BLAST/PSIBLAST alignment of GI: 254780122 and GI: 254781220 at iteration 1
>gi|254781220|ref|YP_003065633.1| hypothetical protein CLIBASIA_05635 [Candidatus Liberibacter asiaticus str. psy62] Length = 130
>gi|254040897|gb|ACT57693.1| hypothetical protein CLIBASIA_05635 [Candidatus Liberibacter asiaticus str. psy62] Length = 130
>gi|317120684|gb|ADV02507.1| hypothetical protein SC1_gp135 [Liberibacter phage SC1] Length = 130
>gi|317120726|gb|ADV02548.1| hypothetical protein SC2_gp135 [Liberibacter phage SC2] Length = 130
>gi|317120787|gb|ADV02608.1| hypothetical protein SC2_gp135 [Liberibacter phage SC2] Length = 130
>gi|317120828|gb|ADV02649.1| hypothetical protein SC1_gp135 [Liberibacter phage SC1] Length = 130
 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 69/135 (51%), Gaps = 17/135 (12%)

Query: 1   MGALKNHFHDEINENFYFHSHPNA----DPDISIEMQISENQRYLDEEISQCNAVVDVFK 56
           MG LK ++ +EI  N+ F S  N     +P+ + E+++ E    L+  +     ++    
Sbjct: 1   MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEK---LERALKTSKKLIHFRD 57

Query: 57  RSDST-ILDKLDAMDDLKTYISLLQATAKNLKSLL---KEYW----EESLDGEDDEEIYE 108
           R+  T IL+  D ++++   I L +A  + L+  +    E W    E   D E  E   E
Sbjct: 58  RTIRTHILE--DLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSE 115

Query: 109 HPDQEHREDYYANQI 123
           HPDQEH+EDYYA+QI
Sbjct: 116 HPDQEHKEDYYASQI 130