Diaphorina citri psyllid: psy996


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
MNFIFLFPAPPGISNNKDSSSKKKEAKEEKKEDKKPSVTQYPPQKSHNLTDSVRLKCREMLQNSIQVGDLDMDGLASLEELATELEEAIYNEFKNTDNRYKNRVRSRIANLKDPKNPMLSRNYIFGAISASKLATMTAEVQTRSADEPMTTFEMANDEMKTLRNKFIKESIDDAQLATVQGTKTDLLKCGKCKKRNCTYNQVQTRSADEPMTTLHHFYITV
ccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHccccccccHHHHHcccHHHHcccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccEECcccccccEEEEEEEEccccccccEEEEEEEEc
*NFIFL************************************************LKCREMLQNSIQVGDLDMDGLASLEELATELEEAIYNEFKNTDNRYKNRVRSRIANLKDPKNPMLSRNYIFGAISASKLATM****************EMANDEMKTLRNKFIKESIDDAQLATVQGTKTDLLKCGKCKKRNCTYNQVQTRSADEPMTTLHHFYITV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFIFLFPAPPGISNNKDSSSKKKEAKEEKKEDKKPSVTQYPPQKSHNLTDSVRLKCREMLQNSIQVGDLDMDGLASLEELATELEEAIYNEFKNTDNRYKNRVRSRIANLKDPKNPMLSRNYIFGAISASKLATMTAEVQTRSADEPMTTFEMANDEMKTLRNKFIKESIDDAQLATVQGTKTDLLKCGKCKKRNCTYNQVQTRSADEPMTTLHHFYITV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription elongation factor A protein 1 Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.confidentQ29RL9
Putative transcription elongation factor S-II Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.confidentP52652
Transcription elongation factor A protein 1 Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.confidentP10711

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0010557 [BP]positive regulation of macromolecule biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0060255, GO:0009889, GO:0010556, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0010604
GO:0051254 [BP]positive regulation of RNA metabolic processprobableGO:0045935, GO:0010604, GO:0019222, GO:0060255, GO:0031323, GO:0031325, GO:0051252, GO:0080090, GO:0050794, GO:0019219, GO:0065007, GO:0051171, GO:0051173, GO:0048518, GO:0008150, GO:0048522, GO:0050789, GO:0009893
GO:0031328 [BP]positive regulation of cellular biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0009889, GO:0050794, GO:0031323, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PO3, chain S
Confidence level:very confident
Coverage over the Query: 51-139,153-219
View the alignment between query and template
View the model in PyMOL