Diaphorina citri psyllid: psy9982


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MFTPDFLGLIGGTLTVEIFLLVFLLLNVLSYILIEKFKRKDLEDYLSTDEDEATVYTVSPAYTQVSPAYTQVSPAYTQVSPAYTQVSPAYIPVSPAYTPVSPAYTQVSPAYTQVSPAYTQVSPAYTQVSLAYTQVSLAYTQVSPAYTQVSPAYTQVSPAYTQVSSAYTQVILNKIRPGRESNSRSSAYEAFFHEWVWMSWYPDINPTLPIAMGVHCHDSKDK
cccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**TPDFLGLIGGTLTVEIFLLVFLLLNVLSYILIEK***********************************************************************************************************************V*P***************************************MSWYPDINPTLPIAMGVHC******
xxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTPDFLGLIGGTLTVEIFLLVFLLLNVLSYILIEKFKRKDLEDYLSTDEDEATVYTVSPAYTQVSPAYTQVSPAYTQVSPAYTQVSPAYIPVSPAYTPVSPAYTQVSPAYTQVSPAYTQVSPAYTQVSLAYTQVSLAYTQVSPAYTQVSPAYTQVSPAYTQVSSAYTQVILNKIRPGRESNSRSSAYEAFFHEWVWMSWYPDINPTLPIAMGVHCHDSKDK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030312 [CC]external encapsulating structureprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623
GO:0003674 [MF]molecular_functionprobable
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RDD, chain B
Confidence level:probable
Coverage over the Query: 15-42
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1twf, chain Avery confident Alignment | Template Structure
1twf, chain Avery confident Alignment | Template Structure