BLAST/PSIBLAST alignment of GI: 254780122 and GI: 315121961 at iteration 1
>gi|315121961|ref|YP_004062450.1| hypothetical protein CKC_01055 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 128
>gi|315122929|ref|YP_004063418.1| hypothetical protein CKC_05925 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 128
>gi|313495363|gb|ADR51962.1| hypothetical protein CKC_01055 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 128
>gi|313496331|gb|ADR52930.1| hypothetical protein CKC_05925 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 128
 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 81/129 (62%), Gaps = 7/129 (5%)

Query: 1   MGALKNHFHDEINENFYFHSHPNA------DPDISIEMQISENQRYLDEEISQCNAVVDV 54
           MG LK H+ +EI  N+ F+   N       +P+ SI+ ++ E  R LD+    C  +V  
Sbjct: 1   MGKLKQHYMEEIEANYEFNCLNNPRFNLDPEPEPSIKEEVEELIRSLDQRFLWCCDLVRD 60

Query: 55  FKRSDSTILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEH 114
            +RSD TILDKLDAM++++ Y+S+L+ TA  L+ LLKE   E  + E +EE  EHPDQEH
Sbjct: 61  LQRSDYTILDKLDAMEEMRMYLSVLRPTANRLEDLLKES-WEEPEKEPEEEPREHPDQEH 119

Query: 115 REDYYANQI 123
            + YYA+QI
Sbjct: 120 ADAYYADQI 128