Query         psy9982
Match_columns 222
No_of_seqs    150 out of 167
Neff          3.9 
Searched_HMMs 46136
Date          Sat Aug 17 00:38:59 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9982.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9982hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0260|consensus              100.0 7.2E-29 1.6E-33  252.7  13.1   51   57-107  1447-1497(1605)
  2 KOG0260|consensus              100.0   5E-28 1.1E-32  246.6  13.2  108   61-168  1472-1579(1605)
  3 KOG3722|consensus               99.3 2.7E-13 5.9E-18  129.0   1.9   57   16-73     24-80  (538)
  4 PF13908 Shisa:  Wnt and FGF in  95.3   0.089 1.9E-06   44.1   7.7   23   10-32     77-99  (179)
  5 PF01102 Glycophorin_A:  Glycop  93.8   0.054 1.2E-06   44.4   2.9   33   10-44     66-98  (122)
  6 PF01034 Syndecan:  Syndecan do  92.8   0.038 8.2E-07   41.1   0.4   32    6-43     11-42  (64)
  7 PF06024 DUF912:  Nucleopolyhed  89.9    0.11 2.4E-06   40.7   0.4   27   16-42     68-94  (101)
  8 PF13908 Shisa:  Wnt and FGF in  89.4     2.6 5.7E-05   35.3   8.3   31    6-36     77-107 (179)
  9 PF12273 RCR:  Chitin synthesis  84.6    0.95 2.1E-05   36.3   2.9   19   18-36      7-25  (130)
 10 PF02439 Adeno_E3_CR2:  Adenovi  83.0     1.2 2.7E-05   30.1   2.4   26    6-31      5-30  (38)
 11 PF04277 OAD_gamma:  Oxaloaceta  76.0     3.4 7.4E-05   30.1   3.2   34    8-42      8-41  (79)
 12 PF04791 LMBR1:  LMBR1-like mem  73.9     2.3 4.9E-05   40.1   2.3   26   18-43      1-26  (471)
 13 PHA02849 putative transmembran  73.5     3.1 6.6E-05   32.4   2.5   17   18-34     27-43  (82)
 14 PF11368 DUF3169:  Protein of u  71.9     2.2 4.8E-05   37.6   1.6   27   16-42     51-77  (248)
 15 PF07466 DUF1517:  Protein of u  70.9       8 0.00017   35.7   5.0   44   19-62     70-113 (289)
 16 PRK10263 DNA translocase FtsK;  70.9     3.1 6.6E-05   45.8   2.6   17    6-22    157-173 (1355)
 17 TIGR03546 conserved hypothetic  70.2       3 6.5E-05   35.3   1.9   25   18-42    116-140 (154)
 18 PF06143 Baculo_11_kDa:  Baculo  69.5     3.6 7.7E-05   32.1   2.1   28    3-30     33-60  (84)
 19 KOG4433|consensus               69.5     6.4 0.00014   39.4   4.3   30   20-52    398-427 (526)
 20 PF10857 DUF2701:  Protein of u  68.8     4.5 9.8E-05   30.1   2.4   20   15-34      5-24  (63)
 21 PF06679 DUF1180:  Protein of u  68.7       8 0.00017   33.3   4.2   11   49-59    149-159 (163)
 22 PRK05886 yajC preprotein trans  67.6     3.7 7.9E-05   33.2   1.8   23   17-42      8-30  (109)
 23 PHA02902 putative IMV membrane  65.3     8.5 0.00019   29.1   3.2   24   19-42      6-29  (70)
 24 COG1930 CbiN ABC-type cobalt t  65.1      12 0.00025   30.0   4.1   40   32-73     20-61  (97)
 25 PRK06531 yajC preprotein trans  59.2     5.1 0.00011   32.5   1.2   20   22-41      8-27  (113)
 26 PF13073 DUF3937:  Protein of u  59.1      12 0.00027   28.3   3.1   32    1-32      1-32  (73)
 27 PF09451 ATG27:  Autophagy-rela  58.5     8.4 0.00018   34.6   2.6   26   17-42    207-232 (268)
 28 PF11857 DUF3377:  Domain of un  58.2     6.5 0.00014   30.1   1.6   28   14-42     32-59  (74)
 29 PF15102 TMEM154:  TMEM154 prot  57.6     5.9 0.00013   33.7   1.4   27   17-43     62-88  (146)
 30 TIGR01165 cbiN cobalt transpor  55.9      16 0.00035   28.9   3.5   54   17-72      7-62  (91)
 31 PF05545 FixQ:  Cbb3-type cytoc  55.6      14  0.0003   25.1   2.7    9   18-26     13-21  (49)
 32 PF02553 CbiN:  Cobalt transpor  55.6      12 0.00026   28.5   2.6   51   20-72      7-60  (74)
 33 PF02439 Adeno_E3_CR2:  Adenovi  55.5     9.1  0.0002   25.9   1.8   14   12-25     15-28  (38)
 34 PF07172 GRP:  Glycine rich pro  55.4      19  0.0004   28.3   3.8   19   17-35      7-25  (95)
 35 PF05151 PsbM:  Photosystem II   54.3      12 0.00025   24.4   2.0   24    5-28      4-27  (31)
 36 PF14150 YesK:  YesK-like prote  53.5      16 0.00036   28.2   3.2   26   16-41      2-27  (81)
 37 PF12273 RCR:  Chitin synthesis  53.4     8.8 0.00019   30.7   1.8   26   18-43      4-29  (130)
 38 PRK10633 hypothetical protein;  52.7      19 0.00042   27.7   3.4   22   18-39     49-70  (80)
 39 PF06129 Chordopox_G3:  Chordop  51.7      14  0.0003   30.1   2.6   20   13-32      2-22  (109)
 40 KOG4841|consensus               51.1     8.6 0.00019   30.5   1.3   33   22-58     46-78  (95)
 41 PF06422 PDR_CDR:  CDR ABC tran  50.9      19 0.00041   28.1   3.2   25   17-41     52-76  (103)
 42 PHA02681 ORF089 virion membran  50.6      13 0.00029   29.3   2.3   21   21-41      8-28  (92)
 43 PHA03030 hypothetical protein;  48.8      12 0.00027   30.7   1.9   27   14-40      1-27  (122)
 44 PHA02657 hypothetical protein;  47.7      22 0.00047   28.3   3.0   17   18-34     37-53  (95)
 45 PF10873 DUF2668:  Protein of u  47.5      92   0.002   26.9   7.0   10   50-59     99-108 (155)
 46 COG1862 YajC Preprotein transl  46.0      13 0.00028   29.5   1.6   22   18-42     14-35  (97)
 47 PF12270 Cyt_c_ox_IV:  Cytochro  45.4      36 0.00077   28.7   4.2   41   23-67     46-86  (137)
 48 PRK14472 F0F1 ATP synthase sub  44.9      26 0.00055   29.3   3.3   13    1-13      1-13  (175)
 49 PF15339 Afaf:  Acrosome format  44.5      19 0.00041   32.0   2.5   27   17-43    138-164 (200)
 50 PF05434 Tmemb_9:  TMEM9;  Inte  44.4      18 0.00039   30.9   2.3   27    8-34     52-78  (149)
 51 PF08135 EPV_E5:  Major transfo  42.8      35 0.00075   23.8   3.1   28    5-32      5-32  (44)
 52 COG1766 fliF Flagellar basal b  42.8      25 0.00054   35.4   3.4   30   15-44    447-476 (545)
 53 PF05399 EVI2A:  Ectropic viral  42.7      24 0.00052   32.1   2.9   13   13-25    138-150 (227)
 54 PF11119 DUF2633:  Protein of u  42.6      23 0.00049   26.1   2.3   30   13-42      8-38  (59)
 55 PF04906 Tweety:  Tweety;  Inte  42.3      21 0.00045   34.2   2.6   31    6-36     18-49  (406)
 56 PRK13453 F0F1 ATP synthase sub  40.9      35 0.00076   28.6   3.6   23    7-29     10-34  (173)
 57 PF13134 DUF3948:  Protein of u  40.6      17 0.00038   24.1   1.3   12    4-15     12-23  (35)
 58 PF02157 Man-6-P_recep:  Mannos  39.9     9.6 0.00021   35.5   0.0   35    7-42    185-219 (278)
 59 TIGR01432 QOXA cytochrome aa3   39.9      31 0.00068   30.0   3.2   26   17-42     28-53  (217)
 60 PF00558 Vpu:  Vpu protein;  In  39.8      25 0.00054   27.3   2.3   38    1-39      1-38  (81)
 61 COG4736 CcoQ Cbb3-type cytochr  39.7      40 0.00086   24.8   3.2   23   19-41     15-37  (60)
 62 PF15471 TMEM171:  Transmembran  39.6      22 0.00048   33.5   2.3   32   10-42    156-187 (319)
 63 PF06716 DUF1201:  Protein of u  38.9      43 0.00093   24.0   3.1   20   15-34     14-33  (54)
 64 TIGR02762 TraL_TIGR type IV co  38.8      31 0.00066   26.7   2.7   24   19-43     42-65  (95)
 65 PF01102 Glycophorin_A:  Glycop  38.7      23 0.00051   29.1   2.1   30    4-34     64-93  (122)
 66 KOG1094|consensus               38.3 4.1E+02  0.0089   28.2  11.1   13   62-74    443-455 (807)
 67 PRK13454 F0F1 ATP synthase sub  37.8      30 0.00066   29.3   2.7   17   20-36     38-55  (181)
 68 PF15468 DUF4636:  Domain of un  37.6      40 0.00087   30.8   3.5   13    5-17     33-45  (243)
 69 TIGR02866 CoxB cytochrome c ox  35.8      70  0.0015   27.4   4.6   23   18-41     19-42  (201)
 70 TIGR00869 sec62 protein transl  35.7      27 0.00058   31.8   2.1   10   25-34    170-179 (232)
 71 PF12409 P5-ATPase:  P5-type AT  35.6      43 0.00093   26.4   3.1   26   12-37     17-42  (119)
 72 PF11457 DUF3021:  Protein of u  33.9      34 0.00075   26.9   2.3   28   15-42    102-129 (136)
 73 PF06024 DUF912:  Nucleopolyhed  33.9      31 0.00067   27.0   2.0   34   11-44     59-92  (101)
 74 PF03821 Mtp:  Golgi 4-transmem  33.4      32 0.00069   31.4   2.3   26   18-43     38-64  (233)
 75 TIGR02976 phageshock_pspB phag  33.3      43 0.00092   25.4   2.6   27   15-42      5-31  (75)
 76 PRK02898 cobalt transport prot  33.2      58  0.0013   26.2   3.4   55   16-72      5-62  (100)
 77 PF13179 DUF4006:  Family of un  32.8      44 0.00095   25.1   2.5   38    6-43      7-44  (66)
 78 PRK14780 lipoprotein signal pe  32.7      45 0.00098   31.0   3.1   52    5-57    191-249 (263)
 79 PHA02825 LAP/PHD finger-like p  32.3      29 0.00063   30.1   1.7   50   14-65     79-128 (162)
 80 PF04478 Mid2:  Mid2 like cell   32.2      15 0.00033   31.5   0.0   20   38-59     77-96  (154)
 81 PF08374 Protocadherin:  Protoc  32.2      29 0.00063   31.5   1.8   17    6-22     40-56  (221)
 82 PF15330 SIT:  SHP2-interacting  32.1      90   0.002   25.0   4.4   26   17-42      8-33  (107)
 83 PF11057 Cortexin:  Cortexin of  31.7      42  0.0009   26.1   2.3   30   12-41     29-60  (81)
 84 PF13073 DUF3937:  Protein of u  31.3      42  0.0009   25.5   2.2   16   18-33     10-25  (73)
 85 PRK04989 psbM photosystem II r  31.2      31 0.00068   23.0   1.4   22    6-27      5-26  (35)
 86 PF13800 Sigma_reg_N:  Sigma fa  31.0      41 0.00089   25.4   2.2   21   14-34     19-39  (96)
 87 CHL00080 psbM photosystem II p  30.8      31 0.00066   22.9   1.2   22    6-27      5-26  (34)
 88 COG3462 Predicted membrane pro  30.7      85  0.0018   26.0   4.1   36    7-44     40-82  (117)
 89 PRK13682 hypothetical protein;  30.7      56  0.0012   23.4   2.7   16   18-33     33-48  (51)
 90 TIGR01195 oadG_fam sodium pump  29.9      66  0.0014   24.4   3.2   19   17-35     20-38  (82)
 91 TIGR03063 srtB_target sortase   29.6      64  0.0014   20.6   2.5   12   21-32     11-22  (29)
 92 PF02790 COX2_TM:  Cytochrome C  29.6      84  0.0018   22.5   3.6   21   15-35     28-48  (84)
 93 KOG4433|consensus               29.5      46   0.001   33.6   2.8   20   16-35     53-72  (526)
 94 PF02532 PsbI:  Photosystem II   29.4      80  0.0017   21.2   3.1   17   16-32      8-24  (36)
 95 PF07946 DUF1682:  Protein of u  29.2      46   0.001   30.7   2.6   21   16-36      6-26  (321)
 96 PF08370 PDR_assoc:  Plant PDR   29.2      77  0.0017   23.4   3.3   27   15-41     35-61  (65)
 97 PF14851 FAM176:  FAM176 family  29.0      63  0.0014   27.6   3.2   19   15-33     29-47  (153)
 98 PF06196 DUF997:  Protein of un  29.0      74  0.0016   24.2   3.3   22   18-39     49-70  (80)
 99 PF14276 DUF4363:  Domain of un  28.8      40 0.00088   26.3   1.9   26   17-42      1-26  (121)
100 PRK10983 putative inner membra  28.7      55  0.0012   30.8   3.1   38    6-43    312-350 (368)
101 PF03579 SHP:  Small hydrophobi  28.7      62  0.0014   24.1   2.7   17   19-35     18-34  (64)
102 PF04246 RseC_MucC:  Positive r  28.5      52  0.0011   26.2   2.5   24   20-43    100-123 (135)
103 TIGR03038 PS_II_psbM photosyst  28.4      37 0.00081   22.4   1.4   23    6-28      5-27  (33)
104 PF06783 UPF0239:  Uncharacteri  28.2      18 0.00039   28.4  -0.2   18    8-25     25-42  (85)
105 PF13858 DUF4199:  Protein of u  28.2      56  0.0012   26.2   2.7   15   28-42     43-57  (163)
106 PF12669 P12:  Virus attachment  28.0      55  0.0012   23.4   2.3    9   31-39     18-26  (58)
107 TIGR02736 cbb3_Q_epsi cytochro  27.9 1.1E+02  0.0023   22.4   3.8   24   18-41      7-30  (56)
108 COG4395 Uncharacterized protei  27.8      31 0.00066   32.3   1.2   21   18-38     61-81  (281)
109 PLN03207 stomagen; Provisional  27.4      67  0.0015   26.2   2.9   20   13-33     10-29  (113)
110 PF13131 DUF3951:  Protein of u  27.4      99  0.0022   22.4   3.5   39   18-56      8-46  (53)
111 PLN00090 photosystem II reacti  26.7      44 0.00096   27.2   1.8   22    6-27     75-96  (113)
112 PF10332 DUF2418:  Protein of u  26.0      66  0.0014   25.4   2.6   32   11-42     35-66  (99)
113 KOG2417|consensus               25.7      37 0.00081   33.4   1.4   25   13-37     80-104 (462)
114 cd00922 Cyt_c_Oxidase_IV Cytoc  25.5      49  0.0011   27.4   1.9   23    3-25     71-94  (136)
115 TIGR01433 CyoA cytochrome o ub  25.5      50  0.0011   29.3   2.1   29   15-43     35-63  (226)
116 PF03620 IBV_3C:  IBV 3C protei  25.1      91   0.002   24.8   3.2   27    7-33      9-35  (93)
117 PF10063 DUF2301:  Uncharacteri  25.0 1.3E+02  0.0028   25.3   4.3   37   17-58     99-135 (135)
118 PRK09697 protein secretion pro  25.0      37 0.00081   28.4   1.1   21   10-30     24-44  (139)
119 PHA02909 hypothetical protein;  24.8      85  0.0018   23.4   2.8   14   13-26     39-52  (72)
120 PF03839 Sec62:  Translocation   24.7      55  0.0012   29.5   2.2   25    6-30    146-171 (224)
121 COG5487 Small integral membran  24.6      87  0.0019   22.7   2.8   16   18-33     33-48  (54)
122 PRK09459 pspG phage shock prot  24.6 1.3E+02  0.0027   23.3   3.8   36    8-43     35-70  (76)
123 PRK14094 psbM photosystem II r  24.3      27 0.00058   24.9   0.1   11    7-17      6-16  (50)
124 PRK13707 conjugal transfer pil  23.7      67  0.0015   25.4   2.3   17   26-42     51-67  (101)
125 PF03908 Sec20:  Sec20;  InterP  23.6      93   0.002   23.5   3.0   18   18-35     73-90  (92)
126 PF09680 Tiny_TM_bacill:  Prote  23.6      74  0.0016   19.7   1.9   13   18-30      8-20  (24)
127 COG3339 Uncharacterized conser  23.3      63  0.0014   26.5   2.1   39    2-42     66-104 (116)
128 PF15347 PAG:  Phosphoprotein a  23.1      45 0.00098   32.8   1.4   22   18-41     26-47  (428)
129 PF06837 Fijivirus_P9-2:  Fijiv  23.1      82  0.0018   28.4   2.9   17   22-38    125-141 (214)
130 PHA02975 hypothetical protein;  23.1      76  0.0017   24.1   2.3   11   17-27     54-64  (69)
131 PHA02815 hypothetical protein;  23.0      64  0.0014   24.1   1.9   17   16-32      5-21  (64)
132 PF07178 TraL:  TraL protein;    23.0      78  0.0017   24.2   2.5   24   20-43     39-62  (95)
133 PF06667 PspB:  Phage shock pro  22.5      84  0.0018   23.9   2.5   17   26-42     15-31  (75)
134 PRK09702 PTS system arbutin-sp  22.5   1E+02  0.0022   26.3   3.3   25   14-38     10-35  (161)
135 PF10864 DUF2663:  Protein of u  22.4      43 0.00092   28.1   1.0   24   20-43     60-83  (130)
136 PF05978 UNC-93:  Ion channel r  22.4      60  0.0013   27.1   1.9   32    2-34     56-87  (156)
137 PRK04778 septation ring format  22.2      70  0.0015   31.7   2.6   28   15-42      5-32  (569)
138 COG1585 Membrane protein impli  22.0      87  0.0019   26.0   2.7   25   17-41     48-72  (140)
139 PTZ00404 cytochrome P450; Prov  22.0      95  0.0021   29.0   3.3   27   17-43      3-29  (482)
140 PF15330 SIT:  SHP2-interacting  21.9 1.1E+02  0.0024   24.4   3.3   29   16-44      4-32  (107)
141 PRK09458 pspB phage shock prot  21.8 1.1E+02  0.0023   23.5   3.0   16   27-42     16-31  (75)
142 PF12768 Rax2:  Cortical protei  21.7 1.2E+02  0.0025   28.0   3.7   25   18-42    235-259 (281)
143 PHA02867 C-type lectin protein  21.6      63  0.0014   27.8   1.9   19   12-30     17-35  (167)
144 PF00558 Vpu:  Vpu protein;  In  21.5      84  0.0018   24.4   2.4   34   10-43      6-39  (81)
145 PF05620 DUF788:  Protein of un  21.4 1.2E+02  0.0026   25.6   3.5   27   16-42     47-73  (170)
146 PF09125 COX2-transmemb:  Cytoc  21.4 1.1E+02  0.0025   20.7   2.6    9   28-36     30-38  (38)
147 PF10954 DUF2755:  Protein of u  21.4      88  0.0019   25.1   2.5   33    7-40     67-99  (100)
148 PHA02650 hypothetical protein;  21.2      85  0.0019   24.5   2.3   10   30-39     66-75  (81)
149 PF03208 PRA1:  PRA1 family pro  21.2      93   0.002   25.0   2.7   20   16-35    118-137 (153)
150 PF06678 DUF1179:  Protein of u  21.1 3.8E+02  0.0082   21.8   6.1   20   23-43     14-33  (103)
151 PHA02819 hypothetical protein;  21.1      88  0.0019   23.9   2.3    9   19-27     58-66  (71)
152 PTZ00358 hypothetical protein;  21.1 1.2E+02  0.0026   29.4   3.8   38    6-43    116-174 (367)
153 PHA03049 IMV membrane protein;  21.0 1.2E+02  0.0027   22.9   3.1   23   20-42      6-28  (68)
154 PHA03054 IMV membrane protein;  21.0      89  0.0019   23.9   2.3    9   19-27     60-68  (72)
155 PF11466 Doppel:  Prion-like pr  20.7      77  0.0017   20.5   1.7   17   10-26      5-21  (30)
156 PF11045 YbjM:  Putative inner   20.7      86  0.0019   26.2   2.4   18   14-31      8-25  (125)
157 PHA02681 ORF089 virion membran  20.6      81  0.0017   25.0   2.1   27    8-38      2-28  (92)
158 PF00430 ATP-synt_B:  ATP synth  20.5 1.2E+02  0.0027   23.2   3.2    7   36-42     27-33  (132)
159 PF11845 DUF3365:  Protein of u  20.5      72  0.0016   26.1   2.0   21   18-38      2-22  (188)
160 PF05821 NDUF_B8:  NADH-ubiquin  20.3 1.2E+02  0.0027   26.3   3.4   37    1-37    106-145 (179)
161 PF11359 gpUL132:  Glycoprotein  20.3      88  0.0019   28.6   2.6    9   22-30     70-78  (235)
162 PF07019 Rab5ip:  Rab5-interact  20.2   1E+02  0.0022   22.7   2.6   18   25-42     35-52  (81)
163 PF07219 HemY_N:  HemY protein   20.2 1.3E+02  0.0028   23.2   3.2   20   15-34     19-38  (108)

No 1  
>KOG0260|consensus
Probab=99.96  E-value=7.2e-29  Score=252.69  Aligned_cols=51  Identities=45%  Similarity=0.985  Sum_probs=23.7

Q ss_pred             ecCCCcccCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q psy9982          57 TVSPAYTQVSPAYTQVSPAYTQVSPAYTQVSPAYIPVSPAYTPVSPAYTQV  107 (222)
Q Consensus        57 ~iS~~lc~~Sp~ysPtSP~ySPtSP~ysPtSP~ysPtSP~YsPtSP~ysp~  107 (222)
                      --|++|.+.||.|+|+||.|+|++|+|+|+||+|+|+||.|+|++|.|+|+
T Consensus      1447 ~ssp~~s~tsp~ysptsp~ys~tsp~~sptspsysptspsysptspsyspt 1497 (1605)
T KOG0260|consen 1447 SSSPGYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1497 (1605)
T ss_pred             CCCCCCCCCCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Confidence            355555555555555555444444444444444444444443333333333


No 2  
>KOG0260|consensus
Probab=99.95  E-value=5e-28  Score=246.59  Aligned_cols=108  Identities=42%  Similarity=0.912  Sum_probs=60.7

Q ss_pred             CcccCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCCCC
Q psy9982          61 AYTQVSPAYTQVSPAYTQVSPAYTQVSPAYIPVSPAYTPVSPAYTQVSPAYTQVSPAYTQVSPAYTQVSLAYTQVSLAYT  140 (222)
Q Consensus        61 ~lc~~Sp~ysPtSP~ySPtSP~ysPtSP~ysPtSP~YsPtSP~ysp~SP~ysPsSPsySP~SP~YSP~SP~ysP~SPsys  140 (222)
                      .|.+.||+|+|+||.|+|+||.|+|+||.|+|+||.|+|+||.|+|++|+|+|+||+|+|+||+|+|++|+|+|++|+|+
T Consensus      1472 ~~sptspsysptspsysptspsysptspsysptspsysptspsysptspsysptspsysptspsysptspsysptspsys 1551 (1605)
T KOG0260|consen 1472 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYS 1551 (1605)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Confidence            34444444444444444444444444444555555555555555555555555555555555566666666666666666


Q ss_pred             CCCCCCcCCCCCCCCCCCCCCCCCcccc
Q psy9982         141 QVSPAYTQVSPAYTQVSPAYTQVSSAYT  168 (222)
Q Consensus       141 PtSP~ysPtSP~ysPsSP~~sp~ss~~s  168 (222)
                      |+||.|+|+||.|+|++|.|+|+|+.|+
T Consensus      1552 ptspsysptsp~ysptspsysptspsys 1579 (1605)
T KOG0260|consen 1552 PTSPSYSPTSPSYSPTSPSYSPTSPSYS 1579 (1605)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCcc
Confidence            6666666666666666666666666666


No 3  
>KOG3722|consensus
Probab=99.34  E-value=2.7e-13  Score=129.00  Aligned_cols=57  Identities=33%  Similarity=0.486  Sum_probs=52.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhcccccccccccCCccccceeecCCCcccCCCCccCCC
Q psy9982          16 VEIFLLVFLLLNVLSYILIEKFKRKDLEDYLSTDEDEATVYTVSPAYTQVSPAYTQVS   73 (222)
Q Consensus        16 ~iI~lLLF~~LYi~Sy~ii~~fkk~~~~~~~~~d~~da~V~~iS~~lc~~Sp~ysPtS   73 (222)
                      .|||++||++||+.+|++|.|||||+|++ ++.||||+.|||||+|+|+|+.|-+=++
T Consensus        24 ~ii~~~l~~lLy~~sy~~isr~krk~~~~-ly~~dED~~Vyris~wl~tftlAvs~Ga   80 (538)
T KOG3722|consen   24 QIICMLLFMLLYVFSYWLISRLKRKTERE-LYAGDEDAFVYRISLWLSTFTLAVSIGA   80 (538)
T ss_pred             HHHHHHHHHHHHHHHhhhHHHHhhcCccc-cccCccceeeeeehhhHHHHHHHHHhcc
Confidence            57999999999999999999999999987 8888999999999999999998865443


No 4  
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=95.31  E-value=0.089  Score=44.06  Aligned_cols=23  Identities=13%  Similarity=0.296  Sum_probs=10.0

Q ss_pred             ccchhhHHHHHHHHHHHHHHHHH
Q psy9982          10 IGGTLTVEIFLLVFLLLNVLSYI   32 (222)
Q Consensus        10 ~~~~~~~iI~lLLF~~LYi~Sy~   32 (222)
                      +.+++..||++++|+++-|+.++
T Consensus        77 ~~~iivgvi~~Vi~Iv~~Iv~~~   99 (179)
T PF13908_consen   77 ITGIIVGVICGVIAIVVLIVCFC   99 (179)
T ss_pred             eeeeeeehhhHHHHHHHhHhhhe
Confidence            33344444444444444444443


No 5  
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=93.84  E-value=0.054  Score=44.41  Aligned_cols=33  Identities=21%  Similarity=0.398  Sum_probs=13.0

Q ss_pred             ccchhhHHHHHHHHHHHHHHHHHHHhhcccccccc
Q psy9982          10 IGGTLTVEIFLLVFLLLNVLSYILIEKFKRKDLED   44 (222)
Q Consensus        10 ~~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~~~   44 (222)
                      |.|.++++++-++.++| +|.|+| +|.|||...+
T Consensus        66 i~~Ii~gv~aGvIg~Il-li~y~i-rR~~Kk~~~~   98 (122)
T PF01102_consen   66 IIGIIFGVMAGVIGIIL-LISYCI-RRLRKKSSSD   98 (122)
T ss_dssp             HHHHHHHHHHHHHHHHH-HHHHHH-HHHS------
T ss_pred             eeehhHHHHHHHHHHHH-HHHHHH-HHHhccCCCC
Confidence            34444444444444444 455666 4455555543


No 6  
>PF01034 Syndecan:  Syndecan domain;  InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ]. Structurally, these proteins consist of four separate domains:   A signal sequence; An extracellular domain (ectodomain) of variable length whose sequence is not evolutionary conserved in the various forms of syndecans. The ectodomain contains the sites of attachment of the heparan sulphate glycosaminoglycan side chains;  A transmembrane region;  A highly conserved cytoplasmic domain of about 30 to 35 residues, which could interact with cytoskeletal proteins.    The proteins known to belong to this family are:    Syndecan 1.  Syndecan 2 or fibroglycan.  Syndecan 3 or neuroglycan or N-syndecan.  Syndecan 4 or amphiglycan or ryudocan.  Drosophila syndecan.   Caenorhabditis elegans probable syndecan (F57C7.3).    Syndecan-4, a transmembrane heparan sulphate proteoglycan, is a coreceptor with integrins in cell adhesion. It has been suggested to form a ternary signalling complex with protein kinase Calpha and phosphatidylinositol 4,5-bisphosphate (PIP2). Structural studies have demonstrated that the cytoplasmic domain undergoes a conformational transition and forms a symmetric dimer in the presence of phospholipid activator PIP2, and whose overall structure in solution exhibits a twisted clamp shape having a cavity in the centre of dimeric interface. In addition, it has been observed that the syndecan-4 variable domain interacts, strongly, not only with fatty acyl groups but also the anionic head group of PIP2. These findings indicate that PIP2 promotes oligomerisation of the syndecan-4 cytoplasmic domain for transmembrane signalling and cell-matrix adhesion [, ].; GO: 0008092 cytoskeletal protein binding, 0016020 membrane; PDB: 1EJQ_B 1EJP_B 1YBO_C 1OBY_Q.
Probab=92.77  E-value=0.038  Score=41.05  Aligned_cols=32  Identities=25%  Similarity=0.533  Sum_probs=0.9

Q ss_pred             chhhccchhhHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy9982           6 FLGLIGGTLTVEIFLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus         6 ~~~~~~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      +.|+|+|.|..++|.+|.++      ++|.|+|||+|-
T Consensus        11 laavIaG~Vvgll~ailLIl------f~iyR~rkkdEG   42 (64)
T PF01034_consen   11 LAAVIAGGVVGLLFAILLIL------FLIYRMRKKDEG   42 (64)
T ss_dssp             --------------------------------S-----
T ss_pred             HHHHHHHHHHHHHHHHHHHH------HHHHHHHhcCCC
Confidence            35788887766666555443      356688888884


No 7  
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=89.88  E-value=0.11  Score=40.72  Aligned_cols=27  Identities=19%  Similarity=0.483  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          16 VEIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        16 ~iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      .+.|+.++++||+|.|+||.|=|++..
T Consensus        68 lls~v~IlVily~IyYFVILRer~~~~   94 (101)
T PF06024_consen   68 LLSFVCILVILYAIYYFVILRERQKSI   94 (101)
T ss_pred             HHHHHHHHHHHhhheEEEEEecccccc
Confidence            345666777889999999997666554


No 8  
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=89.45  E-value=2.6  Score=35.27  Aligned_cols=31  Identities=19%  Similarity=0.260  Sum_probs=22.5

Q ss_pred             chhhccchhhHHHHHHHHHHHHHHHHHHHhh
Q psy9982           6 FLGLIGGTLTVEIFLLVFLLLNVLSYILIEK   36 (222)
Q Consensus         6 ~~~~~~~~~~~iI~lLLF~~LYi~Sy~ii~~   36 (222)
                      ..|+|+|.+..||++++.+++++.|-..+.|
T Consensus        77 ~~~iivgvi~~Vi~Iv~~Iv~~~Cc~c~~~K  107 (179)
T PF13908_consen   77 ITGIIVGVICGVIAIVVLIVCFCCCCCCLYK  107 (179)
T ss_pred             eeeeeeehhhHHHHHHHhHhhheeccccccc
Confidence            4577888777777778888888876765444


No 9  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=84.62  E-value=0.95  Score=36.32  Aligned_cols=19  Identities=26%  Similarity=0.424  Sum_probs=7.9

Q ss_pred             HHHHHHHHHHHHHHHHHhh
Q psy9982          18 IFLLVFLLLNVLSYILIEK   36 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~   36 (222)
                      |++++|+++.++++++-+|
T Consensus         7 iii~~i~l~~~~~~~~~rR   25 (130)
T PF12273_consen    7 IIIVAILLFLFLFYCHNRR   25 (130)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3334444444444444443


No 10 
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=82.96  E-value=1.2  Score=30.09  Aligned_cols=26  Identities=8%  Similarity=0.253  Sum_probs=20.9

Q ss_pred             chhhccchhhHHHHHHHHHHHHHHHH
Q psy9982           6 FLGLIGGTLTVEIFLLVFLLLNVLSY   31 (222)
Q Consensus         6 ~~~~~~~~~~~iI~lLLF~~LYi~Sy   31 (222)
                      ..|.|+|.+..++.+.|.+++|+++|
T Consensus         5 ~IaIIv~V~vg~~iiii~~~~YaCcy   30 (38)
T PF02439_consen    5 TIAIIVAVVVGMAIIIICMFYYACCY   30 (38)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35778888888888888888888887


No 11 
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=75.98  E-value=3.4  Score=30.08  Aligned_cols=34  Identities=26%  Similarity=0.532  Sum_probs=22.9

Q ss_pred             hhccchhhHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982           8 GLIGGTLTVEIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus         8 ~~~~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      -++|-.+..++.+||.+++.+++++ +.++++++.
T Consensus         8 ~i~Gm~iVF~~L~lL~~~i~l~~~~-~~~~~~~~~   41 (79)
T PF04277_consen    8 MIIGMGIVFLVLILLILVISLMSKL-IRKFAPKEK   41 (79)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH-HHhhccccc
Confidence            4566666666667777888888888 556655554


No 12 
>PF04791 LMBR1:  LMBR1-like membrane protein;  InterPro: IPR006876 This group of uncharacterised proteins have a conserved C-terminal region which is found in LMBR1 and in the lipocalin-1 receptor. LMBR1 was thought to play a role in preaxial polydactyly, but recent evidence now suggests this not to be the case [].
Probab=73.95  E-value=2.3  Score=40.10  Aligned_cols=26  Identities=19%  Similarity=0.612  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHHHHHHHHhhccccccc
Q psy9982          18 IFLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      ||+++|++|+++++.+|.+|.++++.
T Consensus         1 i~~~~~~~l~~~~~~~l~~y~~~~~~   26 (471)
T PF04791_consen    1 ILIVLFIILLLIAIYLLRRYQHPDDS   26 (471)
T ss_pred             ChHHHHHHHHHHHHHHHHHhcCchhc
Confidence            79999999999999999999988875


No 13 
>PHA02849 putative transmembrane protein; Provisional
Probab=73.54  E-value=3.1  Score=32.36  Aligned_cols=17  Identities=29%  Similarity=0.663  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy9982          18 IFLLVFLLLNVLSYILI   34 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii   34 (222)
                      ||+++|++||++=...|
T Consensus        27 I~i~~flLlyLvkws~v   43 (82)
T PHA02849         27 ISFLAFMLLYLIKWSYV   43 (82)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            89999999998755443


No 14 
>PF11368 DUF3169:  Protein of unknown function (DUF3169);  InterPro: IPR021509  Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently there is no known function. 
Probab=71.91  E-value=2.2  Score=37.57  Aligned_cols=27  Identities=26%  Similarity=0.402  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          16 VEIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        16 ~iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      ..||+++++++.++....+.+-||...
T Consensus        51 ~~i~~~~~~i~~~~~~~~~~~~~k~~~   77 (248)
T PF11368_consen   51 SFIALLIIIILFLLTFYFIYKSRKYKK   77 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            447777888888777777765555443


No 15 
>PF07466 DUF1517:  Protein of unknown function (DUF1517);  InterPro: IPR010903 This family consists of several hypothetical glycine rich plant and bacterial proteins of around 300 residues in length. The function of this family is unknown.
Probab=70.92  E-value=8  Score=35.70  Aligned_cols=44  Identities=7%  Similarity=0.039  Sum_probs=24.5

Q ss_pred             HHHHHHHHHHHHHHHHhhcccccccccccCCccccceeecCCCc
Q psy9982          19 FLLVFLLLNVLSYILIEKFKRKDLEDYLSTDEDEATVYTVSPAY   62 (222)
Q Consensus        19 ~lLLF~~LYi~Sy~ii~~fkk~~~~~~~~~d~~da~V~~iS~~l   62 (222)
                      +||||++.+++-.++-...+++........+.+.++|-++-.+|
T Consensus        70 iLIl~~Ia~~vv~~~r~~~~~~~~~~~~~~~~~~vsV~klQv~L  113 (289)
T PF07466_consen   70 ILILFGIAFFVVRFFRRRRSGSQGSYGRGASNPKVSVVKLQVGL  113 (289)
T ss_pred             HHHHHHHHHHHHHHHHhhcccccccccccccCCceEEEEeeehh
Confidence            34445555555444444444333333334577789999887765


No 16 
>PRK10263 DNA translocase FtsK; Provisional
Probab=70.89  E-value=3.1  Score=45.83  Aligned_cols=17  Identities=24%  Similarity=0.315  Sum_probs=8.9

Q ss_pred             chhhccchhhHHHHHHH
Q psy9982           6 FLGLIGGTLTVEIFLLV   22 (222)
Q Consensus         6 ~~~~~~~~~~~iI~lLL   22 (222)
                      ++|.+|++|..++++|+
T Consensus       157 LfG~vGa~LILLlllLI  173 (1355)
T PRK10263        157 LLHSSGGTIALLCVWAA  173 (1355)
T ss_pred             HHhHHHHHHHHHHHHHH
Confidence            45666666555543333


No 17 
>TIGR03546 conserved hypothetical protein TIGR03546. Members of this family are uncharacterized proteins, usually encoded by a gene adjacent to a member of family TIGR03545, which is also uncharacterized.
Probab=70.22  E-value=3  Score=35.33  Aligned_cols=25  Identities=16%  Similarity=0.360  Sum_probs=20.2

Q ss_pred             HHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          18 IFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      +-+++.++-|.+|+.+|++||||--
T Consensus       116 ~Gli~~~~~Y~ls~~lI~~Yr~~~~  140 (154)
T TIGR03546       116 VGLILLPPAFAISKVIIAKYRKRIV  140 (154)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4556677889999999999998754


No 18 
>PF06143 Baculo_11_kDa:  Baculovirus 11 kDa family;  InterPro: IPR009313 This is a family of uncharacterised Baculovirus proteins that are all about 11 kDa in size.
Probab=69.53  E-value=3.6  Score=32.10  Aligned_cols=28  Identities=32%  Similarity=0.399  Sum_probs=20.6

Q ss_pred             CccchhhccchhhHHHHHHHHHHHHHHH
Q psy9982           3 TPDFLGLIGGTLTVEIFLLVFLLLNVLS   30 (222)
Q Consensus         3 ~~~~~~~~~~~~~~iI~lLLF~~LYi~S   30 (222)
                      --||+=.|.|.+..+||+|.+++||.+.
T Consensus        33 irdFvLVic~~lVfVii~lFi~ll~~i~   60 (84)
T PF06143_consen   33 IRDFVLVICCFLVFVIIVLFILLLYNIN   60 (84)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3477778888888888887777776543


No 19 
>KOG4433|consensus
Probab=69.48  E-value=6.4  Score=39.40  Aligned_cols=30  Identities=27%  Similarity=0.337  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHhhcccccccccccCCccc
Q psy9982          20 LLVFLLLNVLSYILIEKFKRKDLEDYLSTDEDE   52 (222)
Q Consensus        20 lLLF~~LYi~Sy~ii~~fkk~~~~~~~~~d~~d   52 (222)
                      ++||++|++.++..+ +|+|+.|  |.++||||
T Consensus       398 ~~lsilv~~~~haW~-~f~~r~d--y~dvdEda  427 (526)
T KOG4433|consen  398 LALSILVCSDPHAWI-YFTKRND--YDDVDEDA  427 (526)
T ss_pred             HHHHHHHhccchhhh-hccCCcc--ccccccCC
Confidence            445556666666655 4666633  23455554


No 20 
>PF10857 DUF2701:  Protein of unknown function (DUF2701);  InterPro: IPR022586  This entry represents viral proteins with unknown function. The entry contains ORF C51 from Swinepox virus (strain Kasza). 
Probab=68.83  E-value=4.5  Score=30.10  Aligned_cols=20  Identities=30%  Similarity=0.622  Sum_probs=15.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHH
Q psy9982          15 TVEIFLLVFLLLNVLSYILI   34 (222)
Q Consensus        15 ~~iI~lLLF~~LYi~Sy~ii   34 (222)
                      ..+||+++|++||++=...|
T Consensus         5 ~vvi~i~~~lllyLvkws~v   24 (63)
T PF10857_consen    5 VVVIVILAYLLLYLVKWSYV   24 (63)
T ss_pred             eeHHHHHHHHHHHHHHHHHH
Confidence            34699999999998755443


No 21 
>PF06679 DUF1180:  Protein of unknown function (DUF1180);  InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown.
Probab=68.70  E-value=8  Score=33.27  Aligned_cols=11  Identities=18%  Similarity=0.724  Sum_probs=7.2

Q ss_pred             CccccceeecC
Q psy9982          49 DEDEATVYTVS   59 (222)
Q Consensus        49 d~~da~V~~iS   59 (222)
                      ||||-||+.+.
T Consensus       149 edeD~TvFd~~  159 (163)
T PF06679_consen  149 EDEDSTVFDAN  159 (163)
T ss_pred             cccccceeeec
Confidence            44577888763


No 22 
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=67.61  E-value=3.7  Score=33.20  Aligned_cols=23  Identities=17%  Similarity=0.176  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          17 EIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      +.++++|+++|   |+++++.||+..
T Consensus         8 l~lv~i~~i~y---F~~iRPQkKr~K   30 (109)
T PRK05886          8 LPFLLIMGGFM---YFASRRQRKAMQ   30 (109)
T ss_pred             HHHHHHHHHHH---HHHccHHHHHHH
Confidence            34444555544   677888777653


No 23 
>PHA02902 putative IMV membrane protein; Provisional
Probab=65.27  E-value=8.5  Score=29.06  Aligned_cols=24  Identities=13%  Similarity=0.477  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHHhhcccccc
Q psy9982          19 FLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        19 ~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      |++|-+|+-|+||+|+.-|||-+.
T Consensus         6 fvi~~v~v~Ivclliya~YrR~kc   29 (70)
T PHA02902          6 FVILAVIVIIFCLLIYAAYKRYKC   29 (70)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcC
Confidence            455667778888899888888754


No 24 
>COG1930 CbiN ABC-type cobalt transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=65.08  E-value=12  Score=30.05  Aligned_cols=40  Identities=18%  Similarity=0.337  Sum_probs=23.8

Q ss_pred             HHHhhcccccccccccCCcc-ccceeecCCCccc-CCCCccCCC
Q psy9982          32 ILIEKFKRKDLEDYLSTDED-EATVYTVSPAYTQ-VSPAYTQVS   73 (222)
Q Consensus        32 ~ii~~fkk~~~~~~~~~d~~-da~V~~iS~~lc~-~Sp~ysPtS   73 (222)
                      +|+--|.+..++.  ..|++ +..+.+|.+.|.+ |.|-|+|.|
T Consensus        20 li~~~~~~~ge~g--GaD~~Ae~~I~ei~p~YePWF~Pl~EPpS   61 (97)
T COG1930          20 LIPFSFVTDGEFG--GADGEAEEVITEIKPGYEPWFQPLWEPPS   61 (97)
T ss_pred             HHHheeccccccc--CCcchhhHHHHHhCCCCCcccccccCCCC
Confidence            3444444444442  23444 7788889888877 666676654


No 25 
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=59.15  E-value=5.1  Score=32.54  Aligned_cols=20  Identities=15%  Similarity=0.406  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHhhccccc
Q psy9982          22 VFLLLNVLSYILIEKFKRKD   41 (222)
Q Consensus        22 LF~~LYi~Sy~ii~~fkk~~   41 (222)
                      +|++++++-|++|+..|||.
T Consensus         8 ~~vv~~~i~yf~iRPQkKr~   27 (113)
T PRK06531          8 MFVVMLGLIFFMQRQQKKQA   27 (113)
T ss_pred             HHHHHHHHHHheechHHHHH
Confidence            33444444467788888765


No 26 
>PF13073 DUF3937:  Protein of unknown function (DUF3937)
Probab=59.13  E-value=12  Score=28.31  Aligned_cols=32  Identities=31%  Similarity=0.308  Sum_probs=19.8

Q ss_pred             CCCccchhhccchhhHHHHHHHHHHHHHHHHH
Q psy9982           1 MFTPDFLGLIGGTLTVEIFLLVFLLLNVLSYI   32 (222)
Q Consensus         1 ~~~~~~~~~~~~~~~~iI~lLLF~~LYi~Sy~   32 (222)
                      ||+-.-|--+|-+++.+.+++=|.+=|+=.|+
T Consensus         1 mf~nkklir~gltlfv~L~vi~FtigYfq~Yl   32 (73)
T PF13073_consen    1 MFTNKKLIRFGLTLFVFLSVIDFTIGYFQTYL   32 (73)
T ss_pred             CCccchhhhhhhHHHHHHHHHHhhHHHHHHHH
Confidence            66666665566666666666666666655554


No 27 
>PF09451 ATG27:  Autophagy-related protein 27;  InterPro: IPR018939 Autophagy is a degradative transport pathway that delivers cytosolic proteins to the lysosome (vacuole) [] and is induced by starvation []. Cytosolic proteins appear inside the vacuole enclosed in autophagic vesicles. Autophagy significantly differs from other transport pathways by using double membrane layered transport intermediates, called autophagosomes [, ]. The breakdown of vesicular transport intermediates is a unique feature of autophagy []. Autophagy can also function in the elimination of invading bacteria and antigens []. There are more than 25 AuTophaGy-related (ATG) genes that are essential for autophagy, although it is still not known how the autophagosome is made. Atg9 is a potential membrane carrier to deliver lipids that are used to form the vesicle. Atg27 is another transmembrane protein, and is a cycling protein []. It acts as an effector of VPS34 phosphatidylinositol 3-phosphate kinase signalling and regulates the cytoplasm to vacuole transport (Cvt) vesicle formation. It is also required for autophagy-dependent cycling of ATG9. 
Probab=58.49  E-value=8.4  Score=34.57  Aligned_cols=26  Identities=15%  Similarity=0.050  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          17 EIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      +|.+|||+++|++--.++.++|+..+
T Consensus       207 ~i~~~l~~~~Y~i~g~~~n~~~~g~~  232 (268)
T PF09451_consen  207 FIILFLFLAAYLIFGSWYNYNRYGAR  232 (268)
T ss_pred             HHHHHHHHHHHhhhhhheeeccCCCC
Confidence            35566677888888888887776554


No 28 
>PF11857 DUF3377:  Domain of unknown function (DUF3377);  InterPro: IPR021805  This domain is functionally uncharacterised and found at the C terminus of peptidases belonging to MEROPS peptidase family M10A, membrane-type matrix metallopeptidases (clan MA). ; GO: 0004222 metalloendopeptidase activity
Probab=58.18  E-value=6.5  Score=30.09  Aligned_cols=28  Identities=39%  Similarity=0.607  Sum_probs=22.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          14 LTVEIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        14 ~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      +..+|=++|-+|+-++-|+|+. |||+..
T Consensus        32 vaVviPl~L~LCiLvl~yai~~-fkrkGt   59 (74)
T PF11857_consen   32 VAVVIPLVLLLCILVLIYAIFQ-FKRKGT   59 (74)
T ss_pred             EEEeHHHHHHHHHHHHHHHhhe-eeecCC
Confidence            4455777788889999999998 888875


No 29 
>PF15102 TMEM154:  TMEM154 protein family
Probab=57.61  E-value=5.9  Score=33.74  Aligned_cols=27  Identities=30%  Similarity=0.352  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHHHHHHHHHhhccccccc
Q psy9982          17 EIFLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      +|=++|+++|.++--++|.++|||...
T Consensus        62 lIP~VLLvlLLl~vV~lv~~~kRkr~K   88 (146)
T PF15102_consen   62 LIPLVLLVLLLLSVVCLVIYYKRKRTK   88 (146)
T ss_pred             eHHHHHHHHHHHHHHHheeEEeecccC
Confidence            355555555555555666666666553


No 30 
>TIGR01165 cbiN cobalt transport protein. This model describes the cobalt transporter in bacteria and its equivalents in archaea. It principally functions in the ion uptake mechanism. It is a multisubunit transporter with two integral membrane proteins and two closely associated cytoplasmic subunits. This transporter belongs to the ABC transporter superfamily (ATP stands for ATP Binding Cassette). This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=55.89  E-value=16  Score=28.94  Aligned_cols=54  Identities=19%  Similarity=0.279  Sum_probs=25.0

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcccccccccccCCcc-ccceeecCCCccc-CCCCccCC
Q psy9982          17 EIFLLVFLLLNVLSYILIEKFKRKDLEDYLSTDED-EATVYTVSPAYTQ-VSPAYTQV   72 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~~fkk~~~~~~~~~d~~-da~V~~iS~~lc~-~Sp~ysPt   72 (222)
                      +|.+|+-++|-++-.+++..-.+..++.  ..||. ...+.+|.+.|.+ |+|-++|.
T Consensus         7 ~~ll~~v~~l~~~pl~~~~~~~~~~efg--GaD~~A~~~I~ei~p~Y~PWf~PlwEPp   62 (91)
T TIGR01165         7 IWLLAAVAALVVLPLLIYAGKGEEEEYG--GADGQAEEVIEEIGPDYKPWFSPLWEPP   62 (91)
T ss_pred             HHHHHHHHHHHHHHHHhccCCCcccccc--CcchHHHHHHHHhCCCCcccccccccCC
Confidence            4444444444444444444322223442  23433 5566667766665 34555553


No 31 
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=55.62  E-value=14  Score=25.10  Aligned_cols=9  Identities=22%  Similarity=0.515  Sum_probs=3.4

Q ss_pred             HHHHHHHHH
Q psy9982          18 IFLLVFLLL   26 (222)
Q Consensus        18 I~lLLF~~L   26 (222)
                      |.+|+|+++
T Consensus        13 ~~~v~~~~~   21 (49)
T PF05545_consen   13 IGTVLFFVF   21 (49)
T ss_pred             HHHHHHHHH
Confidence            333333333


No 32 
>PF02553 CbiN:  Cobalt transport protein component CbiN;  InterPro: IPR003705 The cobalt transport protein CbiN is part of the active cobalt transport system involved in uptake of cobalt in to the cell involved with cobalamin biosynthesis (vitamin B12). It has been suggested that CbiN may function as the periplasmic binding protein component of the active cobalt transport system [].; GO: 0015087 cobalt ion transmembrane transporter activity, 0006824 cobalt ion transport, 0009236 cobalamin biosynthetic process, 0016020 membrane
Probab=55.58  E-value=12  Score=28.50  Aligned_cols=51  Identities=22%  Similarity=0.412  Sum_probs=23.3

Q ss_pred             HHHHHHHHHHHHHHHhhccccccccccc-CCcc-ccceeecCCCccc-CCCCccCC
Q psy9982          20 LLVFLLLNVLSYILIEKFKRKDLEDYLS-TDED-EATVYTVSPAYTQ-VSPAYTQV   72 (222)
Q Consensus        20 lLLF~~LYi~Sy~ii~~fkk~~~~~~~~-~d~~-da~V~~iS~~lc~-~Sp~ysPt   72 (222)
                      +++-++|-++..++....-+++++  +. .|+. ...+.+|.+.|.+ |.|-++|.
T Consensus         7 ~~~vv~l~~~pl~~~~~~~~~~~~--~GGaD~~A~~~I~~~~p~Y~PWf~plwePp   60 (74)
T PF02553_consen    7 LLLVVALAVVPLFLYPSSGNDAEE--FGGADDQAEEMIEEIDPDYEPWFEPLWEPP   60 (74)
T ss_pred             HHHHHHHHHHHHHHhccccccccc--ccCccHHHHHHHHHhCCCCCccccccccCC
Confidence            333333444444443333444443  23 3333 4455667766665 44445543


No 33 
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=55.50  E-value=9.1  Score=25.94  Aligned_cols=14  Identities=14%  Similarity=0.332  Sum_probs=5.4

Q ss_pred             chhhHHHHHHHHHH
Q psy9982          12 GTLTVEIFLLVFLL   25 (222)
Q Consensus        12 ~~~~~iI~lLLF~~   25 (222)
                      |.+..+||+++|+|
T Consensus        15 g~~iiii~~~~YaC   28 (38)
T PF02439_consen   15 GMAIIIICMFYYAC   28 (38)
T ss_pred             HHHHHHHHHHHHHH
Confidence            33333333333333


No 34 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=55.35  E-value=19  Score=28.28  Aligned_cols=19  Identities=16%  Similarity=0.128  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHHHHHHHHh
Q psy9982          17 EIFLLVFLLLNVLSYILIE   35 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~   35 (222)
                      +++.|||++|.+||-.+-.
T Consensus         7 llL~l~LA~lLlisSevaa   25 (95)
T PF07172_consen    7 LLLGLLLAALLLISSEVAA   25 (95)
T ss_pred             HHHHHHHHHHHHHHhhhhh
Confidence            3444455555555554443


No 35 
>PF05151 PsbM:  Photosystem II reaction centre M protein (PsbM);  InterPro: IPR007826 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbM found in PSII. PsbM is one of the most hydrophobic proteins in the thylakoid membrane. The function of this protein is unknown.; GO: 0015979 photosynthesis, 0019684 photosynthesis, light reaction, 0009523 photosystem II, 0016021 integral to membrane; PDB: 3A0H_m 3ARC_m 3A0B_M 3PRR_M 3PRQ_M 1S5L_M 4FBY_e 3BZ2_M 3BZ1_M 2AXT_M ....
Probab=54.27  E-value=12  Score=24.42  Aligned_cols=24  Identities=25%  Similarity=0.379  Sum_probs=19.2

Q ss_pred             cchhhccchhhHHHHHHHHHHHHH
Q psy9982           5 DFLGLIGGTLTVEIFLLVFLLLNV   28 (222)
Q Consensus         5 ~~~~~~~~~~~~iI~lLLF~~LYi   28 (222)
                      ..+|+|...++..|.....++||+
T Consensus         4 n~l~fiAtaLfi~iPt~FLiilyv   27 (31)
T PF05151_consen    4 NILAFIATALFILIPTAFLIILYV   27 (31)
T ss_dssp             -TTHHHHHHHHHHHHHHHHHHHHH
T ss_pred             chhhHHHHHHHHHHHHHHHhheEe
Confidence            357888888888888888888887


No 36 
>PF14150 YesK:  YesK-like protein
Probab=53.54  E-value=16  Score=28.20  Aligned_cols=26  Identities=19%  Similarity=0.395  Sum_probs=23.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhccccc
Q psy9982          16 VEIFLLVFLLLNVLSYILIEKFKRKD   41 (222)
Q Consensus        16 ~iI~lLLF~~LYi~Sy~ii~~fkk~~   41 (222)
                      .++|...|++++.+|+++=+||++|.
T Consensus         2 ~llg~~~~ii~f~~S~~lr~r~p~k~   27 (81)
T PF14150_consen    2 YLLGIVTFIIVFGVSVLLRKRFPKKQ   27 (81)
T ss_pred             cHHHHHHHHHHHHHHHHHHHhCCCcc
Confidence            46788889999999999999999887


No 37 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=53.42  E-value=8.8  Score=30.72  Aligned_cols=26  Identities=8%  Similarity=0.377  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHHHHHhhccccccc
Q psy9982          18 IFLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      |++||.+++.|+-.+++.+=|||.+.
T Consensus         4 l~~iii~~i~l~~~~~~~~~rRR~r~   29 (130)
T PF12273_consen    4 LFAIIIVAILLFLFLFYCHNRRRRRR   29 (130)
T ss_pred             eHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            45555555555555555555665554


No 38 
>PRK10633 hypothetical protein; Provisional
Probab=52.68  E-value=19  Score=27.74  Aligned_cols=22  Identities=27%  Similarity=0.464  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHHhhccc
Q psy9982          18 IFLLVFLLLNVLSYILIEKFKR   39 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~fkk   39 (222)
                      =|++++++.-++++++|+.+=|
T Consensus        49 sCi~~p~lfi~l~~~~Vk~vFk   70 (80)
T PRK10633         49 ACLLLPLLFILLCWLMVKFIFR   70 (80)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhc
Confidence            5667777777888999976554


No 39 
>PF06129 Chordopox_G3:  Chordopoxvirus G3 protein;  InterPro: IPR010367 This family consists of several poxvirus specific G3 proteins. The function of this family is unknown.
Probab=51.65  E-value=14  Score=30.14  Aligned_cols=20  Identities=35%  Similarity=0.640  Sum_probs=13.4

Q ss_pred             hhhHHHHHHHHHHH-HHHHHH
Q psy9982          13 TLTVEIFLLVFLLL-NVLSYI   32 (222)
Q Consensus        13 ~~~~iI~lLLF~~L-Yi~Sy~   32 (222)
                      ++.++|++++|+|+ |.+.|.
T Consensus         2 ~ll~l~ffi~Fl~~~Y~~~y~   22 (109)
T PF06129_consen    2 WLLYLIFFILFLVLCYFFNYY   22 (109)
T ss_pred             cHHHHHHHHHHHHHHHHHhhc
Confidence            35667777777776 666653


No 40 
>KOG4841|consensus
Probab=51.08  E-value=8.6  Score=30.55  Aligned_cols=33  Identities=30%  Similarity=0.203  Sum_probs=25.6

Q ss_pred             HHHHHHHHHHHHHhhcccccccccccCCccccceeec
Q psy9982          22 VFLLLNVLSYILIEKFKRKDLEDYLSTDEDEATVYTV   58 (222)
Q Consensus        22 LF~~LYi~Sy~ii~~fkk~~~~~~~~~d~~da~V~~i   58 (222)
                      +|.+|..-||++++---+-+.+    .|++||.|+-+
T Consensus        46 ~~~~l~~G~Ya~~tv~Y~VATf----nDc~eA~veL~   78 (95)
T KOG4841|consen   46 LYLLLSAGCYALGTVGYRVATF----NDCEEAAVELQ   78 (95)
T ss_pred             HHHHHHHHhHhhhhheeeeecc----CCcHHHHHHHH
Confidence            5788889999999877666664    48999988643


No 41 
>PF06422 PDR_CDR:  CDR ABC transporter;  InterPro: IPR010929 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). In yeast, the PDR and CDR ABC transporters display extensive sequence homology, and confer resistance to several anti-fungal compounds by actively transporting their substrates out of the cell. These transporters have two homologous halves, each with an N-terminal intracellular hydrophilic region that contains an ATP-binding site, followed by a C-terminal membrane-associated region containing six transmembrane segments []. This entry represents a domain of the PDR/CDR ABC transporter comprising extracellular loop 3, transmembrane segment 6 and a linker region.; GO: 0005524 ATP binding, 0042626 ATPase activity, coupled to transmembrane movement of substances, 0006810 transport, 0016021 integral to membrane
Probab=50.91  E-value=19  Score=28.10  Aligned_cols=25  Identities=16%  Similarity=0.301  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHHHhhccccc
Q psy9982          17 EIFLLVFLLLNVLSYILIEKFKRKD   41 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~~fkk~~   41 (222)
                      +..++.|+++|++.++|+..|.+..
T Consensus        52 ~GIli~f~i~f~~~~~~~~e~~~~~   76 (103)
T PF06422_consen   52 FGILIAFWIFFIVLTLLATEFIKFE   76 (103)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhccc
Confidence            3455666666666666666554443


No 42 
>PHA02681 ORF089 virion membrane protein; Provisional
Probab=50.58  E-value=13  Score=29.32  Aligned_cols=21  Identities=24%  Similarity=0.651  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHhhccccc
Q psy9982          21 LVFLLLNVLSYILIEKFKRKD   41 (222)
Q Consensus        21 LLF~~LYi~Sy~ii~~fkk~~   41 (222)
                      |+-+|+-|+||+|+.-|||-.
T Consensus         8 ~~~V~V~IVclliya~YRR~~   28 (92)
T PHA02681          8 LTVIVISIVCYIVIMMYRRSC   28 (92)
T ss_pred             HHHHHHHHHHHHHHHHHHhcc
Confidence            335566778888888887753


No 43 
>PHA03030 hypothetical protein; Provisional
Probab=48.83  E-value=12  Score=30.67  Aligned_cols=27  Identities=26%  Similarity=0.583  Sum_probs=19.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhcccc
Q psy9982          14 LTVEIFLLVFLLLNVLSYILIEKFKRK   40 (222)
Q Consensus        14 ~~~iI~lLLF~~LYi~Sy~ii~~fkk~   40 (222)
                      +.|||.+|+|+.++++-|+-|+.-||.
T Consensus         1 lnci~~ili~lfifl~iffYI~~IkRD   27 (122)
T PHA03030          1 LNCIFLILIFLFIFLFIFFYIRIIKRD   27 (122)
T ss_pred             CceehHHHHHHHHHHHHHHHheeeecc
Confidence            356777777777777778878776654


No 44 
>PHA02657 hypothetical protein; Provisional
Probab=47.68  E-value=22  Score=28.30  Aligned_cols=17  Identities=24%  Similarity=0.788  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy9982          18 IFLLVFLLLNVLSYILI   34 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii   34 (222)
                      ||+|.|++||++=...|
T Consensus        37 I~il~flLLYLvkWS~V   53 (95)
T PHA02657         37 VCILIYLLIYLVDWSLV   53 (95)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            99999999998855443


No 45 
>PF10873 DUF2668:  Protein of unknown function (DUF2668);  InterPro: IPR022640  Members in this family of proteins are annotated as cysteine and tyrosine-rich protein 1, however currently no function is known []. 
Probab=47.47  E-value=92  Score=26.90  Aligned_cols=10  Identities=20%  Similarity=0.172  Sum_probs=6.2

Q ss_pred             ccccceeecC
Q psy9982          50 EDEATVYTVS   59 (222)
Q Consensus        50 ~~da~V~~iS   59 (222)
                      ..++-.+.|+
T Consensus        99 ~~tt~in~v~  108 (155)
T PF10873_consen   99 IRTTHINAVS  108 (155)
T ss_pred             eecccccccc
Confidence            4566666666


No 46 
>COG1862 YajC Preprotein translocase subunit YajC [Intracellular trafficking and secretion]
Probab=45.95  E-value=13  Score=29.48  Aligned_cols=22  Identities=14%  Similarity=0.492  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          18 IFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      +++|+|++.|   |+|++..||+..
T Consensus        14 ~~vl~~~ify---Fli~RPQrKr~K   35 (97)
T COG1862          14 PLVLIFAIFY---FLIIRPQRKRMK   35 (97)
T ss_pred             HHHHHHHHHH---HhhcCHHHHHHH
Confidence            4444444444   347777777653


No 47 
>PF12270 Cyt_c_ox_IV:  Cytochrome c oxidase subunit IV;  InterPro: IPR021050  This family of proteins is found in bacteria. Proteins in this family are approximately 140 amino acids in length. This family is the fourth subunit of the cytochrome c oxidase complex. This subunit does not have a catalytic capacity but instead, is required for assembly and/or stability of the complex []. ; GO: 0004129 cytochrome-c oxidase activity, 0055114 oxidation-reduction process, 0016021 integral to membrane
Probab=45.42  E-value=36  Score=28.70  Aligned_cols=41  Identities=20%  Similarity=0.198  Sum_probs=27.4

Q ss_pred             HHHHHHHHHHHHhhcccccccccccCCccccceeecCCCcccCCC
Q psy9982          23 FLLLNVLSYILIEKFKRKDLEDYLSTDEDEATVYTVSPAYTQVSP   67 (222)
Q Consensus        23 F~~LYi~Sy~ii~~fkk~~~~~~~~~d~~da~V~~iS~~lc~~Sp   67 (222)
                      .+++-|--|+-++. ||.+..   -.|++|+.|...+-.+.-|||
T Consensus        46 ~l~~mig~yl~~~~-rr~~~r---PED~~daEI~dgAGe~GfFsP   86 (137)
T PF12270_consen   46 GLALMIGFYLRFTA-RRIGPR---PEDREDAEIADGAGELGFFSP   86 (137)
T ss_pred             HHHHHHHHHHHHHH-hhCCCC---CccccccccccCCCCcCcCCC
Confidence            34445555665553 443332   457889999999999988887


No 48 
>PRK14472 F0F1 ATP synthase subunit B; Provisional
Probab=44.94  E-value=26  Score=29.29  Aligned_cols=13  Identities=38%  Similarity=0.585  Sum_probs=6.0

Q ss_pred             CCCccchhhccch
Q psy9982           1 MFTPDFLGLIGGT   13 (222)
Q Consensus         1 ~~~~~~~~~~~~~   13 (222)
                      |.|-..+-+.||.
T Consensus         1 ~~~~~~~~~~~~~   13 (175)
T PRK14472          1 MLTSGIILLSGGL   13 (175)
T ss_pred             CccchhhhhcCCc
Confidence            4444444444554


No 49 
>PF15339 Afaf:  Acrosome formation-associated factor
Probab=44.55  E-value=19  Score=31.99  Aligned_cols=27  Identities=19%  Similarity=0.307  Sum_probs=22.0

Q ss_pred             HHHHHHHHHHHHHHHHHHhhccccccc
Q psy9982          17 EIFLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      +.-||||++|-++|.+.+.+.|+-...
T Consensus       138 LmTl~lfv~Ll~~c~atlyklk~l~~k  164 (200)
T PF15339_consen  138 LMTLFLFVILLAFCSATLYKLKHLSYK  164 (200)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhccc
Confidence            356789999999999999988876654


No 50 
>PF05434 Tmemb_9:  TMEM9;  InterPro: IPR008853 This family contains several eukaryotic transmembrane proteins which are homologous to Homo sapiens transmembrane protein 9 Q9P0T7 from SWISSPROT. The TMEM9 gene encodes a 183 amino-acid protein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites and three conserved cys-rich domains in the N terminus, but no known functional domains. The protein is highly conserved between species from Caenorhabditis elegans to H. sapiens and belongs to a novel family of transmembrane proteins. The exact function of TMEM9 is unknown although it has been found to be widely expressed and localised to the late endosomes and lysosomes []. Members of this family contain CXCXC repeats IPR004153 from INTERPRO in their N-terminal region.; GO: 0016021 integral to membrane
Probab=44.41  E-value=18  Score=30.93  Aligned_cols=27  Identities=15%  Similarity=0.301  Sum_probs=15.4

Q ss_pred             hhccchhhHHHHHHHHHHHHHHHHHHH
Q psy9982           8 GLIGGTLTVEIFLLVFLLLNVLSYILI   34 (222)
Q Consensus         8 ~~~~~~~~~iI~lLLF~~LYi~Sy~ii   34 (222)
                      ++|-.+|..+|++|--++|||+=-.++
T Consensus        52 ~tikVvVIivl~Vi~lLvlYM~fL~~l   78 (149)
T PF05434_consen   52 TTIKVVVIIVLWVIGLLVLYMLFLMCL   78 (149)
T ss_pred             eEEEEEEEEeHHHHHHHHHHHHHHHHH
Confidence            455566666666666666666544344


No 51 
>PF08135 EPV_E5:  Major transforming protein E5 family;  InterPro: IPR012555 This family consists of the major transforming proteins (E5) of the bovine papilloma virus (BPV). The equine sarcoid is one of the most common dermatological lesion in equids. It is a benign, locally invasive dermal fibroblastic lesion and studies have shown an association of the lesions with BPV. E5 is a short hydrophobic membrane protein localising to the Golgi apparatus and other intracellular membranes. It binds to and constitutively activates the platelet-derived growth factor-beta in transformed cells. This stimulation activates a receptor signalling cascade which results in an intracellular growth stimulatory signal [].
Probab=42.83  E-value=35  Score=23.78  Aligned_cols=28  Identities=39%  Similarity=0.673  Sum_probs=18.2

Q ss_pred             cchhhccchhhHHHHHHHHHHHHHHHHH
Q psy9982           5 DFLGLIGGTLTVEIFLLVFLLLNVLSYI   32 (222)
Q Consensus         5 ~~~~~~~~~~~~iI~lLLF~~LYi~Sy~   32 (222)
                      .++-..|-+......+|+|++++.+-|+
T Consensus         5 glllflgl~~~lQL~LL~FlL~fFLV~W   32 (44)
T PF08135_consen    5 GLLLFLGLTFALQLLLLVFLLFFFLVYW   32 (44)
T ss_pred             eeHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444455556666778888877777665


No 52 
>COG1766 fliF Flagellar basal body M-ring protein [Cell motility and secretion]
Probab=42.82  E-value=25  Score=35.40  Aligned_cols=30  Identities=30%  Similarity=0.551  Sum_probs=25.2

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhcccccccc
Q psy9982          15 TVEIFLLVFLLLNVLSYILIEKFKRKDLED   44 (222)
Q Consensus        15 ~~iI~lLLF~~LYi~Sy~ii~~fkk~~~~~   44 (222)
                      -..+.+|.|++|+++.+-|++++++|..++
T Consensus       447 ~~~~~l~~~lv~~~~~r~~i~~~~~~~~e~  476 (545)
T COG1766         447 PVALYLVVFLVLFIIVRPVIRPRRRRGAEA  476 (545)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcccchh
Confidence            345778889999999999999999998753


No 53 
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=42.66  E-value=24  Score=32.06  Aligned_cols=13  Identities=31%  Similarity=0.386  Sum_probs=6.6

Q ss_pred             hhhHHHHHHHHHH
Q psy9982          13 TLTVEIFLLVFLL   25 (222)
Q Consensus        13 ~~~~iI~lLLF~~   25 (222)
                      .|-.+||.|||+.
T Consensus       138 AVLfLICT~LfLS  150 (227)
T PF05399_consen  138 AVLFLICTLLFLS  150 (227)
T ss_pred             HHHHHHHHHHHHH
Confidence            3444555555543


No 54 
>PF11119 DUF2633:  Protein of unknown function (DUF2633);  InterPro: IPR022576  This family is conserved largely in Proteobacteria. Several members are named as YfgG. The function is not known. 
Probab=42.63  E-value=23  Score=26.11  Aligned_cols=30  Identities=23%  Similarity=0.349  Sum_probs=21.6

Q ss_pred             hhhHHHHHHHHHHHHH-HHHHHHhhcccccc
Q psy9982          13 TLTVEIFLLVFLLLNV-LSYILIEKFKRKDL   42 (222)
Q Consensus        13 ~~~~iI~lLLF~~LYi-~Sy~ii~~fkk~~~   42 (222)
                      .++-||.|+-|++|+. ++|..|.-+.++.+
T Consensus         8 ~mtriVLLISfiIlfgRl~Y~~I~a~~hHq~   38 (59)
T PF11119_consen    8 RMTRIVLLISFIILFGRLIYSAIGAWVHHQD   38 (59)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhHHHHHHH
Confidence            4566777777888887 88888776666554


No 55 
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=42.32  E-value=21  Score=34.24  Aligned_cols=31  Identities=16%  Similarity=0.254  Sum_probs=20.1

Q ss_pred             chhhccchhh-HHHHHHHHHHHHHHHHHHHhh
Q psy9982           6 FLGLIGGTLT-VEIFLLVFLLLNVLSYILIEK   36 (222)
Q Consensus         6 ~~~~~~~~~~-~iI~lLLF~~LYi~Sy~ii~~   36 (222)
                      .||++|+... +.++.|||+++|+++..--++
T Consensus        18 sL~~la~v~~~~l~l~Ll~ll~yl~~~CC~r~   49 (406)
T PF04906_consen   18 SLLILASVAAACLALSLLFLLIYLICRCCCRR   49 (406)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCC
Confidence            3555554322 446778899999988885443


No 56 
>PRK13453 F0F1 ATP synthase subunit B; Provisional
Probab=40.93  E-value=35  Score=28.57  Aligned_cols=23  Identities=43%  Similarity=0.661  Sum_probs=10.4

Q ss_pred             hhhccchh--hHHHHHHHHHHHHHH
Q psy9982           7 LGLIGGTL--TVEIFLLVFLLLNVL   29 (222)
Q Consensus         7 ~~~~~~~~--~~iI~lLLF~~LYi~   29 (222)
                      ||..||.-  +.++-++.|++|+++
T Consensus        10 ~~~~~~~~~~t~~~~iInFliL~~l   34 (173)
T PRK13453         10 LGAAGGVEWGTVIVTVLTFIVLLAL   34 (173)
T ss_pred             HHhhcCCCHHHHHHHHHHHHHHHHH
Confidence            56666652  233334444444433


No 57 
>PF13134 DUF3948:  Protein of unknown function (DUF3948)
Probab=40.55  E-value=17  Score=24.14  Aligned_cols=12  Identities=42%  Similarity=0.650  Sum_probs=9.8

Q ss_pred             ccchhhccchhh
Q psy9982           4 PDFLGLIGGTLT   15 (222)
Q Consensus         4 ~~~~~~~~~~~~   15 (222)
                      -||||+.||++.
T Consensus        12 ~D~lgsasga~~   23 (35)
T PF13134_consen   12 MDFLGSASGAAV   23 (35)
T ss_pred             hhhhhcccchHH
Confidence            489999999753


No 58 
>PF02157 Man-6-P_recep:  Mannose-6-phosphate receptor; PDB: 2RLB_A 3K42_A 2RL9_A 3K43_A 1C39_A 1M6P_A 3CY4_A 1KEO_B 2RL7_D 2RL8_B ....
Probab=39.91  E-value=9.6  Score=35.49  Aligned_cols=35  Identities=23%  Similarity=0.348  Sum_probs=0.0

Q ss_pred             hhhccchhhHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982           7 LGLIGGTLTVEIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus         7 ~~~~~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      -||.+|.|++||++.+.+ +|++.=+|..|+...++
T Consensus       185 ~~lS~GsVflIIf~iav~-vYfiGG~lYqR~v~gar  219 (278)
T PF02157_consen  185 SGLSVGSVFLIIFFIAVA-VYFIGGILYQRFVMGAR  219 (278)
T ss_dssp             ------------------------------------
T ss_pred             cCCchhHHHHHHHHHHHH-HHHHhHHHHHHHHhcCc
Confidence            466778888777766654 78887788888766655


No 59 
>TIGR01432 QOXA cytochrome aa3 quinol oxidase, subunit II. This enzyme catalyzes the oxidation of quinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. This subunit contains two transmembrane helices and a large external domain responsible for the binding and oxidation of quinol. QuoX is (presently) only found in gram positive bacteria of the Bacillus/Staphylococcus group. Like CyoA, the ubiquinol oxidase found in proteobacteria, the residues responsible for the ligation of Cu(a) and cytochrome c (found in the related cyt. c oxidases) are absent. Unlike CyoA, QoxA is in complex with a subunit I which contains cytochromes a similar to the cyt. c oxidases (as opposed to cytochromes b).
Probab=39.89  E-value=31  Score=30.02  Aligned_cols=26  Identities=19%  Similarity=0.388  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          17 EIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      .|++++++++|++...++.|||++.+
T Consensus        28 ~i~~iI~lvv~~lli~~~~kyr~r~~   53 (217)
T TIGR01432        28 VFMLVIVFVVFVLFTIFLVKYRYRKD   53 (217)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhccc
Confidence            35566667777777777777776654


No 60 
>PF00558 Vpu:  Vpu protein;  InterPro: IPR008187 The Human immunodeficiency virus 1 (HIV-1) Vpu protein acts in the degradation of CD4 in the endoplasmic reticulum and in the enhancement of virion release from the plasma membrane of infected cells [].; GO: 0019076 release of virus from host; PDB: 2JPX_A 1PI8_A 2GOH_A 2GOF_A 1PI7_A 1PJE_A 1VPU_A 2K7Y_A.
Probab=39.75  E-value=25  Score=27.25  Aligned_cols=38  Identities=18%  Similarity=0.373  Sum_probs=14.9

Q ss_pred             CCCccchhhccchhhHHHHHHHHHHHHHHHHHHHhhccc
Q psy9982           1 MFTPDFLGLIGGTLTVEIFLLVFLLLNVLSYILIEKFKR   39 (222)
Q Consensus         1 ~~~~~~~~~~~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk   39 (222)
                      |-.-+.+|+|+..|..||..++.+++|+- |.-++++||
T Consensus         1 M~~l~i~~iialiv~~iiaIvvW~iv~ie-Yrk~~rqrk   38 (81)
T PF00558_consen    1 MQSLEILAIIALIVALIIAIVVWTIVYIE-YRKIKRQRK   38 (81)
T ss_dssp             -------HHHHHHHHHHHHHHHHHHH-------------
T ss_pred             CchHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHh
Confidence            44556778888888777777777777654 444444443


No 61 
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=39.69  E-value=40  Score=24.78  Aligned_cols=23  Identities=13%  Similarity=0.170  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHHhhccccc
Q psy9982          19 FLLVFLLLNVLSYILIEKFKRKD   41 (222)
Q Consensus        19 ~lLLF~~LYi~Sy~ii~~fkk~~   41 (222)
                      .+.+++|++.+-|++.++-||+.
T Consensus        15 t~~~~l~fiavi~~ayr~~~K~~   37 (60)
T COG4736          15 TIAFTLFFIAVIYFAYRPGKKGE   37 (60)
T ss_pred             HHHHHHHHHHHHHHHhcccchhh
Confidence            34445555555566666555443


No 62 
>PF15471 TMEM171:  Transmembrane protein family 171
Probab=39.60  E-value=22  Score=33.54  Aligned_cols=32  Identities=22%  Similarity=0.449  Sum_probs=23.1

Q ss_pred             ccchhhHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          10 IGGTLTVEIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        10 ~~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      |-|.|+..|.-= .|.|--+||++|.|.|||.+
T Consensus       156 ~CGFLslQImGP-lIVl~GLCFFVVAHvKKr~n  187 (319)
T PF15471_consen  156 ICGFLSLQIMGP-LIVLVGLCFFVVAHVKKRNN  187 (319)
T ss_pred             ccceeehhhhhh-HHHHHhhhhhheeeeeeccC
Confidence            445566665433 35666889999999999987


No 63 
>PF06716 DUF1201:  Protein of unknown function (DUF1201);  InterPro: IPR009591 This entry consists of several Beet yellows virus (BYV) putative membrane-binding proteins of around 54 residues in length. The function of this currently unknown.
Probab=38.93  E-value=43  Score=24.02  Aligned_cols=20  Identities=20%  Similarity=0.368  Sum_probs=15.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHH
Q psy9982          15 TVEIFLLVFLLLNVLSYILI   34 (222)
Q Consensus        15 ~~iI~lLLF~~LYi~Sy~ii   34 (222)
                      ..+||+.||.+.|.+-++.-
T Consensus        14 ~~lIC~Fl~~~~~F~~F~~K   33 (54)
T PF06716_consen   14 GFLICLFLFCLVVFIWFVYK   33 (54)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            45799999999888877653


No 64 
>TIGR02762 TraL_TIGR type IV conjugative transfer system protein TraL. This protein is part of the type IV secretion system for conjugative plasmid transfer. The function of the TraL protein is unknown.
Probab=38.84  E-value=31  Score=26.75  Aligned_cols=24  Identities=17%  Similarity=0.104  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHHhhccccccc
Q psy9982          19 FLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus        19 ~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      ++++-+.+. +.+..++|+||..-+
T Consensus        42 g~~lg~~~~-~~~~~lrr~K~g~~~   65 (95)
T TIGR02762        42 GLILGAAVM-LIWKRLRRIKGGEGE   65 (95)
T ss_pred             HHHHHHHHH-HHHHHHHHHHcCCCh
Confidence            333333334 334448899887754


No 65 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=38.74  E-value=23  Score=29.09  Aligned_cols=30  Identities=20%  Similarity=0.367  Sum_probs=16.8

Q ss_pred             ccchhhccchhhHHHHHHHHHHHHHHHHHHH
Q psy9982           4 PDFLGLIGGTLTVEIFLLVFLLLNVLSYILI   34 (222)
Q Consensus         4 ~~~~~~~~~~~~~iI~lLLF~~LYi~Sy~ii   34 (222)
                      +...|+|.|.+.-||.++| +++|+|..++=
T Consensus        64 ~~i~~Ii~gv~aGvIg~Il-li~y~irR~~K   93 (122)
T PF01102_consen   64 PAIIGIIFGVMAGVIGIIL-LISYCIRRLRK   93 (122)
T ss_dssp             TCHHHHHHHHHHHHHHHHH-HHHHHHHHHS-
T ss_pred             cceeehhHHHHHHHHHHHH-HHHHHHHHHhc
Confidence            4456666666666655444 45566655443


No 66 
>KOG1094|consensus
Probab=38.33  E-value=4.1e+02  Score=28.23  Aligned_cols=13  Identities=15%  Similarity=0.240  Sum_probs=7.0

Q ss_pred             cccCCCCccCCCC
Q psy9982          62 YTQVSPAYTQVSP   74 (222)
Q Consensus        62 lc~~Sp~ysPtSP   74 (222)
                      .|.+.|.-.+.++
T Consensus       443 ~~hv~pS~~~~~q  455 (807)
T KOG1094|consen  443 LIHVRPSPREPPQ  455 (807)
T ss_pred             eeccCCCCCCCCC
Confidence            4556665555444


No 67 
>PRK13454 F0F1 ATP synthase subunit B'; Provisional
Probab=37.81  E-value=30  Score=29.33  Aligned_cols=17  Identities=18%  Similarity=0.467  Sum_probs=7.7

Q ss_pred             HHHHHHHH-HHHHHHHhh
Q psy9982          20 LLVFLLLN-VLSYILIEK   36 (222)
Q Consensus        20 lLLF~~LY-i~Sy~ii~~   36 (222)
                      ++.|++|| +++++++.+
T Consensus        38 lI~F~iL~~ll~k~l~~P   55 (181)
T PRK13454         38 LVTLVAIYFVLTRVALPR   55 (181)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            33344443 345664443


No 68 
>PF15468 DUF4636:  Domain of unknown function (DUF4636)
Probab=37.65  E-value=40  Score=30.85  Aligned_cols=13  Identities=38%  Similarity=0.309  Sum_probs=9.3

Q ss_pred             cchhhccchhhHH
Q psy9982           5 DFLGLIGGTLTVE   17 (222)
Q Consensus         5 ~~~~~~~~~~~~i   17 (222)
                      |.-|.||..|+-.
T Consensus        33 dsc~~iG~fLlWy   45 (243)
T PF15468_consen   33 DSCGAIGSFLLWY   45 (243)
T ss_pred             CccchhhhHHHHH
Confidence            6778888777644


No 69 
>TIGR02866 CoxB cytochrome c oxidase, subunit II. Cytochrome c oxidase is the terminal electron acceptor of mitochondria (and one of several possible acceptors in prokaryotes) in the electron transport chain of aerobic respiration. The enzyme couples the oxidation of reduced cytochrome c with the reduction of molecular oxygen to water. This process results in the pumping of four protons across the membrane which are used in the proton gradient powered synthesis of ATP. The oxidase contains two heme a cofactors and three copper atoms as well as other bound ions.
Probab=35.82  E-value=70  Score=27.39  Aligned_cols=23  Identities=35%  Similarity=0.641  Sum_probs=10.8

Q ss_pred             HHHHHHHHH-HHHHHHHHhhccccc
Q psy9982          18 IFLLVFLLL-NVLSYILIEKFKRKD   41 (222)
Q Consensus        18 I~lLLF~~L-Yi~Sy~ii~~fkk~~   41 (222)
                      |++++|+++ +++-| .+.|||+++
T Consensus        19 i~~iI~v~V~~~l~~-~~~k~r~~~   42 (201)
T TIGR02866        19 VATTISLLVAALLAY-VVWKFRRKG   42 (201)
T ss_pred             HHHHHHHHHHHHHHH-hhhhhhccc
Confidence            333343333 34444 444777753


No 70 
>TIGR00869 sec62 protein translocation protein, Sec62 family. protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins has been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.
Probab=35.68  E-value=27  Score=31.76  Aligned_cols=10  Identities=40%  Similarity=0.717  Sum_probs=4.7

Q ss_pred             HHHHHHHHHH
Q psy9982          25 LLNVLSYILI   34 (222)
Q Consensus        25 ~LYi~Sy~ii   34 (222)
                      +||++.+++.
T Consensus       170 ilF~i~~~~~  179 (232)
T TIGR00869       170 ILFVLTLIVV  179 (232)
T ss_pred             HHHHHHHHHh
Confidence            4444554443


No 71 
>PF12409 P5-ATPase:  P5-type ATPase cation transporter
Probab=35.56  E-value=43  Score=26.43  Aligned_cols=26  Identities=15%  Similarity=0.083  Sum_probs=21.2

Q ss_pred             chhhHHHHHHHHHHHHHHHHHHHhhc
Q psy9982          12 GTLTVEIFLLVFLLLNVLSYILIEKF   37 (222)
Q Consensus        12 ~~~~~iI~lLLF~~LYi~Sy~ii~~f   37 (222)
                      -.+..+.|+|-+++||+++++.-.-+
T Consensus        17 ~~l~~~l~ilT~Gll~L~~~W~p~~~   42 (119)
T PF12409_consen   17 TILYYFLCILTLGLLYLVFRWFPKWW   42 (119)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhHHHhh
Confidence            45677899999999999999987543


No 72 
>PF11457 DUF3021:  Protein of unknown function (DUF3021);  InterPro: IPR021560  This is a bacterial family of uncharacterised proteins. 
Probab=33.91  E-value=34  Score=26.89  Aligned_cols=28  Identities=21%  Similarity=0.704  Sum_probs=20.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          15 TVEIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        15 ~~iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      ..++++++|+++|++-+++.....|++-
T Consensus       102 ~~~~~~~~fi~IYliIw~~~y~~~k~~i  129 (136)
T PF11457_consen  102 SLLIFILIFIIIYLIIWLIFYLYWKKDI  129 (136)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4457777888888888888777666654


No 73 
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=33.90  E-value=31  Score=26.97  Aligned_cols=34  Identities=18%  Similarity=0.199  Sum_probs=27.2

Q ss_pred             cchhhHHHHHHHHHHHHHHHHHHHhhcccccccc
Q psy9982          11 GGTLTVEIFLLVFLLLNVLSYILIEKFKRKDLED   44 (222)
Q Consensus        11 ~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~~~   44 (222)
                      +++...+|.+|.|+|+.++=|+|..-+=-|++..
T Consensus        59 ~~~~iili~lls~v~IlVily~IyYFVILRer~~   92 (101)
T PF06024_consen   59 NNGNIILISLLSFVCILVILYAIYYFVILRERQK   92 (101)
T ss_pred             ccccchHHHHHHHHHHHHHHhhheEEEEEecccc
Confidence            4456778999999999999999987777777653


No 74 
>PF03821 Mtp:  Golgi 4-transmembrane spanning transporter;  InterPro: IPR004687 LAPTM4 and 5 are lysosome-associated transmembrane proteins, found in mammals, insects and nematodes. ; GO: 0016021 integral to membrane
Probab=33.45  E-value=32  Score=31.36  Aligned_cols=26  Identities=31%  Similarity=0.517  Sum_probs=22.4

Q ss_pred             HHHHHHHHHHHHHH-HHHhhccccccc
Q psy9982          18 IFLLVFLLLNVLSY-ILIEKFKRKDLE   43 (222)
Q Consensus        18 I~lLLF~~LYi~Sy-~ii~~fkk~~~~   43 (222)
                      -++||-+.|+++|+ .+++.+|+|++.
T Consensus        38 s~~~li~~lf~is~~~l~g~~~~re~~   64 (233)
T PF03821_consen   38 SSFLLIAMLFVISYSLLIGVYKNRERY   64 (233)
T ss_pred             hhHHHHHHHHHhhHHHHhhhhhhhccc
Confidence            46777799999999 999999999984


No 75 
>TIGR02976 phageshock_pspB phage shock protein B. This model describes the PspB protein of the psp (phage shock protein) operon, as found in Escherichia coli and many related species. Expression of a phage protein called secretin protein IV, and a number of other stresses including ethanol, heat shock, and defects in protein secretion trigger sigma-54-dependent expression of the phage shock regulon. PspB is both a regulator and an effector protein of the phage shock response.
Probab=33.27  E-value=43  Score=25.41  Aligned_cols=27  Identities=26%  Similarity=0.411  Sum_probs=14.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          15 TVEIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        15 ~~iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      +.+|=+++| ++++.=-+++.||++|..
T Consensus         5 fl~~Pliif-~ifVap~wl~lHY~~k~~   31 (75)
T TIGR02976         5 FLAIPLIIF-VIFVAPLWLILHYRSKRK   31 (75)
T ss_pred             HHHHHHHHH-HHHHHHHHHHHHHHhhhc
Confidence            344445555 444445556666664443


No 76 
>PRK02898 cobalt transport protein CbiN; Provisional
Probab=33.23  E-value=58  Score=26.21  Aligned_cols=55  Identities=20%  Similarity=0.348  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhcc-cccccccccCCcc-ccceeecCCCccc-CCCCccCC
Q psy9982          16 VEIFLLVFLLLNVLSYILIEKFK-RKDLEDYLSTDED-EATVYTVSPAYTQ-VSPAYTQV   72 (222)
Q Consensus        16 ~iI~lLLF~~LYi~Sy~ii~~fk-k~~~~~~~~~d~~-da~V~~iS~~lc~-~Sp~ysPt   72 (222)
                      ++|.+++-++|-++-.+++..-- +.++|.  ..||. +..+.+|.+.|.+ |.|-++|-
T Consensus         5 ~~~L~~~vi~l~~~pl~~~~~~~~~~~eFg--GaD~~A~~~I~ei~p~Y~PWf~PlwEPP   62 (100)
T PRK02898          5 NLLLLLLVILLAVLPLFIYSGSGEDGGEFG--GADGQAEEAITEIAPDYEPWFEPLWEPP   62 (100)
T ss_pred             HHHHHHHHHHHHHHHHHhhcCCcCcccccc--CccHHHHHHHHHhCCCCcccccccccCC
Confidence            44445554455555544444211 112232  23333 5556667776666 34555553


No 77 
>PF13179 DUF4006:  Family of unknown function (DUF4006)
Probab=32.76  E-value=44  Score=25.09  Aligned_cols=38  Identities=24%  Similarity=0.316  Sum_probs=29.6

Q ss_pred             chhhccchhhHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy9982           6 FLGLIGGTLTVEIFLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus         6 ~~~~~~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      ..||=|-+-..|+.+||-.+|-++.|.-|.-++..+..
T Consensus         7 ~f~LnGi~G~LIAvvLLLsIl~~lt~~ai~~Qq~~At~   44 (66)
T PF13179_consen    7 VFGLNGITGMLIAVVLLLSILAFLTYWAIKVQQEQATN   44 (66)
T ss_pred             eeeecchHhHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            35666666677888888899999999888887776664


No 78 
>PRK14780 lipoprotein signal peptidase; Provisional
Probab=32.67  E-value=45  Score=30.96  Aligned_cols=52  Identities=17%  Similarity=0.347  Sum_probs=26.9

Q ss_pred             cchhhccchhhHH--HHHHHHHHHHHHHHH--HHhhcccccccccc-c--CCccccceee
Q psy9982           5 DFLGLIGGTLTVE--IFLLVFLLLNVLSYI--LIEKFKRKDLEDYL-S--TDEDEATVYT   57 (222)
Q Consensus         5 ~~~~~~~~~~~~i--I~lLLF~~LYi~Sy~--ii~~fkk~~~~~~~-~--~d~~da~V~~   57 (222)
                      ||+.+- ..++++  ||+.+=++|.++..+  ++..|||.+|...- -  .||.|.+.++
T Consensus       191 Dfi~~~-~~iFNlADi~I~~G~~llv~~~li~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  249 (263)
T PRK14780        191 DYWKFV-NSIINLFDVYIVVGVCVLVVILIISFIIKWKKDKDSEDNKKKIADENDLEINE  249 (263)
T ss_pred             EEEecC-CceeEHHHHHHHHHHHHHHHHHHHHHHHhhcccccchhccCcccccccccccC
Confidence            444432 345665  555555555555555  67777777663111 1  2555666554


No 79 
>PHA02825 LAP/PHD finger-like protein; Provisional
Probab=32.30  E-value=29  Score=30.13  Aligned_cols=50  Identities=16%  Similarity=0.214  Sum_probs=29.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhcccccccccccCCccccceeecCCCcccC
Q psy9982          14 LTVEIFLLVFLLLNVLSYILIEKFKRKDLEDYLSTDEDEATVYTVSPAYTQV   65 (222)
Q Consensus        14 ~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~~~~~~~d~~da~V~~iS~~lc~~   65 (222)
                      ...+++.|||++|.+++|+++.-=-++--+  ...++|-++|..+...+-+|
T Consensus        79 ~~~l~~~llcl~~~~i~~~l~~~~i~~~~~--~~~~~~~~~~~~~~~~~~p~  128 (162)
T PHA02825         79 DSAIVNSLLCLIVGGITYLLVSFNIKKLIE--SEENSDLIKLFLVVAYLLPF  128 (162)
T ss_pred             hHHHHHHHHHHHHhhhhheeeehhhhhhhh--cccccchhheeeeehhcccc
Confidence            456788888888988988776532222211  12345566666665555443


No 80 
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=32.23  E-value=15  Score=31.53  Aligned_cols=20  Identities=20%  Similarity=0.305  Sum_probs=10.0

Q ss_pred             ccccccccccCCccccceeecC
Q psy9982          38 KRKDLEDYLSTDEDEATVYTVS   59 (222)
Q Consensus        38 kk~~~~~~~~~d~~da~V~~iS   59 (222)
                      +||.+|  ..-|.--.+.|+-.
T Consensus        77 ~kktdf--idSdGkvvtay~~n   96 (154)
T PF04478_consen   77 RKKTDF--IDSDGKVVTAYRSN   96 (154)
T ss_pred             cccCcc--ccCCCcEEEEEcCc
Confidence            344444  34444466666653


No 81 
>PF08374 Protocadherin:  Protocadherin;  InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains. They are expressed in a variety of organisms and are found in high concentrations in the brain where they seem to be localised mainly at cell-cell contact sites. Their expression seems to be developmentally regulated []. 
Probab=32.23  E-value=29  Score=31.46  Aligned_cols=17  Identities=18%  Similarity=0.669  Sum_probs=11.3

Q ss_pred             chhhccchhhHHHHHHH
Q psy9982           6 FLGLIGGTLTVEIFLLV   22 (222)
Q Consensus         6 ~~~~~~~~~~~iI~lLL   22 (222)
                      .+|+|+|+++.|+++|+
T Consensus        40 ~iaiVAG~~tVILVI~i   56 (221)
T PF08374_consen   40 MIAIVAGIMTVILVIFI   56 (221)
T ss_pred             eeeeecchhhhHHHHHH
Confidence            46788888877654443


No 82 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=32.08  E-value=90  Score=24.98  Aligned_cols=26  Identities=19%  Similarity=0.378  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          17 EIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      .+.|||.++..|+.+....+.+|..+
T Consensus         8 ~llLll~l~asl~~wr~~~rq~k~~~   33 (107)
T PF15330_consen    8 ALLLLLSLAASLLAWRMKQRQKKAGQ   33 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhccccC
Confidence            34455555556666555554444433


No 83 
>PF11057 Cortexin:  Cortexin of kidney;  InterPro: IPR020066 Cortexin is a neuron-specific, 82-residue membrane protein which is found especially in vertebrate brain cortex tissue. It may mediate extracellular or intracellular signalling of cortical neurons during forebrain development. Cortexin is present at significant levels in the foetal brain, suggesting that it may be important to neurons of both the developing and adult cerebral cortex. Cortexin has a conserved single membrane-spanning region in the middle of each sequence []. In humans, there is selective expression of Cortexin 3 (CTXN3) in the kidney as well as the brain []. This entry contains Cortexins 1, 2 and 3.; GO: 0031224 intrinsic to membrane
Probab=31.71  E-value=42  Score=26.11  Aligned_cols=30  Identities=20%  Similarity=0.397  Sum_probs=18.2

Q ss_pred             chhhHHHHHHHHHHHHHH-HH-HHHhhccccc
Q psy9982          12 GTLTVEIFLLVFLLLNVL-SY-ILIEKFKRKD   41 (222)
Q Consensus        12 ~~~~~iI~lLLF~~LYi~-Sy-~ii~~fkk~~   41 (222)
                      .++.++|+|+||+++-|+ |+ +++-.|++--
T Consensus        29 t~faFV~~L~~fL~~liVRCfrIllDPYssmP   60 (81)
T PF11057_consen   29 TAFAFVGLLCLFLGLLIVRCFRILLDPYSSMP   60 (81)
T ss_pred             eeehHHHHHHHHHHHHHHHHHHHHcChhhcCC
Confidence            345667888888877665 44 3444555543


No 84 
>PF13073 DUF3937:  Protein of unknown function (DUF3937)
Probab=31.26  E-value=42  Score=25.49  Aligned_cols=16  Identities=25%  Similarity=0.625  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHHHH
Q psy9982          18 IFLLVFLLLNVLSYIL   33 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~i   33 (222)
                      ++|-||+||+|+-+.|
T Consensus        10 ~gltlfv~L~vi~Fti   25 (73)
T PF13073_consen   10 FGLTLFVFLSVIDFTI   25 (73)
T ss_pred             hhhHHHHHHHHHHhhH
Confidence            7889999999998765


No 85 
>PRK04989 psbM photosystem II reaction center protein M; Provisional
Probab=31.18  E-value=31  Score=23.02  Aligned_cols=22  Identities=23%  Similarity=0.354  Sum_probs=10.1

Q ss_pred             chhhccchhhHHHHHHHHHHHH
Q psy9982           6 FLGLIGGTLTVEIFLLVFLLLN   27 (222)
Q Consensus         6 ~~~~~~~~~~~iI~lLLF~~LY   27 (222)
                      -||+|...|+.+|=...-++||
T Consensus         5 ~lgfiAt~Lfi~iPt~FLlilY   26 (35)
T PRK04989          5 DLGFVASLLFVLVPTVFLIILY   26 (35)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            3555555554444433333444


No 86 
>PF13800 Sigma_reg_N:  Sigma factor regulator N-terminal
Probab=31.02  E-value=41  Score=25.42  Aligned_cols=21  Identities=14%  Similarity=0.396  Sum_probs=11.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHH
Q psy9982          14 LTVEIFLLVFLLLNVLSYILI   34 (222)
Q Consensus        14 ~~~iI~lLLF~~LYi~Sy~ii   34 (222)
                      ++.++|++|++++++++.+.+
T Consensus        19 isi~~~lvi~~i~~~~~~l~y   39 (96)
T PF13800_consen   19 ISIISALVIFIISFIISALYY   39 (96)
T ss_pred             HHHhhhhhhHHHHHHhhhhee
Confidence            344455666665665655433


No 87 
>CHL00080 psbM photosystem II protein M
Probab=30.80  E-value=31  Score=22.94  Aligned_cols=22  Identities=18%  Similarity=0.315  Sum_probs=10.8

Q ss_pred             chhhccchhhHHHHHHHHHHHH
Q psy9982           6 FLGLIGGTLTVEIFLLVFLLLN   27 (222)
Q Consensus         6 ~~~~~~~~~~~iI~lLLF~~LY   27 (222)
                      .||+|...|+.+|=...-++||
T Consensus         5 ~lgfiAt~LFi~iPt~FLlily   26 (34)
T CHL00080          5 ILAFIATALFILVPTAFLLIIY   26 (34)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhh
Confidence            3566655555554443333444


No 88 
>COG3462 Predicted membrane protein [Function unknown]
Probab=30.74  E-value=85  Score=25.98  Aligned_cols=36  Identities=22%  Similarity=0.526  Sum_probs=21.3

Q ss_pred             hhhccc-----hhhHH--HHHHHHHHHHHHHHHHHhhcccccccc
Q psy9982           7 LGLIGG-----TLTVE--IFLLVFLLLNVLSYILIEKFKRKDLED   44 (222)
Q Consensus         7 ~~~~~~-----~~~~i--I~lLLF~~LYi~Sy~ii~~fkk~~~~~   44 (222)
                      .|..||     .+.-|  ++.|+|++++  -|.|+.++|+..+.|
T Consensus        40 ~gm~GG~yGm~lImpI~~~vvli~lvvf--m~~~~g~~r~~~~~d   82 (117)
T COG3462          40 RGMMGGLYGMWLIMPIFWAVVLIFLVVF--MFYILGAVRRGSDDD   82 (117)
T ss_pred             cccccchhhhHHHHHHHHHHHHHHHHHH--HHHHHHHhcccchhc
Confidence            366677     23333  3344444444  478899999887754


No 89 
>PRK13682 hypothetical protein; Provisional
Probab=30.72  E-value=56  Score=23.41  Aligned_cols=16  Identities=44%  Similarity=0.854  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHHH
Q psy9982          18 IFLLVFLLLNVLSYIL   33 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~i   33 (222)
                      |.+++|++|.+++.+.
T Consensus        33 iLF~iflvl~vvslv~   48 (51)
T PRK13682         33 ILFFIFLVLFVVSLLL   48 (51)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            8888899999998765


No 90 
>TIGR01195 oadG_fam sodium pump decarboxylases, gamma subunit. Most sequences scoring between the noise and trusted cutoffs are eukaryotic sodium channel proteins.
Probab=29.86  E-value=66  Score=24.41  Aligned_cols=19  Identities=5%  Similarity=0.079  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHHHHHHHh
Q psy9982          17 EIFLLVFLLLNVLSYILIE   35 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~   35 (222)
                      ++..||..++.+++.++-+
T Consensus        20 ~fL~lLi~~i~~~~~~~~~   38 (82)
T TIGR01195        20 LFLSLLIYAVRGMGKVVGR   38 (82)
T ss_pred             HHHHHHHHHHHHHHHHHhc
Confidence            3344445555555554443


No 91 
>TIGR03063 srtB_target sortase B cell surface sorting signal. Two different classes of sorting signal, both analogous to the sortase A signal LPXTG, may be recognized by the sortase SrtB. These are given as NXZTN and NPKXZ. Proteins sorted by this class of sortase are less common than the sortase A and LPXTG system. This model describes a number of cell surface protein C-terminal regions from Gram-positive bacteria that appear to be sortase B (SrtB) sorting signals.
Probab=29.64  E-value=64  Score=20.64  Aligned_cols=12  Identities=17%  Similarity=0.069  Sum_probs=7.3

Q ss_pred             HHHHHHHHHHHH
Q psy9982          21 LVFLLLNVLSYI   32 (222)
Q Consensus        21 LLF~~LYi~Sy~   32 (222)
                      -||++|.++|-+
T Consensus        11 ~ly~~l~~~s~~   22 (29)
T TIGR03063        11 GLYAVLFLGSGL   22 (29)
T ss_pred             HHHHHHHHHHHH
Confidence            456666677633


No 92 
>PF02790 COX2_TM:  Cytochrome C oxidase subunit II, transmembrane domain This family corresponds to chains b and o.;  InterPro: IPR011759 Cytochrome c oxidase (1.9.3.1 from EC) [, ] is an oligomeric enzymatic complex which is a component of the respiratory chain and is involved in the transfer of electrons from cytochrome c to oxygen. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane. The enzyme complex consists of 3-4 subunits (prokaryotes) to up to 13 polypeptides (mammals). Subunit 2 (CO II) transfers the electrons from cytochrome c to the catalytic subunit 1. It contains two adjacent transmembrane regions in its N terminus and the major part of the protein is exposed to the periplasmic or to the mitochondrial intermembrane space, respectively. CO II provides the substrate-binding site and contains a copper centre called Cu(A) (see IPR001505 from INTERPRO), probably the primary acceptor in cytochrome c oxidase. An exception is the corresponding subunit of the cbb3-type oxidase which lacks the copper A redox-centre. Several bacterial CO II have a C-terminal extension that contains a covalently bound haem c.  The N-terminal domain of cytochrome C oxidase contains two transmembrane alpha-helices. ; GO: 0004129 cytochrome-c oxidase activity, 0005507 copper ion binding, 0009055 electron carrier activity, 0022900 electron transport chain, 0016021 integral to membrane; PDB: 3VRJ_C 2EIN_B 3AG3_B 2DYR_O 3AG1_B 2EIK_O 3ASN_B 1OCR_B 2EIJ_B 1OCC_O ....
Probab=29.59  E-value=84  Score=22.51  Aligned_cols=21  Identities=14%  Similarity=0.472  Sum_probs=12.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHh
Q psy9982          15 TVEIFLLVFLLLNVLSYILIE   35 (222)
Q Consensus        15 ~~iI~lLLF~~LYi~Sy~ii~   35 (222)
                      ..++++++++++|++-|++.+
T Consensus        28 ~~i~~~I~~~V~~~l~~~~~~   48 (84)
T PF02790_consen   28 MIIMIFIFVFVFYFLIYFLFN   48 (84)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhheeeeEeeeccccccc
Confidence            344555556666666666666


No 93 
>KOG4433|consensus
Probab=29.50  E-value=46  Score=33.58  Aligned_cols=20  Identities=20%  Similarity=0.228  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHh
Q psy9982          16 VEIFLLVFLLLNVLSYILIE   35 (222)
Q Consensus        16 ~iI~lLLF~~LYi~Sy~ii~   35 (222)
                      +.|..|||+++|.++..-=+
T Consensus        53 ~l~l~Ll~ll~yli~~cC~R   72 (526)
T KOG4433|consen   53 CLGLSLLFLLFYLICRCCCR   72 (526)
T ss_pred             HHHHHHHHHHHHHHHHHHcC
Confidence            45677777777777766543


No 94 
>PF02532 PsbI:  Photosystem II reaction centre I protein (PSII 4.8 kDa protein);  InterPro: IPR003686 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbI, which is tightly associated with the D1/D2 heterodimer in PSII. The function of PsbI is unknown, but it may be involved in the assembly, dimerisation or stabilisation of PSII dimers [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_i 3ARC_I 3A0B_i 3BZ2_I 3PRQ_I 3KZI_I 3PRR_I 2AXT_i 4FBY_I 1S5L_i ....
Probab=29.37  E-value=80  Score=21.22  Aligned_cols=17  Identities=18%  Similarity=0.509  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy9982          16 VEIFLLVFLLLNVLSYI   32 (222)
Q Consensus        16 ~iI~lLLF~~LYi~Sy~   32 (222)
                      .-+|+++|++|+|-.++
T Consensus         8 Vy~vV~ffv~LFifGfl   24 (36)
T PF02532_consen    8 VYTVVIFFVSLFIFGFL   24 (36)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             ehhhHHHHHHHHhcccc
Confidence            44778888888888775


No 95 
>PF07946 DUF1682:  Protein of unknown function (DUF1682);  InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function. One member (Q920S6 from SWISSPROT) is described as being an adipocyte-specific protein, but no evidence of this was found. 
Probab=29.18  E-value=46  Score=30.69  Aligned_cols=21  Identities=43%  Similarity=0.771  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHhh
Q psy9982          16 VEIFLLVFLLLNVLSYILIEK   36 (222)
Q Consensus        16 ~iI~lLLF~~LYi~Sy~ii~~   36 (222)
                      .-||+|.|++||++.|++=++
T Consensus         6 ~E~~~l~~l~~y~~~y~~G~~   26 (321)
T PF07946_consen    6 LEIIFLAFLLLYVVNYFIGKS   26 (321)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            347788888888888887554


No 96 
>PF08370 PDR_assoc:  Plant PDR ABC transporter associated;  InterPro: IPR013581 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This domain is found on the C terminus of ABC-2 type transporter domains (IPR013525 from INTERPRO). It seems to be associated with the plant pleiotropic drug resistance (PDR) protein family of ABC transporters. Like in yeast, plant PDR ABC transporters may also play a role in the transport of antifungal agents [] (see also IPR010929 from INTERPRO). The PDR family is characterised by a configuration in which the ABC domain is nearer the N terminus of the protein than the transmembrane domain []. 
Probab=29.15  E-value=77  Score=23.44  Aligned_cols=27  Identities=15%  Similarity=0.352  Sum_probs=19.1

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhccccc
Q psy9982          15 TVEIFLLVFLLLNVLSYILIEKFKRKD   41 (222)
Q Consensus        15 ~~iI~lLLF~~LYi~Sy~ii~~fkk~~   41 (222)
                      ..+-+.+||-+||+++-..+..++|..
T Consensus        35 aL~G~~vlFNil~~laL~yL~p~~k~~   61 (65)
T PF08370_consen   35 ALLGFIVLFNILFTLALTYLNPLGKSQ   61 (65)
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCcCCCC
Confidence            345667788888888877777776653


No 97 
>PF14851 FAM176:  FAM176 family
Probab=29.02  E-value=63  Score=27.61  Aligned_cols=19  Identities=32%  Similarity=0.114  Sum_probs=10.2

Q ss_pred             hHHHHHHHHHHHHHHHHHH
Q psy9982          15 TVEIFLLVFLLLNVLSYIL   33 (222)
Q Consensus        15 ~~iI~lLLF~~LYi~Sy~i   33 (222)
                      ..|+-|||.+||.++--..
T Consensus        29 gVC~GLlLtLcllV~risc   47 (153)
T PF14851_consen   29 GVCAGLLLTLCLLVIRISC   47 (153)
T ss_pred             HHHHHHHHHHHHHHhhhee
Confidence            3445566666666554444


No 98 
>PF06196 DUF997:  Protein of unknown function (DUF997);  InterPro: IPR010398 This is a family of predicted bacterial membrane protein with unknown function.
Probab=28.96  E-value=74  Score=24.23  Aligned_cols=22  Identities=14%  Similarity=0.273  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHHHhhccc
Q psy9982          18 IFLLVFLLLNVLSYILIEKFKR   39 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~fkk   39 (222)
                      =|++++++.-++++++++++=|
T Consensus        49 SCi~~~il~~~l~~~~vk~~Fk   70 (80)
T PF06196_consen   49 SCIGGPILFIILVWLMVKFFFK   70 (80)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhh
Confidence            4566666666778888877654


No 99 
>PF14276 DUF4363:  Domain of unknown function (DUF4363)
Probab=28.81  E-value=40  Score=26.28  Aligned_cols=26  Identities=19%  Similarity=0.304  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          17 EIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      ||++++|+++-+++++...+.++..+
T Consensus         1 ~i~~~i~~lii~~~~~~~~~l~~~~~   26 (121)
T PF14276_consen    1 IIVIIIFILIIALSIFSNNYLNNSTD   26 (121)
T ss_pred             ChHHHHHHHHHHHHHHHHhhhhhHHH
Confidence            35566666666666666666655443


No 100
>PRK10983 putative inner membrane protein; Provisional
Probab=28.74  E-value=55  Score=30.77  Aligned_cols=38  Identities=24%  Similarity=0.289  Sum_probs=29.7

Q ss_pred             chhhccchh-hHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy9982           6 FLGLIGGTL-TVEIFLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus         6 ~~~~~~~~~-~~iI~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      ++|++||.. +-++-++|.-.+..+.+.+++.+++..+.
T Consensus       312 l~~~~~G~~~fG~~G~~lgp~i~a~~~~l~~~~~~~~~~  350 (368)
T PRK10983        312 LSGVIGGLIAFGMIGLFIGPVVLAVSYRLFSAWVHEVPP  350 (368)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCC
Confidence            467777766 77888888888999999999999865443


No 101
>PF03579 SHP:  Small hydrophobic protein;  InterPro: IPR005327 The small hydrophobic integral membrane protein, SH (previously designated 1A) is found to have a variety of glycosylated forms [, ]. This protein is a component of the mature respiratory syncytial virion [] where it may form complexes and appears to play a structural role.; GO: 0016020 membrane, 0016021 integral to membrane, 0048222 glycoprotein network
Probab=28.74  E-value=62  Score=24.07  Aligned_cols=17  Identities=24%  Similarity=0.739  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHHHHHh
Q psy9982          19 FLLVFLLLNVLSYILIE   35 (222)
Q Consensus        19 ~lLLF~~LYi~Sy~ii~   35 (222)
                      |.|+|++|-|++++||+
T Consensus        18 FtLi~M~lti~~~~Iv~   34 (64)
T PF03579_consen   18 FTLIFMMLTIGFFFIVT   34 (64)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45666666666666554


No 102
>PF04246 RseC_MucC:  Positive regulator of sigma(E), RseC/MucC;  InterPro: IPR007359 This bacterial family of integral membrane proteins represents a positive regulator of the sigma(E) transcription factor, namely RseC/MucC. The sigma(E) transcription factor is up-regulated by cell envelope protein misfolding, and regulates the expression of genes that are collectively termed ECF (devoted to Extra-Cellular Functions) []. In Pseudomonas aeruginosa, derepression of sigma(E) is associated with the alginate-overproducing phenotype characteristic of chronic respiratory tract colonization in cystic fibrosis patients. The mechanism by which RseC/MucC positively regulates the sigma(E) transcription factor is unknown. RseC is also thought to have a role in thiamine biosynthesis in Salmonella typhimurium []. In addition, this family also includes an N-terminal part of RnfF, a Rhodobacter capsulatus protein, of unknown function, that is essential for nitrogen fixation. This protein also contains a domain found in ApbE protein IPR003374 from INTERPRO, which is itself involved in thiamine biosynthesis.
Probab=28.47  E-value=52  Score=26.21  Aligned_cols=24  Identities=25%  Similarity=0.351  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHhhccccccc
Q psy9982          20 LLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus        20 lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      +|..+...+++|+++++|+|+-+.
T Consensus       100 ~l~~l~~l~~~~~~~~~~~~~~~~  123 (135)
T PF04246_consen  100 ILGGLLGLALGFLILRLFDRRLKK  123 (135)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhcc
Confidence            344445556777788877776553


No 103
>TIGR03038 PS_II_psbM photosystem II reaction center protein PsbM. Members of this protein family are the photosystem II reaction center M protein, product of the psbM gene, in Cyanobacteria and their derived organelles in plants. This model resembles Pfam model pfam05151 but has cutoffs set to avoid false-positive matches to similar (not necessarily homologous) sequences in species that are not photosynthetic.
Probab=28.45  E-value=37  Score=22.39  Aligned_cols=23  Identities=26%  Similarity=0.467  Sum_probs=11.4

Q ss_pred             chhhccchhhHHHHHHHHHHHHH
Q psy9982           6 FLGLIGGTLTVEIFLLVFLLLNV   28 (222)
Q Consensus         6 ~~~~~~~~~~~iI~lLLF~~LYi   28 (222)
                      .+|+|...|+..|=...-++|||
T Consensus         5 ~l~fiAt~Lfi~iPt~FLiilYv   27 (33)
T TIGR03038         5 ILGFIATLLFILVPTVFLLILYI   27 (33)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhe
Confidence            45666555555544444444443


No 104
>PF06783 UPF0239:  Uncharacterised protein family (UPF0239);  InterPro: IPR009621 This is a group of transmembrane proteins of unknown function.; GO: 0016021 integral to membrane
Probab=28.23  E-value=18  Score=28.38  Aligned_cols=18  Identities=33%  Similarity=0.551  Sum_probs=14.7

Q ss_pred             hhccchhhHHHHHHHHHH
Q psy9982           8 GLIGGTLTVEIFLLVFLL   25 (222)
Q Consensus         8 ~~~~~~~~~iI~lLLF~~   25 (222)
                      ||.-|.+|-+||+|-.++
T Consensus        25 GLf~GAIFQliCilAiI~   42 (85)
T PF06783_consen   25 GLFVGAIFQLICILAIIL   42 (85)
T ss_pred             HHHHHHHHHHHHHHheee
Confidence            788899999999886554


No 105
>PF13858 DUF4199:  Protein of unknown function (DUF4199)
Probab=28.17  E-value=56  Score=26.21  Aligned_cols=15  Identities=20%  Similarity=0.576  Sum_probs=9.6

Q ss_pred             HHHHHHHhhcccccc
Q psy9982          28 VLSYILIEKFKRKDL   42 (222)
Q Consensus        28 i~Sy~ii~~fkk~~~   42 (222)
                      ++-|+-+++||++..
T Consensus        43 ~~i~~~i~~~R~~~~   57 (163)
T PF13858_consen   43 IFIYFAIRRYRKKYN   57 (163)
T ss_pred             HHHHHHHHHHHHHcc
Confidence            344677788886654


No 106
>PF12669 P12:  Virus attachment protein p12 family
Probab=27.96  E-value=55  Score=23.43  Aligned_cols=9  Identities=22%  Similarity=0.239  Sum_probs=3.8

Q ss_pred             HHHHhhccc
Q psy9982          31 YILIEKFKR   39 (222)
Q Consensus        31 y~ii~~fkk   39 (222)
                      +-+++.+|+
T Consensus        18 r~~~k~~K~   26 (58)
T PF12669_consen   18 RKFIKDKKK   26 (58)
T ss_pred             HHHHHHhhc
Confidence            444444333


No 107
>TIGR02736 cbb3_Q_epsi cytochrome c oxidase, cbb3-type, CcoQ subunit, epsilon-Proteobacterial. Members of this protein family are restricted to the epsilon branch of the Proteobacteria. All members are found in operons containing the other three structural subunits of the cbb3 type of cytochrome c oxidase. These small proteins show remote sequence similarity to the CcoQ subunit in other cytochrome c oxidase systems, so this family is assumed to represent the epsilonproteobacterial variant of CcoQ.
Probab=27.91  E-value=1.1e+02  Score=22.44  Aligned_cols=24  Identities=25%  Similarity=0.400  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHHHHHhhccccc
Q psy9982          18 IFLLVFLLLNVLSYILIEKFKRKD   41 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~fkk~~   41 (222)
                      +.++|+++||.--|-|-+..||-+
T Consensus         7 ~ti~lvv~LYgY~yhLYrsek~G~   30 (56)
T TIGR02736         7 FTLLLVIFLYAYIYHLYRSQKKGE   30 (56)
T ss_pred             HHHHHHHHHHHHHHHhhhhhcccc
Confidence            344455555555555555555443


No 108
>COG4395 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.83  E-value=31  Score=32.29  Aligned_cols=21  Identities=29%  Similarity=0.551  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHHHHHHHhhcc
Q psy9982          18 IFLLVFLLLNVLSYILIEKFK   38 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~fk   38 (222)
                      |+|||-++|=.+..+.++.|+
T Consensus        61 ~~l~l~~lig~~~~~~~r~f~   81 (281)
T COG4395          61 IFLLLITLIGFVIMLEMRFFD   81 (281)
T ss_pred             HHHHHHHHHHHHHHHhccccc
Confidence            333333333333344444443


No 109
>PLN03207 stomagen; Provisional
Probab=27.36  E-value=67  Score=26.24  Aligned_cols=20  Identities=35%  Similarity=0.805  Sum_probs=11.7

Q ss_pred             hhhHHHHHHHHHHHHHHHHHH
Q psy9982          13 TLTVEIFLLVFLLLNVLSYIL   33 (222)
Q Consensus        13 ~~~~iI~lLLF~~LYi~Sy~i   33 (222)
                      +..+.+|+|||.+| +..|+|
T Consensus        10 t~~~~lffLl~~ll-la~~v~   29 (113)
T PLN03207         10 TRCLTLFFLLFFLL-LGAYVI   29 (113)
T ss_pred             chhHHHHHHHHHHH-HHHHHH
Confidence            44555777777666 444444


No 110
>PF13131 DUF3951:  Protein of unknown function (DUF3951)
Probab=27.36  E-value=99  Score=22.38  Aligned_cols=39  Identities=21%  Similarity=0.289  Sum_probs=24.5

Q ss_pred             HHHHHHHHHHHHHHHHHhhcccccccccccCCcccccee
Q psy9982          18 IFLLVFLLLNVLSYILIEKFKRKDLEDYLSTDEDEATVY   56 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~fkk~~~~~~~~~d~~da~V~   56 (222)
                      |+++.-.++.++.++--+-|-||+.-+-++.-+|.+++-
T Consensus         8 ~~~~~~~I~~lIgfity~mfV~K~s~q~~YTP~d~iTgQ   46 (53)
T PF13131_consen    8 IILFTIFIFFLIGFITYKMFVKKASPQIYYTPFDSITGQ   46 (53)
T ss_pred             HHHHHHHHHHHHHHHHHHhheecCCCceeeccchheeee
Confidence            344444455666666667777777766566667776654


No 111
>PLN00090 photosystem II reaction center M protein; Provisional
Probab=26.73  E-value=44  Score=27.18  Aligned_cols=22  Identities=18%  Similarity=0.108  Sum_probs=9.6

Q ss_pred             chhhccchhhHHHHHHHHHHHH
Q psy9982           6 FLGLIGGTLTVEIFLLVFLLLN   27 (222)
Q Consensus         6 ~~~~~~~~~~~iI~lLLF~~LY   27 (222)
                      +||+|...|+.+|=.+.-++||
T Consensus        75 iLafIATaLFIlIPTaFLLILY   96 (113)
T PLN00090         75 FGAYLAVALGTFLPCLFLINLF   96 (113)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4555544444444333333344


No 112
>PF10332 DUF2418:  Protein of unknown function (DUF2418);  InterPro: IPR018819  This entry represents the conserved 100 residue central region from a family of proteins found in fungi. It carries a characteristic EYD sequence motif. The function is not known. 
Probab=26.01  E-value=66  Score=25.38  Aligned_cols=32  Identities=25%  Similarity=0.314  Sum_probs=22.6

Q ss_pred             cchhhHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          11 GGTLTVEIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        11 ~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      +++.+..+++++-+++-+.-|+++.+|..+-.
T Consensus        35 ~~s~~~~~~~~~~~l~s~~l~~li~~f~~~ik   66 (99)
T PF10332_consen   35 LPSVTSFTTLFLMVLLSFQLYFLISRFEQLIK   66 (99)
T ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            44666777777777777777888888876543


No 113
>KOG2417|consensus
Probab=25.69  E-value=37  Score=33.36  Aligned_cols=25  Identities=24%  Similarity=0.542  Sum_probs=21.4

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHhhc
Q psy9982          13 TLTVEIFLLVFLLLNVLSYILIEKF   37 (222)
Q Consensus        13 ~~~~iI~lLLF~~LYi~Sy~ii~~f   37 (222)
                      .++|||.+|+|++-|-.||+||.--
T Consensus        80 ~l~~ill~lv~~ip~Y~~y~ii~~i  104 (462)
T KOG2417|consen   80 CLSLILLTLVFMIPYYHCYLIIRNI  104 (462)
T ss_pred             hHHHHHHHHHHHHHHHhheeeeecc
Confidence            4788999999999999999998643


No 114
>cd00922 Cyt_c_Oxidase_IV Cytochrome c oxidase subunit IV. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit IV is the largest of the nuclear-encoded subunits. It binds ATP at the matrix side, leading to an allosteric inhibition of enzyme activity at high intramitochondrial ATP/ADP ratios. In mammals, subunit IV has a lung-specific isoform and a ubiquitously expressed isoform.
Probab=25.51  E-value=49  Score=27.38  Aligned_cols=23  Identities=30%  Similarity=0.449  Sum_probs=11.1

Q ss_pred             CccchhhccchhhHH-HHHHHHHH
Q psy9982           3 TPDFLGLIGGTLTVE-IFLLVFLL   25 (222)
Q Consensus         3 ~~~~~~~~~~~~~~i-I~lLLF~~   25 (222)
                      +++....+||++..| |.+++|+.
T Consensus        71 ~~ewk~v~~~~~~~i~~s~~~~~~   94 (136)
T cd00922          71 TGEWKTVFGGVLAFIGITGVIFGL   94 (136)
T ss_pred             CccHHHHHHHHHHHHHHHHHHHHH
Confidence            345555566655444 34444433


No 115
>TIGR01433 CyoA cytochrome o ubiquinol oxidase subunit II. This enzyme catalyzes the oxidation of ubiquinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. Subunit II is responsible for binding and oxidation of the ubiquinone substrate. This sequence is closely related to QoxA, which oxidizes quinol in gram positive bacteria but which is in complex with subunits which utilize cytochromes a in the reduction of molecular oxygen. Slightly more distantly related is subunit II of cytochrome c oxidase which uses cyt. c as the oxidant.
Probab=25.51  E-value=50  Score=29.30  Aligned_cols=29  Identities=14%  Similarity=0.376  Sum_probs=18.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy9982          15 TVEIFLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus        15 ~~iI~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      ..+|++++|+++.++-...+.||||+++.
T Consensus        35 ~~~~~~ii~v~v~~~~~~~~~r~r~~~~~   63 (226)
T TIGR01433        35 AFGLMLLVVIPVILMTLFFAWKYRATNKD   63 (226)
T ss_pred             HHHHHHHHHHHHHHHHheeeEEEeccCCc
Confidence            34566667777666655666778877553


No 116
>PF03620 IBV_3C:  IBV 3C protein;  InterPro: IPR005296 These proteins are the product of ORF 3C from Infectious bronchitis virus. Currently, the function of this protein remains unknown.
Probab=25.13  E-value=91  Score=24.76  Aligned_cols=27  Identities=37%  Similarity=0.357  Sum_probs=21.7

Q ss_pred             hhhccchhhHHHHHHHHHHHHHHHHHH
Q psy9982           7 LGLIGGTLTVEIFLLVFLLLNVLSYIL   33 (222)
Q Consensus         7 ~~~~~~~~~~iI~lLLF~~LYi~Sy~i   33 (222)
                      |--=|+.++++-.+|-|+.||++.-.+
T Consensus         9 leeNG~Flt~lYv~~gfialYllgk~L   35 (93)
T PF03620_consen    9 LEENGSFLTALYVLLGFIALYLLGKAL   35 (93)
T ss_pred             HHhcCcHHHHHHHHHHHHHHHHHHHHH
Confidence            334578899999999999999987654


No 117
>PF10063 DUF2301:  Uncharacterized integral membrane protein (DUF2301);  InterPro: IPR019275  This family contains uncharacterised integral membrane proteins. 
Probab=25.03  E-value=1.3e+02  Score=25.34  Aligned_cols=37  Identities=14%  Similarity=0.098  Sum_probs=22.3

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcccccccccccCCccccceeec
Q psy9982          17 EIFLLVFLLLNVLSYILIEKFKRKDLEDYLSTDEDEATVYTV   58 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~~fkk~~~~~~~~~d~~da~V~~i   58 (222)
                      +++.||.+.--+.-.+-++||+..-.+     |-.|..||.+
T Consensus        99 ~~~~ll~~~~~L~~i~A~rK~~mPl~~-----DIGDKSvf~~  135 (135)
T PF10063_consen   99 VELALLGIWALLFLIFAIRKWRMPLHF-----DIGDKSVFQY  135 (135)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhCCCCCc-----ccCccccccC
Confidence            345555533333445667888866655     5678888763


No 118
>PRK09697 protein secretion protein GspB; Provisional
Probab=25.02  E-value=37  Score=28.38  Aligned_cols=21  Identities=24%  Similarity=0.091  Sum_probs=13.4

Q ss_pred             ccchhhHHHHHHHHHHHHHHH
Q psy9982          10 IGGTLTVEIFLLVFLLLNVLS   30 (222)
Q Consensus        10 ~~~~~~~iI~lLLF~~LYi~S   30 (222)
                      .-||+.++||||+..+.+.-+
T Consensus        24 ~~~TI~~Vi~L~~~~L~~AG~   44 (139)
T PRK09697         24 KHSTIIYVICLLLICLWFAGM   44 (139)
T ss_pred             hccchHHHHHHHHHHHHHhcc
Confidence            347778889988754444333


No 119
>PHA02909 hypothetical protein; Provisional
Probab=24.85  E-value=85  Score=23.44  Aligned_cols=14  Identities=50%  Similarity=0.688  Sum_probs=8.0

Q ss_pred             hhhHHHHHHHHHHH
Q psy9982          13 TLTVEIFLLVFLLL   26 (222)
Q Consensus        13 ~~~~iI~lLLF~~L   26 (222)
                      .++.||||-.|.+|
T Consensus        39 ilfviiflsmftil   52 (72)
T PHA02909         39 ILFVIIFLSMFTIL   52 (72)
T ss_pred             HHHHHHHHHHHHHH
Confidence            45556666666554


No 120
>PF03839 Sec62:  Translocation protein Sec62;  InterPro: IPR004728 Members of the NSCC2 family have been sequenced from various yeast, fungal and animals species including Saccharomyces cerevisiae, Drosophila melanogaster and Homo sapiens. These proteins are the Sec62 proteins, believed to be associated with the Sec61 and Sec63 constituents of the general protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins have been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.; GO: 0008565 protein transporter activity, 0015031 protein transport, 0016021 integral to membrane
Probab=24.65  E-value=55  Score=29.50  Aligned_cols=25  Identities=28%  Similarity=0.541  Sum_probs=0.0

Q ss_pred             chhhccchhhHH-HHHHHHHHHHHHH
Q psy9982           6 FLGLIGGTLTVE-IFLLVFLLLNVLS   30 (222)
Q Consensus         6 ~~~~~~~~~~~i-I~lLLF~~LYi~S   30 (222)
                      +|||||..+... |=++||++++++.
T Consensus       146 ~lgll~~~~~laivRlilf~i~w~~~  171 (224)
T PF03839_consen  146 ALGLLGLFFALAIVRLILFLITWFFT  171 (224)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHh


No 121
>COG5487 Small integral membrane protein [Function unknown]
Probab=24.63  E-value=87  Score=22.70  Aligned_cols=16  Identities=31%  Similarity=0.675  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHHHH
Q psy9982          18 IFLLVFLLLNVLSYIL   33 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~i   33 (222)
                      |.+.+|++|+++|.+.
T Consensus        33 IlF~i~~vlf~vsL~~   48 (54)
T COG5487          33 ILFFIFLVLFLVSLFA   48 (54)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            8888999999998654


No 122
>PRK09459 pspG phage shock protein G; Reviewed
Probab=24.62  E-value=1.3e+02  Score=23.30  Aligned_cols=36  Identities=31%  Similarity=0.468  Sum_probs=30.3

Q ss_pred             hhccchhhHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy9982           8 GLIGGTLTVEIFLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus         8 ~~~~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      .++||.+..+|=+|=.++|-++.-+++++++|+...
T Consensus        35 M~l~Gm~~lviKLLPWLil~~v~vW~~r~~~~~~~~   70 (76)
T PRK09459         35 MFLGGMFALMIKLLPWLLLAVVVVWVIRAIKAPKVP   70 (76)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccc
Confidence            457788888888999999999999999998887654


No 123
>PRK14094 psbM photosystem II reaction center protein M; Provisional
Probab=24.25  E-value=27  Score=24.92  Aligned_cols=11  Identities=27%  Similarity=0.537  Sum_probs=5.1

Q ss_pred             hhhccchhhHH
Q psy9982           7 LGLIGGTLTVE   17 (222)
Q Consensus         7 ~~~~~~~~~~i   17 (222)
                      ||+|...|+.+
T Consensus         6 lgfiAtaLFi~   16 (50)
T PRK14094          6 FGFVASLLFVG   16 (50)
T ss_pred             HHHHHHHHHHH
Confidence            55554444433


No 124
>PRK13707 conjugal transfer pilus assembly protein TraL; Provisional
Probab=23.69  E-value=67  Score=25.37  Aligned_cols=17  Identities=29%  Similarity=0.301  Sum_probs=11.9

Q ss_pred             HHHHHHHHHhhcccccc
Q psy9982          26 LNVLSYILIEKFKRKDL   42 (222)
Q Consensus        26 LYi~Sy~ii~~fkk~~~   42 (222)
                      +=++-+.+++|+|+...
T Consensus        51 ~g~~~~~~~r~lK~g~g   67 (101)
T PRK13707         51 AAVLVWFGIRKLKKGRG   67 (101)
T ss_pred             HHHHHHHHHHHHHcCCC
Confidence            33445778899887765


No 125
>PF03908 Sec20:  Sec20;  InterPro: IPR005606 Sec20 is a membrane glycoprotein associated with secretory pathway.
Probab=23.60  E-value=93  Score=23.45  Aligned_cols=18  Identities=39%  Similarity=0.674  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q psy9982          18 IFLLVFLLLNVLSYILIE   35 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~   35 (222)
                      |++.+++.+-++.|+|.+
T Consensus        73 i~~~~~~f~~~v~yI~~r   90 (92)
T PF03908_consen   73 IFFAFLFFLLVVLYILWR   90 (92)
T ss_pred             HHHHHHHHHHHHHHHhhh
Confidence            444444444445555544


No 126
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=23.56  E-value=74  Score=19.68  Aligned_cols=13  Identities=23%  Similarity=0.756  Sum_probs=8.0

Q ss_pred             HHHHHHHHHHHHH
Q psy9982          18 IFLLVFLLLNVLS   30 (222)
Q Consensus        18 I~lLLF~~LYi~S   30 (222)
                      ..++||++|-|+.
T Consensus         8 livVLFILLiIvG   20 (24)
T PF09680_consen    8 LIVVLFILLIIVG   20 (24)
T ss_pred             hHHHHHHHHHHhc
Confidence            3456777776653


No 127
>COG3339 Uncharacterized conserved protein [Function unknown]
Probab=23.30  E-value=63  Score=26.53  Aligned_cols=39  Identities=26%  Similarity=0.435  Sum_probs=28.4

Q ss_pred             CCccchhhccchhhHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982           2 FTPDFLGLIGGTLTVEIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus         2 ~~~~~~~~~~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      +.|||++.||-+==.+|+-+++..+--  |.+..+.++.++
T Consensus        66 iIPD~lp~iG~iDDi~V~~~~v~~i~~--~~~~~~~~~~a~  104 (116)
T COG3339          66 IIPDFLPVIGFIDDIAVLTLAVTAISK--YLLLEEHWEAAE  104 (116)
T ss_pred             hchhhhhccchHHHHHHHHHHHHHHHH--HHhhHHHHHHHH
Confidence            469999999976555566666655444  788888887775


No 128
>PF15347 PAG:  Phosphoprotein associated with glycosphingolipid-enriched
Probab=23.13  E-value=45  Score=32.76  Aligned_cols=22  Identities=27%  Similarity=0.413  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHHHHHHHhhccccc
Q psy9982          18 IFLLVFLLLNVLSYILIEKFKRKD   41 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~fkk~~   41 (222)
                      .||||-++|+++|=.  .|-||..
T Consensus        26 ~f~lis~LifLCsSC--~reKK~~   47 (428)
T PF15347_consen   26 TFLLISFLIFLCSSC--DREKKPK   47 (428)
T ss_pred             HHHHHHHHHHHhhcc--cccccCC
Confidence            455555455555444  4555555


No 129
>PF06837 Fijivirus_P9-2:  Fijivirus P9-2 protein;  InterPro: IPR009650 This family consists of several Fijivirus specific P9-2 proteins from Rice black streaked dwarf virus (RBSDV) and Fiji disease virus. The function of this family is unknown.
Probab=23.11  E-value=82  Score=28.36  Aligned_cols=17  Identities=29%  Similarity=0.368  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHHHhhcc
Q psy9982          22 VFLLLNVLSYILIEKFK   38 (222)
Q Consensus        22 LF~~LYi~Sy~ii~~fk   38 (222)
                      +|++|++++|+++-.|.
T Consensus       125 fy~~~~V~iyLv~~ffg  141 (214)
T PF06837_consen  125 FYTLLFVSIYLVYFFFG  141 (214)
T ss_pred             HHHHHHHHHHHHHHHhh
Confidence            33444455665554443


No 130
>PHA02975 hypothetical protein; Provisional
Probab=23.05  E-value=76  Score=24.08  Aligned_cols=11  Identities=27%  Similarity=0.341  Sum_probs=5.1

Q ss_pred             HHHHHHHHHHH
Q psy9982          17 EIFLLVFLLLN   27 (222)
Q Consensus        17 iI~lLLF~~LY   27 (222)
                      ++|+++|+.||
T Consensus        54 v~~~~~~~flY   64 (69)
T PHA02975         54 ITCIAVFTFLY   64 (69)
T ss_pred             HHHHHHHHHHH
Confidence            34444444444


No 131
>PHA02815 hypothetical protein; Provisional
Probab=23.02  E-value=64  Score=24.10  Aligned_cols=17  Identities=18%  Similarity=0.561  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy9982          16 VEIFLLVFLLLNVLSYI   32 (222)
Q Consensus        16 ~iI~lLLF~~LYi~Sy~   32 (222)
                      ..|++++|++||++=..
T Consensus         5 ~~I~~~~ylLl~Lv~ws   21 (64)
T PHA02815          5 IVIVISLYLLFQLVNCF   21 (64)
T ss_pred             EeHHHHHHHHHHHHHHH
Confidence            45899999999987443


No 132
>PF07178 TraL:  TraL protein;  InterPro: IPR009838 This entry represents bacterial TraL proteins. TraL is a predicted peripheral membrane protein involved in bacterial sex pilus assembly []. TraL is part of the type IV secretion system for conjugative plasmid transfer []. The exact function of TraL is unknown.; GO: 0000746 conjugation, 0019867 outer membrane
Probab=22.97  E-value=78  Score=24.22  Aligned_cols=24  Identities=25%  Similarity=0.365  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHHhhccccccc
Q psy9982          20 LLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus        20 lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      +++.+++=++...+++|+||....
T Consensus        39 ~~~g~i~g~~~~~~~~k~K~~~~~   62 (95)
T PF07178_consen   39 FLIGLILGIVLWWGYRKFKKGRGR   62 (95)
T ss_pred             HHHHHHHHHHHHHHHHHHHccCCc
Confidence            345566667778888999987764


No 133
>PF06667 PspB:  Phage shock protein B;  InterPro: IPR009554 This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages []. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one [].; GO: 0006355 regulation of transcription, DNA-dependent, 0009271 phage shock
Probab=22.54  E-value=84  Score=23.89  Aligned_cols=17  Identities=24%  Similarity=0.180  Sum_probs=9.5

Q ss_pred             HHHHHHHHHhhcccccc
Q psy9982          26 LNVLSYILIEKFKRKDL   42 (222)
Q Consensus        26 LYi~Sy~ii~~fkk~~~   42 (222)
                      ++|.=-+|+.||++|..
T Consensus        15 ifVap~WL~lHY~sk~~   31 (75)
T PF06667_consen   15 IFVAPIWLILHYRSKWK   31 (75)
T ss_pred             HHHHHHHHHHHHHHhcc
Confidence            34445566667665543


No 134
>PRK09702 PTS system arbutin-specific transporter subunit IIB; Provisional
Probab=22.51  E-value=1e+02  Score=26.30  Aligned_cols=25  Identities=40%  Similarity=0.280  Sum_probs=18.3

Q ss_pred             hhHH-HHHHHHHHHHHHHHHHHhhcc
Q psy9982          14 LTVE-IFLLVFLLLNVLSYILIEKFK   38 (222)
Q Consensus        14 ~~~i-I~lLLF~~LYi~Sy~ii~~fk   38 (222)
                      |..+ |-++.|++-|++-|++|++|.
T Consensus        10 ~~~i~iGl~~f~iYyfvF~flI~kfn   35 (161)
T PRK09702         10 LTQIAIGLCFTLLYFVVFRTLILQFN   35 (161)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHcC
Confidence            4444 555667778888999999994


No 135
>PF10864 DUF2663:  Protein of unknown function (DUF2663);  InterPro: IPR020210 This entry represents a group of uncharacterised transmembrane proteins.
Probab=22.41  E-value=43  Score=28.06  Aligned_cols=24  Identities=29%  Similarity=0.398  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHHhhccccccc
Q psy9982          20 LLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus        20 lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      .|+++++.+.+|..+..|||++|.
T Consensus        60 ~l~~ll~~~~~~~~~~~~~kK~eK   83 (130)
T PF10864_consen   60 HLFWLLALAFSYWAMYYLKKKEEK   83 (130)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhHHH
Confidence            456667777888888888888874


No 136
>PF05978 UNC-93:  Ion channel regulatory protein UNC-93;  InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans. UNC-93 colocalizes with SUP-10 and SUP-9 within muscle cells. Genetic studies suggest that these three proteins forms complex that coordinates muscle contraction. The function of UNC-93 is not known but is most likely an ion channel regulatory protein [].
Probab=22.36  E-value=60  Score=27.09  Aligned_cols=32  Identities=16%  Similarity=0.350  Sum_probs=21.2

Q ss_pred             CCccchhhccchhhHHHHHHHHHHHHHHHHHHH
Q psy9982           2 FTPDFLGLIGGTLTVEIFLLVFLLLNVLSYILI   34 (222)
Q Consensus         2 ~~~~~~~~~~~~~~~iI~lLLF~~LYi~Sy~ii   34 (222)
                      |+|-++.++|.=.+.+|..++|+ +|+++++-.
T Consensus        56 ~~P~iv~~lg~K~sm~lg~~~y~-~y~~~~~~~   87 (156)
T PF05978_consen   56 FAPSIVNKLGPKWSMILGSLGYA-IYIASFFYP   87 (156)
T ss_pred             hHHHHHHHHhhHHHHHHHHHHHH-HHHHHHHhh
Confidence            45556677777777777777665 677776544


No 137
>PRK04778 septation ring formation regulator EzrA; Provisional
Probab=22.17  E-value=70  Score=31.73  Aligned_cols=28  Identities=7%  Similarity=0.156  Sum_probs=19.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          15 TVEIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        15 ~~iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      +.||.++|.+++|++.|++=+++.|+=+
T Consensus         5 ~ii~i~ii~i~~~~~~~~~rr~~~~~i~   32 (569)
T PRK04778          5 LIIAIVVIIIIAYLAGLILRKRNYKRID   32 (569)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4456667778888888877777666544


No 138
>COG1585 Membrane protein implicated in regulation of membrane protease activity [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=22.02  E-value=87  Score=25.96  Aligned_cols=25  Identities=32%  Similarity=0.506  Sum_probs=20.7

Q ss_pred             HHHHHHHHHHHHHHHHHHhhccccc
Q psy9982          17 EIFLLVFLLLNVLSYILIEKFKRKD   41 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~~fkk~~   41 (222)
                      .+-+++|++|-+++.++.++|.|+-
T Consensus        48 ~~q~v~f~~lsv~~~~l~rr~~~~~   72 (140)
T COG1585          48 WLQLVLFAILSVLLALLGRRFVRRR   72 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            3567789999999999999998863


No 139
>PTZ00404 cytochrome P450; Provisional
Probab=22.00  E-value=95  Score=28.97  Aligned_cols=27  Identities=15%  Similarity=0.257  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHHHHHHhhccccccc
Q psy9982          17 EIFLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus        17 iI~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      +.|.|||..||.+-....++|+|+...
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~   29 (482)
T PTZ00404          3 LFNIILFLFIFYIIHNAYKKYKKIHKN   29 (482)
T ss_pred             hHHHHHHHHHHHHHHHHHHHhhhccCC
Confidence            457778888888866777777765543


No 140
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=21.87  E-value=1.1e+02  Score=24.44  Aligned_cols=29  Identities=21%  Similarity=0.224  Sum_probs=21.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhcccccccc
Q psy9982          16 VEIFLLVFLLLNVLSYILIEKFKRKDLED   44 (222)
Q Consensus        16 ~iI~lLLF~~LYi~Sy~ii~~fkk~~~~~   44 (222)
                      ..||.||++++-+.+-+.-+..||++...
T Consensus         4 l~il~llLll~l~asl~~wr~~~rq~k~~   32 (107)
T PF15330_consen    4 LGILALLLLLSLAASLLAWRMKQRQKKAG   32 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhcccc
Confidence            46888888888787777777777777763


No 141
>PRK09458 pspB phage shock protein B; Provisional
Probab=21.78  E-value=1.1e+02  Score=23.55  Aligned_cols=16  Identities=19%  Similarity=0.125  Sum_probs=10.1

Q ss_pred             HHHHHHHHhhcccccc
Q psy9982          27 NVLSYILIEKFKRKDL   42 (222)
Q Consensus        27 Yi~Sy~ii~~fkk~~~   42 (222)
                      +|.=-+|+.||+.|..
T Consensus        16 fVaPiWL~LHY~sk~~   31 (75)
T PRK09458         16 FVAPIWLWLHYRSKRQ   31 (75)
T ss_pred             HHHHHHHHHhhccccc
Confidence            4455677778876544


No 142
>PF12768 Rax2:  Cortical protein marker for cell polarity
Probab=21.72  E-value=1.2e+02  Score=27.97  Aligned_cols=25  Identities=24%  Similarity=0.276  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          18 IFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      -|-|-.+.|-++.++|+.+++||++
T Consensus       235 AiALG~v~ll~l~Gii~~~~~r~~~  259 (281)
T PF12768_consen  235 AIALGTVFLLVLIGIILAYIRRRRQ  259 (281)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            3445556667778888888888855


No 143
>PHA02867 C-type lectin protein; Provisional
Probab=21.55  E-value=63  Score=27.79  Aligned_cols=19  Identities=26%  Similarity=0.354  Sum_probs=15.0

Q ss_pred             chhhHHHHHHHHHHHHHHH
Q psy9982          12 GTLTVEIFLLVFLLLNVLS   30 (222)
Q Consensus        12 ~~~~~iI~lLLF~~LYi~S   30 (222)
                      -|+..+|+|+||++|=|+.
T Consensus        17 ~~~~~~~~~~~~~~~~v~~   35 (167)
T PHA02867         17 ITVLGILCLILFTILVVVT   35 (167)
T ss_pred             hHHHHHHHHHHHHHhhhee
Confidence            4777889999999887664


No 144
>PF00558 Vpu:  Vpu protein;  InterPro: IPR008187 The Human immunodeficiency virus 1 (HIV-1) Vpu protein acts in the degradation of CD4 in the endoplasmic reticulum and in the enhancement of virion release from the plasma membrane of infected cells [].; GO: 0019076 release of virus from host; PDB: 2JPX_A 1PI8_A 2GOH_A 2GOF_A 1PI7_A 1PJE_A 1VPU_A 2K7Y_A.
Probab=21.52  E-value=84  Score=24.40  Aligned_cols=34  Identities=21%  Similarity=0.317  Sum_probs=14.0

Q ss_pred             ccchhhHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy9982          10 IGGTLTVEIFLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus        10 ~~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      |-+.+..++.+++-+++..+.|.--++-||..+.
T Consensus         6 i~~iialiv~~iiaIvvW~iv~ieYrk~~rqrkI   39 (81)
T PF00558_consen    6 ILAIIALIVALIIAIVVWTIVYIEYRKIKRQRKI   39 (81)
T ss_dssp             --HHHHHHHHHHHHHHHHHHH------------C
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhH
Confidence            3455666677777777777777777777777773


No 145
>PF05620 DUF788:  Protein of unknown function (DUF788);  InterPro: IPR008506 This family consists of several eukaryotic proteins of unknown function.
Probab=21.45  E-value=1.2e+02  Score=25.57  Aligned_cols=27  Identities=26%  Similarity=0.400  Sum_probs=22.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhcccccc
Q psy9982          16 VEIFLLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        16 ~iI~lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      .++.++|+.+++++||.+|.+.-|..-
T Consensus        47 ~~~~~~~~~~~~~~~~~~l~~~~rp~~   73 (170)
T PF05620_consen   47 SWFGYLLFSLPAIFCYYFLEKMARPKY   73 (170)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhCCCCc
Confidence            677788899999999999999887553


No 146
>PF09125 COX2-transmemb:  Cytochrome C oxidase subunit II, transmembrane;  InterPro: IPR015209 This N-terminal domain forms the transmembrane region in subunit II of cytochrome c oxidase from Thermus thermophilus. This domain adopts a tertiary structure consisting of two antiparallel transmembrane helices, in a transmembrane helix hairpin fold []. ; PDB: 1EHK_B 2QPE_B 3S8F_B 4EV3_B 3BVD_B 3S8G_B 3EH3_B 3S3C_B 3S39_B 3QJQ_B ....
Probab=21.39  E-value=1.1e+02  Score=20.72  Aligned_cols=9  Identities=22%  Similarity=0.589  Sum_probs=5.4

Q ss_pred             HHHHHHHhh
Q psy9982          28 VLSYILIEK   36 (222)
Q Consensus        28 i~Sy~ii~~   36 (222)
                      +++|.+.+|
T Consensus        30 li~ytl~th   38 (38)
T PF09125_consen   30 LIGYTLATH   38 (38)
T ss_dssp             HHHHHHHSG
T ss_pred             HHHHHHhcC
Confidence            366766654


No 147
>PF10954 DUF2755:  Protein of unknown function (DUF2755);  InterPro: IPR020513 This entry contains membrane proteins with no known function.; GO: 0016021 integral to membrane
Probab=21.39  E-value=88  Score=25.15  Aligned_cols=33  Identities=27%  Similarity=0.202  Sum_probs=23.0

Q ss_pred             hhhccchhhHHHHHHHHHHHHHHHHHHHhhcccc
Q psy9982           7 LGLIGGTLTVEIFLLVFLLLNVLSYILIEKFKRK   40 (222)
Q Consensus         7 ~~~~~~~~~~iI~lLLF~~LYi~Sy~ii~~fkk~   40 (222)
                      +||--||++-+|=+ |+.|+.+.--.+|.|+|++
T Consensus        67 igl~VgTlFgLiPF-L~Gc~~~~v~~l~lrwr~r   99 (100)
T PF10954_consen   67 IGLGVGTLFGLIPF-LAGCLILGVIALILRWRHR   99 (100)
T ss_pred             EeehhHHHHHHHHH-HHHHHHHHHHHHHHHHHhc
Confidence            46777888877765 4677777666677777765


No 148
>PHA02650 hypothetical protein; Provisional
Probab=21.23  E-value=85  Score=24.49  Aligned_cols=10  Identities=20%  Similarity=0.703  Sum_probs=3.7

Q ss_pred             HHHHHhhccc
Q psy9982          30 SYILIEKFKR   39 (222)
Q Consensus        30 Sy~ii~~fkk   39 (222)
                      +++.++-.||
T Consensus        66 ~flYLK~~~r   75 (81)
T PHA02650         66 SFFVFKGYTR   75 (81)
T ss_pred             HHHHHHHhcc
Confidence            3333333343


No 149
>PF03208 PRA1:  PRA1 family protein;  InterPro: IPR004895 This family includes yeast hypothetical proteins and the uncharacterised rat prenylated rab acceptor protein PRA1.
Probab=21.18  E-value=93  Score=24.98  Aligned_cols=20  Identities=20%  Similarity=0.009  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHh
Q psy9982          16 VEIFLLVFLLLNVLSYILIE   35 (222)
Q Consensus        16 ~iI~lLLF~~LYi~Sy~ii~   35 (222)
                      .+++.+++.++.++.|+.++
T Consensus       118 ~l~~~l~~~~~lvl~HA~~r  137 (153)
T PF03208_consen  118 TLFWSLGASVLLVLLHASFR  137 (153)
T ss_pred             HHHHHHHHHHHHHHHHHHhc
Confidence            34455555555566666554


No 150
>PF06678 DUF1179:  Protein of unknown function (DUF1179);  InterPro: IPR009564 This family consists of several hypothetical Caenorhabditis elegans proteins of around 106 residues in length. The function of the family is unknown.
Probab=21.14  E-value=3.8e+02  Score=21.83  Aligned_cols=20  Identities=15%  Similarity=0.004  Sum_probs=8.1

Q ss_pred             HHHHHHHHHHHHhhccccccc
Q psy9982          23 FLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus        23 F~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      |+..+++...|+.-. +|+.|
T Consensus        14 ~g~~lll~~~iv~C~-sKKKF   33 (103)
T PF06678_consen   14 FGPFLLLIVSIVQCQ-SKKKF   33 (103)
T ss_pred             hhHHHHHHHHHHHhh-hcccc
Confidence            333334444444332 44444


No 151
>PHA02819 hypothetical protein; Provisional
Probab=21.13  E-value=88  Score=23.88  Aligned_cols=9  Identities=22%  Similarity=1.032  Sum_probs=3.3

Q ss_pred             HHHHHHHHH
Q psy9982          19 FLLVFLLLN   27 (222)
Q Consensus        19 ~lLLF~~LY   27 (222)
                      |++||+.||
T Consensus        58 ~~~~~~flY   66 (71)
T PHA02819         58 FVIIFIIFY   66 (71)
T ss_pred             HHHHHHHHH
Confidence            333333333


No 152
>PTZ00358 hypothetical protein; Provisional
Probab=21.08  E-value=1.2e+02  Score=29.45  Aligned_cols=38  Identities=24%  Similarity=0.425  Sum_probs=24.3

Q ss_pred             chhhccchhhH---------------------HHHHHHHHHHHHHHHHHHhhccccccc
Q psy9982           6 FLGLIGGTLTV---------------------EIFLLVFLLLNVLSYILIEKFKRKDLE   43 (222)
Q Consensus         6 ~~~~~~~~~~~---------------------iI~lLLF~~LYi~Sy~ii~~fkk~~~~   43 (222)
                      .||+.|||+.|                     .|.+.|-+++-+..-.-+.+|..++++
T Consensus       116 lL~ILggTLyCGWKCnLFcRPCCkSQyiCYgSaiVvVLviL~vlavt~sl~~~~~~~~~  174 (367)
T PTZ00358        116 LLGILGGTLYCGWKCNLFCRPCCKSQYICYGSAIVVVLVILIVLAVTASLIAFVGRSEF  174 (367)
T ss_pred             HHHHHHhhhhcccccCcccccccccceeeehhhHHHHHHHHHHHHHHHHHHHHhCCCcc
Confidence            47889999875                     255555555555555566677766654


No 153
>PHA03049 IMV membrane protein; Provisional
Probab=21.05  E-value=1.2e+02  Score=22.91  Aligned_cols=23  Identities=17%  Similarity=0.452  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHHHHhhcccccc
Q psy9982          20 LLVFLLLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        20 lLLF~~LYi~Sy~ii~~fkk~~~   42 (222)
                      +|+-+|+=|+.-++-.-|+|+.+
T Consensus         6 ~l~iICVaIi~lIvYgiYnkk~~   28 (68)
T PHA03049          6 ILVIICVVIIGLIVYGIYNKKTT   28 (68)
T ss_pred             HHHHHHHHHHHHHHHHHHhcccc
Confidence            33344444444455555555554


No 154
>PHA03054 IMV membrane protein; Provisional
Probab=20.97  E-value=89  Score=23.91  Aligned_cols=9  Identities=33%  Similarity=0.674  Sum_probs=3.3

Q ss_pred             HHHHHHHHH
Q psy9982          19 FLLVFLLLN   27 (222)
Q Consensus        19 ~lLLF~~LY   27 (222)
                      |++||+.||
T Consensus        60 ~~~l~~flY   68 (72)
T PHA03054         60 ILLLLIYLY   68 (72)
T ss_pred             HHHHHHHHH
Confidence            333333333


No 155
>PF11466 Doppel:  Prion-like protein Doppel;  InterPro: IPR021566  Dpl is a homologue related to the prion protein (PrP). Dpl is toxic to neurons and is expressed in the brains of mice that do not express PrP. In DHPC and SDS micelles, Dpl shoes about 40% alpha-helical structure however in aqueous solution it consists of a random coil. The alpha helical segment can adopt a transmembrane localisation also in a membrane. The unprocessed Dpl protein is thought to posses a possible channel formation mechanism which may be related to toxicity through direct interaction with cell membranes and damage to the cell membrane. ; PDB: 1Z65_A.
Probab=20.74  E-value=77  Score=20.52  Aligned_cols=17  Identities=29%  Similarity=0.487  Sum_probs=11.5

Q ss_pred             ccchhhHHHHHHHHHHH
Q psy9982          10 IGGTLTVEIFLLVFLLL   26 (222)
Q Consensus        10 ~~~~~~~iI~lLLF~~L   26 (222)
                      +|+-.--|.|+|||-=|
T Consensus         5 Lg~~~lAi~c~LL~s~L   21 (30)
T PF11466_consen    5 LGGWWLAIVCVLLFSHL   21 (30)
T ss_dssp             -SSHHHHHHHHHHHHHT
T ss_pred             hhhHHHHHHHHHHHHHh
Confidence            45666678888888644


No 156
>PF11045 YbjM:  Putative inner membrane protein of Enterobacteriaceae;  InterPro: IPR020368 This entry contains membrane proteins with no known function.; GO: 0016021 integral to membrane
Probab=20.69  E-value=86  Score=26.18  Aligned_cols=18  Identities=11%  Similarity=0.224  Sum_probs=13.9

Q ss_pred             hhHHHHHHHHHHHHHHHH
Q psy9982          14 LTVEIFLLVFLLLNVLSY   31 (222)
Q Consensus        14 ~~~iI~lLLF~~LYi~Sy   31 (222)
                      +..|.|++||+++++.--
T Consensus         8 ~g~i~cfvLf~vVfl~~~   25 (125)
T PF11045_consen    8 AGVICCFVLFIVVFLFLK   25 (125)
T ss_pred             hHHHHHHHHHHHHHHHhh
Confidence            467889999998887643


No 157
>PHA02681 ORF089 virion membrane protein; Provisional
Probab=20.57  E-value=81  Score=25.02  Aligned_cols=27  Identities=22%  Similarity=0.386  Sum_probs=12.8

Q ss_pred             hhccchhhHHHHHHHHHHHHHHHHHHHhhcc
Q psy9982           8 GLIGGTLTVEIFLLVFLLLNVLSYILIEKFK   38 (222)
Q Consensus         8 ~~~~~~~~~iI~lLLF~~LYi~Sy~ii~~fk   38 (222)
                      ||+-..|+.|+..+++.++|    .+-+|+.
T Consensus         2 gl~Da~~~~V~V~IVclliy----a~YRR~~   28 (92)
T PHA02681          2 GLLDALLTVIVISIVCYIVI----MMYRRSC   28 (92)
T ss_pred             chHHHHHHHHHHHHHHHHHH----HHHHhcc
Confidence            66666666443333333333    3345555


No 158
>PF00430 ATP-synt_B:  ATP synthase B/B' CF(0);  InterPro: IPR002146 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunits B and B' from the F0 complex in F-ATPases found in chloroplasts and in bacterial plasma membranes. The B subunits are part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In bacterial and chloroplast F-ATPases, the peripheral stalk is composed of one copy of the delta subunit (homologous to OSCP in mitochondria), and two copies of subunit B in bacteria, or one copy each of subunits B and B' in chloroplasts and photosynthetic bacteria []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0045263 proton-transporting ATP synthase complex, coupling factor F(o); PDB: 1L2P_A 2KHK_A 1B9U_A.
Probab=20.46  E-value=1.2e+02  Score=23.19  Aligned_cols=7  Identities=0%  Similarity=0.078  Sum_probs=1.7

Q ss_pred             hcccccc
Q psy9982          36 KFKRKDL   42 (222)
Q Consensus        36 ~fkk~~~   42 (222)
                      -+.+|++
T Consensus        27 ~l~~R~~   33 (132)
T PF00430_consen   27 FLDERKA   33 (132)
T ss_dssp             HCS--S-
T ss_pred             HHHHHHH
Confidence            3444444


No 159
>PF11845 DUF3365:  Protein of unknown function (DUF3365);  InterPro: IPR021796  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 198 to 657 amino acids in length. 
Probab=20.46  E-value=72  Score=26.12  Aligned_cols=21  Identities=24%  Similarity=0.423  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHHHHHHHHhhcc
Q psy9982          18 IFLLVFLLLNVLSYILIEKFK   38 (222)
Q Consensus        18 I~lLLF~~LYi~Sy~ii~~fk   38 (222)
                      |++|||++|.++.++...+.+
T Consensus         2 ~~~ll~~~~~~~~~~~~~~~~   22 (188)
T PF11845_consen    2 IVALLFVILFLALFISYSQQQ   22 (188)
T ss_pred             hHHHHHHHHHHHHHHHHHHHH
Confidence            444555555555555444433


No 160
>PF05821 NDUF_B8:  NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI or NDUFB8);  InterPro: IPR008699  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family consists of several eukaryotic NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI) proteins. NADH:ubiquinone oxidoreductase (complex I) is an extremely complicated multiprotein complex located in the inner mitochondrial membrane. Its main function is the transport of electrons from NADH to ubiquinone, which is accompanied by translocation of protons from the mitochondrial matrix to the intermembrane space. Human complex I appears to consist of 41 subunits [].; GO: 0003954 NADH dehydrogenase activity, 0008137 NADH dehydrogenase (ubiquinone) activity, 0005739 mitochondrion
Probab=20.27  E-value=1.2e+02  Score=26.32  Aligned_cols=37  Identities=22%  Similarity=0.312  Sum_probs=20.5

Q ss_pred             CCCccchhhccchh---hHHHHHHHHHHHHHHHHHHHhhc
Q psy9982           1 MFTPDFLGLIGGTL---TVEIFLLVFLLLNVLSYILIEKF   37 (222)
Q Consensus         1 ~~~~~~~~~~~~~~---~~iI~lLLF~~LYi~Sy~ii~~f   37 (222)
                      |+++|.+......+   ..+++|++|+.+-++.|.+...|
T Consensus       106 m~s~dr~d~~~~~~~w~~~~~~l~~flg~~~~~~~~~~~~  145 (179)
T PF05821_consen  106 MYSPDRYDTSPTPVSWQSMLKQLFGFLGFMLFMFYLGEMY  145 (179)
T ss_pred             ceeecccccCCCcccHHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            45666555433222   34566666666666666666554


No 161
>PF11359 gpUL132:  Glycoprotein UL132;  InterPro: IPR021023  Glycoprotein UL132 is a low-abundance structural component of Human herpesvirus 5 []. The function of this protein is not fully understood. 
Probab=20.27  E-value=88  Score=28.61  Aligned_cols=9  Identities=11%  Similarity=-0.097  Sum_probs=4.9

Q ss_pred             HHHHHHHHH
Q psy9982          22 VFLLLNVLS   30 (222)
Q Consensus        22 LF~~LYi~S   30 (222)
                      |+..||..|
T Consensus        70 tvaalYsSC   78 (235)
T PF11359_consen   70 TVAALYSSC   78 (235)
T ss_pred             HHHHHHHHH
Confidence            445556555


No 162
>PF07019 Rab5ip:  Rab5-interacting protein (Rab5ip)
Probab=20.23  E-value=1e+02  Score=22.66  Aligned_cols=18  Identities=17%  Similarity=-0.025  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHhhcccccc
Q psy9982          25 LLNVLSYILIEKFKRKDL   42 (222)
Q Consensus        25 ~LYi~Sy~ii~~fkk~~~   42 (222)
                      +..++++++..++++.++
T Consensus        35 ~~~~~s~~~~~~~~~~~~   52 (81)
T PF07019_consen   35 SSFLVSLLYYAKAGFPDE   52 (81)
T ss_pred             HHHHHHHHHHHHhcCChh
Confidence            334455566666666554


No 163
>PF07219 HemY_N:  HemY protein N-terminus;  InterPro: IPR010817 This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins. These are membrane protein involved in a late step of protoheme IX synthesis [].
Probab=20.19  E-value=1.3e+02  Score=23.25  Aligned_cols=20  Identities=30%  Similarity=0.564  Sum_probs=9.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHH
Q psy9982          15 TVEIFLLVFLLLNVLSYILI   34 (222)
Q Consensus        15 ~~iI~lLLF~~LYi~Sy~ii   34 (222)
                      +.++++++|++||++--+|.
T Consensus        19 ~~~~l~~~~~~l~ll~~ll~   38 (108)
T PF07219_consen   19 ALILLLLLFVVLYLLLRLLR   38 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            33445555555555544443


Done!