Query psy9969
Match_columns 75
No_of_seqs 105 out of 333
Neff 4.6
Searched_HMMs 46136
Date Sat Aug 17 00:20:42 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy9969.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9969hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF01049 Cadherin_C: Cadherin 99.8 1.1E-21 2.5E-26 134.4 1.4 53 5-57 97-149 (149)
2 PF05923 APC_crr: APC cysteine 43.9 7.6 0.00016 19.7 0.0 9 18-26 17-25 (26)
3 PF06327 DUF1053: Domain of Un 33.1 21 0.00045 22.2 0.8 19 38-57 2-20 (101)
4 KOG3190|consensus 28.5 32 0.00069 26.3 1.2 23 13-35 7-29 (256)
5 PF10786 G6PD_bact: Glucose-6- 27.3 8.2 0.00018 28.7 -2.1 9 67-75 60-68 (215)
6 PF00750 tRNA-synt_1d: tRNA sy 22.4 38 0.00082 25.8 0.6 19 37-55 63-81 (354)
7 PF15382 DUF4609: Domain of un 21.2 46 0.001 20.8 0.7 19 30-48 36-54 (70)
8 PF12609 DUF3774: Wound-induce 19.7 38 0.00081 21.1 0.1 9 37-45 71-79 (79)
9 KOG1195|consensus 19.2 27 0.00059 29.3 -0.8 23 36-58 152-174 (567)
10 TIGR00456 argS arginyl-tRNA sy 18.4 49 0.0011 26.8 0.5 20 37-56 155-174 (566)
No 1
>PF01049 Cadherin_C: Cadherin cytoplasmic region; InterPro: IPR000233 Cadherins are transmembrane glycoproteins vital in calcium-dependent cell-cell adhesion during tissue differentiation []. Cadherins cluster to form foci of homophilic binding units. A key determinant to the strength of the binding that it is mediated by cadherins is the juxtamembrane region of the cadherin. This region induces clustering and also binds to the protein p120ctn []. The cytoplasmic region is highly conserved in sequence and has been shown experimentally to regulate the cell-cell binding function of the extracellular domain of E-cadherin, possibly through interaction with the cytoskeleton []. This domain is found upstream of the cadherin domain IPR002126 from INTERPRO.; GO: 0005509 calcium ion binding, 0007156 homophilic cell adhesion, 0016020 membrane; PDB: 2KOH_B 3IFQ_D 1I7X_D 1I7W_D 3L6Y_F 3L6X_B.
Probab=99.83 E-value=1.1e-21 Score=134.44 Aligned_cols=53 Identities=23% Similarity=0.501 Sum_probs=22.8
Q ss_pred cccccccccCCCCCCCCCCCCCCCCCCCCCCCCCccCCcCcchHHHHHhhcCC
Q psy9969 5 KIYTFPFLKISRHTTNRKPRSPSTVTDEGDLNFDYLSNFGPRFRKLADMYGED 57 (75)
Q Consensus 5 ~~~~~~y~~EG~gS~AGSLSSL~Ss~~d~~~~~dyL~~WGPrFq~LA~ly~~~ 57 (75)
-+.+..|.+||.||+|||||||.|.+.+++++|+||++|||||++||+||+++
T Consensus 97 ~Dsl~~Y~~EG~gS~agSLSSL~S~s~~~~~~~~~L~~wGPkF~~LAeiy~~~ 149 (149)
T PF01049_consen 97 YDSLQVYAYEGQGSSAGSLSSLESCSSDEEQDYDFLDDWGPKFRKLAEIYGDR 149 (149)
T ss_dssp -EEEEE----------TT---------------GGGGGS-GGGHHHHHCCSS-
T ss_pred ccceeeeccCCCCCcCCCcccccCCCcccccCchhhhhcChhHHHHHHHHccC
Confidence 34667888999999999999999988888999999999999999999999864
No 2
>PF05923 APC_crr: APC cysteine-rich region; InterPro: IPR009223 This short region is found repeated in the mid region of the adenomatous polyposis proteins (APCs). In the human protein many cancer-linked SNPs are found near the first three occurrences of the motif. These repeats bind beta-catenin [].; GO: 0016055 Wnt receptor signaling pathway; PDB: 1T08_C 1TH1_C 1V18_B.
Probab=43.92 E-value=7.6 Score=19.75 Aligned_cols=9 Identities=11% Similarity=-0.060 Sum_probs=0.0
Q ss_pred CCCCCCCCC
Q psy9969 18 TTNRKPRSP 26 (75)
Q Consensus 18 S~AGSLSSL 26 (75)
|.+.|||+|
T Consensus 17 S~~sSlSsL 25 (26)
T PF05923_consen 17 SRASSLSSL 25 (26)
T ss_dssp ---------
T ss_pred cccccccCC
Confidence 678888887
No 3
>PF06327 DUF1053: Domain of Unknown Function (DUF1053); InterPro: IPR009398 Cyclic AMP (cAMP) is a ubiquitous signalling molecule which mediates many cellular processes by activating cAMP-dependent kinases and also inducing protein-protein interactions. This molecule is produced by the adenylate cyclase (AC) enzyme, using ATP as its substrate. Mammalian adenylate cyclase has nine closely related membrane-bound isoforms (AC1-9) showing significant sequence homology and sharing the same overall structure: two hydrophobic transmembrane domains, and two cytoplasmic domains that are responsible for the catalytic activity. These isoforms differ in both their tissue specificity and their regulation. Regulatory factors known to influence one or more of these isoforms include G proteins, protein kinases, calcium and calmodulin. For more information see [, ]. This entry represents a region of unknown function found in many of these isoforms. It is part of the N-terminal cytoplasmic domain but its presence is not necessary for catalytic activity []. ; GO: 0004016 adenylate cyclase activity, 0009190 cyclic nucleotide biosynthetic process, 0016021 integral to membrane
Probab=33.12 E-value=21 Score=22.23 Aligned_cols=19 Identities=21% Similarity=0.620 Sum_probs=13.6
Q ss_pred CccCCcCcchHHHHHhhcCC
Q psy9969 38 DYLSNFGPRFRKLADMYGED 57 (75)
Q Consensus 38 dyL~~WGPrFq~LA~ly~~~ 57 (75)
.||.+|||. ++.|.+-...
T Consensus 2 ~~l~~W~ae-~PF~nl~~~~ 20 (101)
T PF06327_consen 2 RYLESWGAE-KPFANLNHRE 20 (101)
T ss_pred CCCCCcCCc-CCHhHhccCc
Confidence 589999997 6666665443
No 4
>KOG3190|consensus
Probab=28.49 E-value=32 Score=26.27 Aligned_cols=23 Identities=13% Similarity=0.085 Sum_probs=19.2
Q ss_pred cCCCCCCCCCCCCCCCCCCCCCC
Q psy9969 13 KISRHTTNRKPRSPSTVTDEGDL 35 (75)
Q Consensus 13 ~EG~gS~AGSLSSL~Ss~~d~~~ 35 (75)
.+|.|+-+||+++.++.+++++.
T Consensus 7 ~e~ag~~~gs~rk~~~~~sEEd~ 29 (256)
T KOG3190|consen 7 VEGAGSEDGSERKEGSEDSEEDE 29 (256)
T ss_pred hhhcccccccccccccccchhhc
Confidence 59999999999999887666554
No 5
>PF10786 G6PD_bact: Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49); InterPro: IPR019722 This entry represents proteins conserved in Firmicutes and Proteobacteria. Several members are annotated as being glucose-6-phosphate 1-dehydrogenase (1.1.1.49 from EC) but this could not be confirmed.
Probab=27.32 E-value=8.2 Score=28.74 Aligned_cols=9 Identities=33% Similarity=0.608 Sum_probs=8.0
Q ss_pred CCccccCCC
Q psy9969 67 QPAASESWC 75 (75)
Q Consensus 67 ~~~~~~~~~ 75 (75)
.+||-||||
T Consensus 60 akphIEsWt 68 (215)
T PF10786_consen 60 AKPHIESWT 68 (215)
T ss_pred ccchhhhcc
Confidence 589999998
No 6
>PF00750 tRNA-synt_1d: tRNA synthetases class I (R); InterPro: IPR015945 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This entry represents the core region of arginyl-tRNA synthetase (6.1.1.19 from EC), which has been crystallized and preliminary X-ray crystallographic analysis of yeast arginyl-tRNA synthetase-yeast tRNAArg complexes is available []. ; GO: 0000166 nucleotide binding, 0004814 arginine-tRNA ligase activity, 0005524 ATP binding, 0006420 arginyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 2ZUE_A 2ZUF_A 3FNR_A 1IQ0_A 1F7V_A 1F7U_A 1BS2_A 3GDZ_B.
Probab=22.45 E-value=38 Score=25.81 Aligned_cols=19 Identities=26% Similarity=0.573 Sum_probs=15.8
Q ss_pred CCccCCcCcchHHHHHhhc
Q psy9969 37 FDYLSNFGPRFRKLADMYG 55 (75)
Q Consensus 37 ~dyL~~WGPrFq~LA~ly~ 55 (75)
-.|++|||-+|..|+.-+-
T Consensus 63 ~nyigD~G~Q~~~l~~~~~ 81 (354)
T PF00750_consen 63 ENYIGDWGTQIGLLAASYK 81 (354)
T ss_dssp EEEEBTTSHHHHHHHHHHH
T ss_pred EEEECCCCHHHHHHHHHHH
Confidence 3689999999999986654
No 7
>PF15382 DUF4609: Domain of unknown function (DUF4609)
Probab=21.20 E-value=46 Score=20.77 Aligned_cols=19 Identities=21% Similarity=0.473 Sum_probs=12.1
Q ss_pred CCCCCCCCCccCCcCcchH
Q psy9969 30 TDEGDLNFDYLSNFGPRFR 48 (75)
Q Consensus 30 ~~d~~~~~dyL~~WGPrFq 48 (75)
..+++-...--.+|||-++
T Consensus 36 ~seeQrTI~E~~dWGpy~R 54 (70)
T PF15382_consen 36 GSEEQRTIREQADWGPYYR 54 (70)
T ss_pred Cchhhhhhhccccccchhc
Confidence 3343335666789999765
No 8
>PF12609 DUF3774: Wound-induced protein; InterPro: IPR022251 This family of proteins is found in eukaryotes. Proteins in this family are typically between 81 and 97 amino acids in length. The proteins in the family are often annotated as wound-induced proteins however there is little accompanying literature to confirm this.
Probab=19.71 E-value=38 Score=21.13 Aligned_cols=9 Identities=56% Similarity=1.003 Sum_probs=7.7
Q ss_pred CCccCCcCc
Q psy9969 37 FDYLSNFGP 45 (75)
Q Consensus 37 ~dyL~~WGP 45 (75)
-=||.=|||
T Consensus 71 VMyLSCWGP 79 (79)
T PF12609_consen 71 VMYLSCWGP 79 (79)
T ss_pred eEEEeccCc
Confidence 468999998
No 9
>KOG1195|consensus
Probab=19.24 E-value=27 Score=29.35 Aligned_cols=23 Identities=26% Similarity=0.404 Sum_probs=18.9
Q ss_pred CCCccCCcCcchHHHHHhhcCCC
Q psy9969 36 NFDYLSNFGPRFRKLADMYGEDP 58 (75)
Q Consensus 36 ~~dyL~~WGPrFq~LA~ly~~~~ 58 (75)
..+||.+||-+|.-||.-|..-.
T Consensus 152 r~NYLGDWGkQFgll~~g~~~~g 174 (567)
T KOG1195|consen 152 RVNYLGDWGKQFGLLALGFQLYG 174 (567)
T ss_pred ehhhhhHHHHHhhHHhccHHhhC
Confidence 46899999999999998776543
No 10
>TIGR00456 argS arginyl-tRNA synthetase. This model recognizes arginyl-tRNA synthetase in every completed genome to date. An interesting feature of the alignment of all arginyl-tRNA synthetases is a fairly deep split between two families. One family includes archaeal, eukaryotic and organellar, spirochete, E. coli, and Synechocystis sp. The second, sharing a deletion of about 25 residues in the central region relative to the first, includes Bacillus subtilis, Aquifex aeolicus, the Mycoplasmas and Mycobacteria, and the Gram-negative bacterium Helicobacter pylori.
Probab=18.38 E-value=49 Score=26.81 Aligned_cols=20 Identities=25% Similarity=0.316 Sum_probs=16.7
Q ss_pred CCccCCcCcchHHHHHhhcC
Q psy9969 37 FDYLSNFGPRFRKLADMYGE 56 (75)
Q Consensus 37 ~dyL~~WGPrFq~LA~ly~~ 56 (75)
-.|++|||-+|..|+.-+-.
T Consensus 155 ~~yinD~G~Q~~~l~~~~~~ 174 (566)
T TIGR00456 155 EYYVNDWGRQFGLLALGVEK 174 (566)
T ss_pred EeeecchHHHHHHHHHHHHH
Confidence 47899999999999976643
Done!