RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780122|ref|YP_003064535.1| hypothetical protein
CLIBASIA_00005 [Candidatus Liberibacter asiaticus str. psy62]
         (123 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 34.5 bits (79), Expect = 0.006
 Identities = 24/158 (15%), Positives = 52/158 (32%), Gaps = 57/158 (36%)

Query: 6   NHFHDEI---NENFYFHS---HPNADPDISIEMQISENQRYLDEEISQCNAVVDVF-KRS 58
             F +     N+    H+       + D ++     + +  +   I+        F K+S
Sbjct: 89  TEFENCYLEGND---IHALAAKLLQENDTTL----VKTKELIKNYITARIMAKRPFDKKS 141

Query: 59  DSTILD-------KL-----------DAMDDLK----TYISLL----QATAKNLKSLLKE 92
           +S +         +L           D  ++L+    TY  L+    + +A+ L  L++ 
Sbjct: 142 NSALFRAVGEGNAQLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIR- 200

Query: 93  YWEESLDGEDDEEIY----------EHPDQEHREDYYA 120
                    D E+++          E+P     +DY  
Sbjct: 201 ------TTLDAEKVFTQGLNILEWLENPSNTPDKDYLL 232



 Score = 30.7 bits (69), Expect = 0.082
 Identities = 14/125 (11%), Positives = 35/125 (28%), Gaps = 34/125 (27%)

Query: 7   HFH-DEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDSTILDK 65
            F   ++ E F     P      +            D+E +      ++  +    +   
Sbjct: 27  FFIASQLQEQFN-KILPEPTEGFA-----------ADDEPT---TPAELVGKFLGYVSSL 71

Query: 66  LDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGED----------DEEIYEHPDQEHR 115
           ++    +  +  +L          L E+    L+G D          + +      +E  
Sbjct: 72  VEP-SKVGQFDQVL-------NLCLTEFENCYLEGNDIHALAAKLLQENDTTLVKTKELI 123

Query: 116 EDYYA 120
           ++Y  
Sbjct: 124 KNYIT 128


>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding,
           protein folding, acetylation, ATP-binding, cell inner
           membrane; NMR {Escherichia coli}
          Length = 605

 Score = 30.5 bits (69), Expect = 0.098
 Identities = 11/87 (12%), Positives = 26/87 (29%), Gaps = 11/87 (12%)

Query: 31  EMQISENQRYLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQATAKNLKSLL 90
           ++ I  +    ++EI +     +    +D    + +   +     +   +   +     L
Sbjct: 498 KITIKASSGLNEDEIQKMVRDAEANAEADRKFDELVQTRNQGDHLLHSTRKQVEEAGDKL 557

Query: 91  KE-----------YWEESLDGEDDEEI 106
                          E +L GED   I
Sbjct: 558 PADDKTAIESALTALETALKGEDKAAI 584


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
          photosynthetic reaction center, peripheral antenna;
          HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 28.0 bits (61), Expect = 0.51
 Identities = 8/18 (44%), Positives = 12/18 (66%), Gaps = 1/18 (5%)

Query: 80 QATAKNLKSLLKEYWEES 97
          QA  K L++ LK Y ++S
Sbjct: 20 QAL-KKLQASLKLYADDS 36


>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genomics,
           joint center for structural genomics, JCSG; HET: MSE
           UNL; 1.46A {Listeria monocytogenes str}
          Length = 179

 Score = 26.5 bits (57), Expect = 1.5
 Identities = 11/45 (24%), Positives = 16/45 (35%)

Query: 70  DDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEH 114
            D      L+  TA+ LK      W + L G D   I +  +   
Sbjct: 22  TDRLKINDLMIDTARWLKESGSTQWSDILHGFDVHNIEQRIELGE 66


>1x38_A Beta-D-glucan exohydrolase isoenzyme EXOI; 2-domain fold,
           ligand-protein complex; HET: NAG BMA FUC MAN IDD GOL;
           1.70A {Hordeum vulgare} SCOP: c.1.8.7 c.23.11.1 PDB:
           1lq2_A* 1x39_A* 1ex1_A* 1ieq_A* 1iev_A* 1iew_A* 1iex_A*
           1j8v_A*
          Length = 602

 Score = 26.1 bits (56), Expect = 2.0
 Identities = 13/92 (14%), Positives = 34/92 (36%), Gaps = 2/92 (2%)

Query: 25  DPDISIEMQISE--NQRYLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQAT 82
           D    +E ++++   +  L E+I Q   +  +    D    + + ++      +    AT
Sbjct: 7   DATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGAT 66

Query: 83  AKNLKSLLKEYWEESLDGEDDEEIYEHPDQEH 114
           AK  + ++  + +  +       +    D  H
Sbjct: 67  AKEWQDMVDGFQKACMSTRLGIPMIYGIDAVH 98


>3mfn_A Uncharacterized protein; structural genomics, unknown function,
          PSI-2, protein structure initiative; HET: MSE; 2.02A
          {Dyadobacter fermentans}
          Length = 157

 Score = 25.2 bits (54), Expect = 3.9
 Identities = 10/30 (33%), Positives = 16/30 (53%)

Query: 14 ENFYFHSHPNADPDISIEMQISENQRYLDE 43
          EN YF  H     ++S +  + E +RYL+ 
Sbjct: 15 ENLYFQGHMIKKQELSAQEAVIEAKRYLNN 44


>2p5z_X Type VI secretion system component; structural genomics, unknown
           function, PSI-2, protein structure initiative; 2.60A
           {Escherichia coli O6} SCOP: b.40.8.1 b.106.1.1 b.106.1.1
          Length = 491

 Score = 24.7 bits (53), Expect = 6.4
 Identities = 5/16 (31%), Positives = 8/16 (50%)

Query: 100 GEDDEEIYEHPDQEHR 115
                +IY H D++ R
Sbjct: 393 STVKNDIYAHIDKDGR 408


>1xq8_A Alpha-synuclein; micelle-bound helix, lipid binding protein; NMR
           {Homo sapiens} SCOP: h.7.1.1
          Length = 140

 Score = 24.5 bits (53), Expect = 7.0
 Identities = 12/35 (34%), Positives = 18/35 (51%)

Query: 84  KNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDY 118
           KN +   +E   E +  + D E YE P +E  +DY
Sbjct: 102 KNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDY 136


>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, joint
           center for structural genomics, JCSG, protein structure
           initiative; HET: ATP PG4; 2.10A {Thermotoga maritima
           MSB8}
          Length = 515

 Score = 24.1 bits (52), Expect = 8.4
 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 52  VDVFKRSDSTILDKL-----DAMDDLKTYISLLQATAKNLKSLLKEY 93
           V+  +R +   L  +     D +DD+KT   L   T + LK  ++E+
Sbjct: 463 VEEVRRFEKEFLRFMHEKHQDILDDIKTKKELTSETEEKLKKAIEEF 509


>2w31_A Globin; oxygen transport, hexacoordination; HET: HEM; 1.50A
           {Geobacter sulfurreducens}
          Length = 162

 Score = 24.2 bits (52), Expect = 9.1
 Identities = 10/80 (12%), Positives = 29/80 (36%), Gaps = 5/80 (6%)

Query: 33  QISENQRYLDEEISQCNAVVDVFKRSDSTILD----KLDAMDDLKTYISLLQATAKNLKS 88
           +I  + R+ DE+     ++  + + +   + D     L  + +   ++       + LK 
Sbjct: 6   EIKAHYRFTDEDAELLGSLFPLAETNKERLADQFYDYLLGIPETAEFLKE-DLVLQKLKQ 64

Query: 89  LLKEYWEESLDGEDDEEIYE 108
             ++++     G  D     
Sbjct: 65  THQDWFVSLFAGSYDNRYIH 84


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.313    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0597    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 1,145,972
Number of extensions: 46391
Number of successful extensions: 184
Number of sequences better than 10.0: 1
Number of HSP's gapped: 184
Number of HSP's successfully gapped: 37
Length of query: 123
Length of database: 5,693,230
Length adjustment: 81
Effective length of query: 42
Effective length of database: 3,729,466
Effective search space: 156637572
Effective search space used: 156637572
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 51 (23.7 bits)