        45 ~~~~C~~C~k~F~~   58 (181)
                      --|.|..|++.|..
T Consensus        52 GIW~C~~C~~~~AG   65 (90)
T PF01780_consen   52 GIWKCKKCGKKFAG   65 (90)
T ss_dssp             TEEEETTTTEEEE-
T ss_pred             EEeecCCCCCEEeC
Confidence            34677777766654


No 232
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=25.03  E-value=30  Score=26.80  Aligned_cols=15  Identities=40%  Similarity=0.738  Sum_probs=12.2

Q ss_pred             CCceecccchhhccC
Q psy9958           7 QNPYLCDHCDQTFRQ   21 (181)
Q Consensus         7 ekp~~C~~C~k~f~~   21 (181)
                      .++.+|..||..|+-
T Consensus       179 GkpqRCpECGqVFKL  193 (268)
T PTZ00043        179 GFLYRCGECDQIFML  193 (268)
T ss_pred             CCCccCCCCCcEEEE
Confidence            458889999988884


No 233
>PTZ00064 histone acetyltransferase; Provisional
Probab=24.90  E-value=65  Score=28.13  Aligned_cols=26  Identities=23%  Similarity=0.401  Sum_probs=20.6

Q ss_pred             CCceecccchhhccChhhHHHHHHHh
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLY   32 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~h   32 (181)
                      ...|.|.+|-+-|.....|.+|+...
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~C  303 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSRC  303 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhcC
Confidence            34688888888888888888887643


No 234
>KOG4727|consensus
Probab=24.58  E-value=35  Score=25.22  Aligned_cols=22  Identities=32%  Similarity=0.649  Sum_probs=19.7

Q ss_pred             eecccchhhccChhhHHHHHHH
Q psy9958          10 YLCDHCDQTFRQKQLLKRHVNL   31 (181)
Q Consensus        10 ~~C~~C~k~f~~~~~L~~H~~~   31 (181)
                      |-|.+|+-.|+...++..|+..
T Consensus        76 yyCdVCdcvvKDSinflDHiNg   97 (193)
T KOG4727|consen   76 YYCDVCDCVVKDSINFLDHING   97 (193)
T ss_pred             eeeeecceeehhhHHHHHHhcc
Confidence            8899999999999999999763


No 235
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.53  E-value=28  Score=21.11  Aligned_cols=14  Identities=36%  Similarity=0.804  Sum_probs=8.0

Q ss_pred             CCcccCCcccccCC
Q psy9958          44 EKTHKCPECKKAFR   57 (181)
Q Consensus        44 ~~~~~C~~C~k~F~   57 (181)
                      -+.|.|+.|.-+..
T Consensus        29 IrtymC~eC~~Rva   42 (68)
T COG4896          29 IRTYMCPECEHRVA   42 (68)
T ss_pred             ceeEechhhHhhhc
Confidence            35566776654444


No 236
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=24.18  E-value=33  Score=20.24  Aligned_cols=30  Identities=13%  Similarity=0.313  Sum_probs=17.8

Q ss_pred             cccCCcccccCCCchhHHHHHHhcCCCChhHHHHHHHh
Q psy9958          46 THKCPECKKAFRHKGNLLRHMTLHDPDSELIEQQVALK   83 (181)
Q Consensus        46 ~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~~~~~~~~~   83 (181)
                      .|.|+.||..+.-....       .+ ....|..|+..
T Consensus         2 ~~~CP~CG~~iev~~~~-------~G-eiV~Cp~CGae   31 (54)
T TIGR01206         2 QFECPDCGAEIELENPE-------LG-ELVICDECGAE   31 (54)
T ss_pred             ccCCCCCCCEEecCCCc-------cC-CEEeCCCCCCE
Confidence            36899999977654332       12 23356666654


No 237
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=24.16  E-value=51  Score=28.32  Aligned_cols=40  Identities=23%  Similarity=0.561  Sum_probs=28.6

Q ss_pred             CCceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCC
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCP   50 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~   50 (181)
                      ...|.|..|-+-|.....|.+|+.....    +.++|..-|.+.
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~C~~----~~PPG~eIYr~~  235 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKKCDL----KHPPGDEIYRHP  235 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhcCCC----CCCCcCeEEEcC
Confidence            4569999999999999999999874321    112455556543


No 238
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=24.15  E-value=57  Score=26.33  Aligned_cols=12  Identities=33%  Similarity=0.971  Sum_probs=8.4

Q ss_pred             cccCCcccccCC
Q psy9958          46 THKCPECKKAFR   57 (181)
Q Consensus        46 ~~~C~~C~k~F~   57 (181)
                      .+.|+.|+.-|.
T Consensus        46 ~~vc~~c~~h~r   57 (292)
T PRK05654         46 LNVCPKCGHHMR   57 (292)
T ss_pred             CCCCCCCCCCee
Confidence            357888887665


No 239
>PLN03239 histone acetyltransferase; Provisional
Probab=24.00  E-value=54  Score=27.16  Aligned_cols=25  Identities=24%  Similarity=0.316  Sum_probs=21.8

Q ss_pred             CCceecccchhhccChhhHHHHHHH
Q psy9958           7 QNPYLCDHCDQTFRQKQLLKRHVNL   31 (181)
Q Consensus         7 ekp~~C~~C~k~f~~~~~L~~H~~~   31 (181)
                      ..-|.|..|-+-|.+...|.+|+..
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHHh
Confidence            4579999999999999999999753


No 240
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=23.97  E-value=15  Score=25.25  Aligned_cols=14  Identities=29%  Similarity=0.712  Sum_probs=11.0

Q ss_pred             CcccCCcccccCCC
Q psy9958          45 KTHKCPECKKAFRH   58 (181)
Q Consensus        45 ~~~~C~~C~k~F~~   58 (181)
                      .-|.|..||..|+.
T Consensus        99 ~Fy~C~~Cg~~wre  112 (113)
T COG1594          99 RFYKCTRCGYRWRE  112 (113)
T ss_pred             EEEEecccCCEeec
Confidence            45899999988763


No 241
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.38  E-value=26  Score=20.17  Aligned_cols=17  Identities=24%  Similarity=0.749  Sum_probs=12.6

Q ss_pred             ccCCcccccCCCchhHH
Q psy9958          47 HKCPECKKAFRHKGNLL   63 (181)
Q Consensus        47 ~~C~~C~k~F~~~~~l~   63 (181)
                      -.|+.|++.|.-...+.
T Consensus        13 KICpvCqRPFsWRkKW~   29 (54)
T COG4338          13 KICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhhcCchHHHHHHH
Confidence            36999999998654443


No 242
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=23.19  E-value=47  Score=27.59  Aligned_cols=23  Identities=17%  Similarity=0.488  Sum_probs=16.0

Q ss_pred             CCcccCCccc-ccCCCchhHHHHH
Q psy9958          44 EKTHKCPECK-KAFRHKGNLLRHM   66 (181)
Q Consensus        44 ~~~~~C~~C~-k~F~~~~~l~~H~   66 (181)
                      .+-|.|.+|| +.+..+..+.+|.
T Consensus       372 d~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         372 DIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             CcceeeeecccccccchHHHHhhh
Confidence            4667777777 6666667777664


No 243
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=22.36  E-value=10  Score=31.30  Aligned_cols=44  Identities=18%  Similarity=0.338  Sum_probs=19.5

Q ss_pred             CceecccchhhccChhhHH---HHHHHhcCCCCCCCCCCCCcccCCcccccCCC
Q psy9958           8 NPYLCDHCDQTFRQKQLLK---RHVNLYHNPHYVPPSPKEKTHKCPECKKAFRH   58 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~---~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~   58 (181)
                      +-+.|..|.+.+-.....-   .|....+.       .-.+-|+|..|++++..
T Consensus       251 kav~C~~C~yt~~~~~~~C~~~~H~l~~~~-------a~KRFFkC~~C~~Rt~s  297 (344)
T PF09332_consen  251 KAVTCKQCKYTAFKPSDRCKEEGHPLKWHD-------AVKRFFKCKDCGNRTIS  297 (344)
T ss_dssp             EEEEETTT--EESS--HHHHHTT--EEEEE-------EE-EEEE-T-TS-EEEE
T ss_pred             EEEEcCCCCCcccCcchhHHhcCCceEEee-------eeeeeEECCCCCCeeee
Confidence            3478999988666654443   22221111       22356799999987554


No 244
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=21.99  E-value=71  Score=25.74  Aligned_cols=25  Identities=40%  Similarity=0.615  Sum_probs=22.6

Q ss_pred             CCcccCCcccccCCCchhHHHHHHh
Q psy9958          44 EKTHKCPECKKAFRHKGNLLRHMTL   68 (181)
Q Consensus        44 ~~~~~C~~C~k~F~~~~~l~~H~~~   68 (181)
                      ...|.|..|-+-|.+...|.+|+..
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHh
Confidence            5689999999999999999999863


No 245
>KOG0943|consensus
Probab=21.98  E-value=62  Score=31.79  Aligned_cols=37  Identities=14%  Similarity=0.418  Sum_probs=0.0

Q ss_pred             cCcccccCCCCCCccCcccccccccCCCCCCCCceEE
Q psy9958          94 DGHKVEVIPDDEEEEEGEETEEEEEGGGEDDGHQYVV  130 (181)
Q Consensus        94 ~~~~~~~~~~~~~~e~~e~~~~e~~~~~~~~~~~~~~  130 (181)
                      .+.......+.+++++++++.+++++++++|+.++..
T Consensus      1731 ~GEed~~Dddnddddddd~EaEdddDddDdDdeD~d~ 1767 (3015)
T KOG0943|consen 1731 AGEEDHHDDDNDDDDDDDAEAEDDDDDDDDDDEDMDL 1767 (3015)
T ss_pred             cCcccccccccccccccchhhcccccccccccccccc


No 246
>KOG2593|consensus
Probab=21.97  E-value=56  Score=27.80  Aligned_cols=21  Identities=24%  Similarity=0.528  Sum_probs=16.7

Q ss_pred             CCCcccCCcccccCCCchhHH
Q psy9958          43 KEKTHKCPECKKAFRHKGNLL   63 (181)
Q Consensus        43 ~~~~~~C~~C~k~F~~~~~l~   63 (181)
                      ...-|.|+.|.+.|..-..++
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~  145 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQ  145 (436)
T ss_pred             ccccccCCccccchhhhHHHH
Confidence            356799999999998766654


No 247
>KOG1280|consensus
Probab=21.90  E-value=45  Score=27.53  Aligned_cols=38  Identities=18%  Similarity=0.298  Sum_probs=27.9

Q ss_pred             CCcccCCcccccCCCchhHHHHHHhcCCCChh--HHHHHH
Q psy9958          44 EKTHKCPECKKAFRHKGNLLRHMTLHDPDSEL--IEQQVA   81 (181)
Q Consensus        44 ~~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~--~~~~~~   81 (181)
                      ..-|.|+.|++.=.+...|..|...-|.+..+  .|..|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            45799999999888889999998766655543  344443


No 248
>KOG4118|consensus
Probab=21.51  E-value=52  Score=20.24  Aligned_cols=31  Identities=23%  Similarity=0.467  Sum_probs=23.1

Q ss_pred             CcccCCcccccCCCchhHHHHHHhcCCCChh
Q psy9958          45 KTHKCPECKKAFRHKGNLLRHMTLHDPDSEL   75 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l~~H~~~h~~~~~~   75 (181)
                      ..|+|.+|--...-...+..|....++..++
T Consensus        37 L~~kCtVC~~~mpdpktfkqhfe~kHpk~~~   67 (74)
T KOG4118|consen   37 LHHKCTVCMVQMPDPKTFKQHFENKHPKEPL   67 (74)
T ss_pred             HHhhhHhhHhhCCCCchHHHHHhhcCCCCCC
Confidence            3578999988777788888887776665554


No 249
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=21.45  E-value=41  Score=24.23  Aligned_cols=19  Identities=21%  Similarity=0.501  Sum_probs=14.7

Q ss_pred             CcccCCcccccCCCchhHH
Q psy9958          45 KTHKCPECKKAFRHKGNLL   63 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l~   63 (181)
                      +.-.|..|+++|++--...
T Consensus        27 RRReC~~C~~RFTTyErve   45 (147)
T TIGR00244        27 RRRECLECHERFTTFERAE   45 (147)
T ss_pred             ecccCCccCCccceeeecc
Confidence            4568999999999865543


No 250
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=21.32  E-value=45  Score=17.52  Aligned_cols=23  Identities=17%  Similarity=0.522  Sum_probs=13.7

Q ss_pred             CcccCCcccccCCCchhHHHHHHh
Q psy9958          45 KTHKCPECKKAFRHKGNLLRHMTL   68 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l~~H~~~   68 (181)
                      ..|.|+.|++.+.. +-+..|+..
T Consensus         3 ~~~~C~nC~R~v~a-~RfA~HLek   25 (33)
T PF08209_consen    3 PYVECPNCGRPVAA-SRFAPHLEK   25 (33)
T ss_dssp             -EEE-TTTSSEEEG-GGHHHHHHH
T ss_pred             CeEECCCCcCCcch-hhhHHHHHH
Confidence            35678888886553 556677543


No 251
>KOG2807|consensus
Probab=21.15  E-value=1.1e+02  Score=25.13  Aligned_cols=60  Identities=25%  Similarity=0.408  Sum_probs=37.5

Q ss_pred             CceecccchhhccChhhHHHHHHHhcCCC---CC-------------CCC----CCCCcccCCcccccCCCchhHHHHHH
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNLYHNPH---YV-------------PPS----PKEKTHKCPECKKAFRHKGNLLRHMT   67 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~hh~~~---~~-------------~~~----~~~~~~~C~~C~k~F~~~~~l~~H~~   67 (181)
                      -|-.|+.|+-......+|.+-.  ||...   |.             ...    .....|.|..|-..|----+.-.|-.
T Consensus       289 LP~eCpiC~ltLVss~hLARSy--hhL~PL~~F~Eip~~~~~~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCldCDv~iHes  366 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSY--HHLFPLKPFVEIPETEYNGSRFCFACQGELLSSGRYRCESCKNVFCLDCDVFIHES  366 (378)
T ss_pred             CCccCCccceeEecchHHHHHH--HhhcCCcchhhccccccCCCcceeeeccccCCCCcEEchhccceeeccchHHHHhh
Confidence            4677999999988888887653  33211   00             000    22345777777777777777666766


Q ss_pred             hc
Q psy9958          68 LH   69 (181)
Q Consensus        68 ~h   69 (181)
                      .|
T Consensus       367 Lh  368 (378)
T KOG2807|consen  367 LH  368 (378)
T ss_pred             hh
Confidence            55


No 252
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=21.02  E-value=46  Score=18.04  Aligned_cols=10  Identities=40%  Similarity=0.667  Sum_probs=4.2

Q ss_pred             CcccCCcccc
Q psy9958          45 KTHKCPECKK   54 (181)
Q Consensus        45 ~~~~C~~C~k   54 (181)
                      +.|.|.+|+.
T Consensus        23 ~~w~C~~C~~   32 (40)
T PF04810_consen   23 KTWICNFCGT   32 (40)
T ss_dssp             TEEEETTT--
T ss_pred             CEEECcCCCC
Confidence            4455555554


No 253
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=20.91  E-value=39  Score=17.46  Aligned_cols=13  Identities=23%  Similarity=0.744  Sum_probs=9.3

Q ss_pred             Cceecccchhhcc
Q psy9958           8 NPYLCDHCDQTFR   20 (181)
Q Consensus         8 kp~~C~~C~k~f~   20 (181)
                      +.|+|..||..+.
T Consensus         6 ~~ykC~~Cgniv~   18 (34)
T TIGR00319         6 QVYKCEVCGNIVE   18 (34)
T ss_pred             cEEEcCCCCcEEE
Confidence            4688888886653


No 254
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=20.88  E-value=31  Score=27.13  Aligned_cols=54  Identities=20%  Similarity=0.530  Sum_probs=26.8

Q ss_pred             CCCceecccchhhccChhhHHHHHHHhc--CCCCCCCCC----CCCcccCCcccccCCCc
Q psy9958           6 DQNPYLCDHCDQTFRQKQLLKRHVNLYH--NPHYVPPSP----KEKTHKCPECKKAFRHK   59 (181)
Q Consensus         6 ~ekp~~C~~C~k~f~~~~~L~~H~~~hh--~~~~~~~~~----~~~~~~C~~C~k~F~~~   59 (181)
                      ..+.|.|..|...+=++-.-++-....+  ...|-+.+.    |---|.|+.|+..|+.-
T Consensus       109 ~drqFaC~~Cd~~WwRrvp~rKeVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~G~  168 (278)
T PF15135_consen  109 VDRQFACSSCDHMWWRRVPQRKEVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFRGF  168 (278)
T ss_pred             cceeeeccccchHHHhccCcccccccccccccccCCCccccccceeeeecccccccchhh
Confidence            3477999999765443322221111111  011222221    12347899998888754


No 255
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=20.86  E-value=41  Score=17.44  Aligned_cols=13  Identities=23%  Similarity=0.744  Sum_probs=8.3

Q ss_pred             Cceecccchhhcc
Q psy9958           8 NPYLCDHCDQTFR   20 (181)
Q Consensus         8 kp~~C~~C~k~f~   20 (181)
                      +.|+|..||..+.
T Consensus         3 ~~ykC~~CGniv~   15 (34)
T cd00974           3 EVYKCEICGNIVE   15 (34)
T ss_pred             cEEEcCCCCcEEE
Confidence            3577777776553


No 256
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=20.62  E-value=83  Score=23.81  Aligned_cols=14  Identities=29%  Similarity=0.634  Sum_probs=9.3

Q ss_pred             CCcccCCcccccCC
Q psy9958          44 EKTHKCPECKKAFR   57 (181)
Q Consensus        44 ~~~~~C~~C~k~F~   57 (181)
                      ...+.|..||..+.
T Consensus        28 ~~lvrC~eCG~V~~   41 (201)
T COG1326          28 EPLVRCEECGTVHP   41 (201)
T ss_pred             ceEEEccCCCcEee
Confidence            35677888877653


No 257
>PRK06450 threonine synthase; Validated
Probab=20.62  E-value=54  Score=26.90  Aligned_cols=10  Identities=20%  Similarity=0.600  Sum_probs=7.8

Q ss_pred             eecccchhhc
Q psy9958          10 YLCDHCDQTF   19 (181)
Q Consensus        10 ~~C~~C~k~f   19 (181)
                      ++|..||+.|
T Consensus         4 ~~C~~Cg~~~   13 (338)
T PRK06450          4 EVCMKCGKER   13 (338)
T ss_pred             eEECCcCCcC
Confidence            6788888776


No 258
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=20.62  E-value=34  Score=18.51  Aligned_cols=11  Identities=36%  Similarity=1.210  Sum_probs=8.4

Q ss_pred             eecccchhhcc
Q psy9958          10 YLCDHCDQTFR   20 (181)
Q Consensus        10 ~~C~~C~k~f~   20 (181)
                      |.|..|++.|+
T Consensus        29 y~C~~C~~~wr   39 (39)
T PF01096_consen   29 YVCCNCGHRWR   39 (39)
T ss_dssp             EEESSSTEEEE
T ss_pred             EEeCCCCCeeC
Confidence            78888887763


No 259
>PRK12722 transcriptional activator FlhC; Provisional
Probab=20.60  E-value=42  Score=25.22  Aligned_cols=9  Identities=22%  Similarity=0.693  Sum_probs=4.4

Q ss_pred             CcccCCccc
Q psy9958          45 KTHKCPECK   53 (181)
Q Consensus        45 ~~~~C~~C~   53 (181)
                      ..|.|+.|.
T Consensus       153 ~~f~CplC~  161 (187)
T PRK12722        153 GSFVCGLCQ  161 (187)
T ss_pred             CCCcCCCCC
Confidence            345555554


No 260
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=20.12  E-value=71  Score=23.76  Aligned_cols=14  Identities=29%  Similarity=0.914  Sum_probs=8.4

Q ss_pred             CCceecccchhhcc
Q psy9958           7 QNPYLCDHCDQTFR   20 (181)
Q Consensus         7 ekp~~C~~C~k~f~   20 (181)
                      ..-|.|+.|.-.|+
T Consensus       111 ~~~y~C~~~~~r~s  124 (176)
T COG1675         111 NNYYVCPNCHVKYS  124 (176)
T ss_pred             CCceeCCCCCCccc
Confidence            44577766665554


No 261
>KOG1842|consensus
Probab=20.12  E-value=50  Score=28.27  Aligned_cols=28  Identities=21%  Similarity=0.437  Sum_probs=20.3

Q ss_pred             CcccCCcccccCCCchhHHHHHHh-cCCC
Q psy9958          45 KTHKCPECKKAFRHKGNLLRHMTL-HDPD   72 (181)
Q Consensus        45 ~~~~C~~C~k~F~~~~~l~~H~~~-h~~~   72 (181)
                      .-|.||+|.+-|..-..|..|.-. |..+
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            457888888888888888888654 4433


No 262
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=20.09  E-value=94  Score=23.52  Aligned_cols=18  Identities=17%  Similarity=0.442  Sum_probs=10.1

Q ss_pred             cCCCCceecccchhhccC
Q psy9958           4 HIDQNPYLCDHCDQTFRQ   21 (181)
Q Consensus         4 Ht~ekp~~C~~C~k~f~~   21 (181)
                      |-.-....|..|+..|..
T Consensus        90 HG~~~~~~C~~C~~~~~~  107 (206)
T cd01410          90 HGNMFIEVCKSCGPEYVR  107 (206)
T ss_pred             cCCcCcccCCCCCCccch
Confidence            444445567777765543


No 263
>KOG1842|consensus
Probab=20.05  E-value=61  Score=27.80  Aligned_cols=27  Identities=22%  Similarity=0.471  Sum_probs=24.0

Q ss_pred             CceecccchhhccChhhHHHHHHHhcC
Q psy9958           8 NPYLCDHCDQTFRQKQLLKRHVNLYHN   34 (181)
Q Consensus         8 kp~~C~~C~k~f~~~~~L~~H~~~hh~   34 (181)
                      .-|.|++|.+-|.+...|..|.-.-|.
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcc
Confidence            458999999999999999999887764


No 264
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=20.02  E-value=7.6  Score=23.97  Aligned_cols=41  Identities=17%  Similarity=0.490  Sum_probs=20.8

Q ss_pred             ceecccchhhccChhhHHHHHHHhcCCCCCCCCCCCCcccCCcccccCCCchh
Q psy9958           9 PYLCDHCDQTFRQKQLLKRHVNLYHNPHYVPPSPKEKTHKCPECKKAFRHKGN   61 (181)
Q Consensus         9 p~~C~~C~k~f~~~~~L~~H~~~hh~~~~~~~~~~~~~~~C~~C~k~F~~~~~   61 (181)
                      -|.|..|+.+-..  .+.++. .+         .|..-.+|+-|.....-..+
T Consensus         4 ~FTC~~C~~Rs~~--~~sk~a-Y~---------~GvViv~C~gC~~~HlIaDn   44 (66)
T PF05180_consen    4 TFTCNKCGTRSAK--MFSKQA-YH---------KGVVIVQCPGCKNRHLIADN   44 (66)
T ss_dssp             EEEETTTTEEEEE--EEEHHH-HH---------TSEEEEE-TTS--EEES--S
T ss_pred             EEEcCCCCCccce--eeCHHH-Hh---------CCeEEEECCCCcceeeehhh
Confidence            3889999854332  333332 22         36677789999765443333


Done!