BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780122|ref|YP_003064535.1| hypothetical protein
CLIBASIA_00005 [Candidatus Liberibacter asiaticus str. psy62]
         (123 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780122|ref|YP_003064535.1| hypothetical protein CLIBASIA_00005 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 123

 Score =  253 bits (645), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%)

Query: 1   MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDS 60
           MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDS
Sbjct: 1   MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDS 60

Query: 61  TILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYA 120
           TILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYA
Sbjct: 61  TILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYA 120

Query: 121 NQI 123
           NQI
Sbjct: 121 NQI 123


>gi|254781220|ref|YP_003065633.1| hypothetical protein CLIBASIA_05635 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 130

 Score = 50.8 bits (120), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 69/135 (51%), Gaps = 17/135 (12%)

Query: 1   MGALKNHFHDEINENFYFHSHPNA----DPDISIEMQISENQRYLDEEISQCNAVVDVFK 56
           MG LK ++ +EI  N+ F S  N     +P+ + E+++ E    L+  +     ++    
Sbjct: 1   MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEK---LERALKTSKKLIHFRD 57

Query: 57  RSDST-ILDKLDAMDDLKTYISLLQATAKNLKSLL---KEYW----EESLDGEDDEEIYE 108
           R+  T IL+  D ++++   I L +A  + L+  +    E W    E   D E  E   E
Sbjct: 58  RTIRTHILE--DLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSE 115

Query: 109 HPDQEHREDYYANQI 123
           HPDQEH+EDYYA+QI
Sbjct: 116 HPDQEHKEDYYASQI 130


>gi|254780524|ref|YP_003064937.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 480

 Score = 22.3 bits (46), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 14/20 (70%)

Query: 24  ADPDISIEMQISENQRYLDE 43
           AD D  IE++IS  +R+L E
Sbjct: 150 ADADKEIELEISNLRRFLSE 169



 Score = 21.9 bits (45), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 8/27 (29%), Positives = 15/27 (55%)

Query: 4   LKNHFHDEINENFYFHSHPNADPDISI 30
           L NH+ D  N+NF F      + ++++
Sbjct: 374 LINHYCDSFNKNFIFDPVAGINTNVTL 400


>gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 1187

 Score = 21.2 bits (43), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 21/44 (47%)

Query: 78  LLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYAN 121
           L++ TA+    L+++Y+E  L    D++ Y        E  Y N
Sbjct: 290 LVKETARKRSQLIQDYYEARLQYSSDKKQYSVYKPIAPEKLYLN 333


>gi|254780263|ref|YP_003064676.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 392

 Score = 20.8 bits (42), Expect = 7.8,   Method: Composition-based stats.
 Identities = 9/23 (39%), Positives = 10/23 (43%)

Query: 101 EDDEEIYEHPDQEHREDYYANQI 123
           E D+  Y H D     DY  N I
Sbjct: 67  ETDKRFYSHIDCPGHADYVKNMI 89


>gi|254780150|ref|YP_003064563.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 392

 Score = 20.8 bits (42), Expect = 7.8,   Method: Composition-based stats.
 Identities = 9/23 (39%), Positives = 10/23 (43%)

Query: 101 EDDEEIYEHPDQEHREDYYANQI 123
           E D+  Y H D     DY  N I
Sbjct: 67  ETDKRFYSHIDCPGHADYVKNMI 89


>gi|254780613|ref|YP_003065026.1| adenylosuccinate synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 432

 Score = 20.4 bits (41), Expect = 9.9,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 34  ISENQR---YLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLK 73
           ++  QR   +LD    + + +++  K    T LD LD +D+LK
Sbjct: 302 VTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELK 344


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.313    0.132    0.377 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 83,269
Number of Sequences: 1233
Number of extensions: 2996
Number of successful extensions: 18
Number of sequences better than 100.0: 17
Number of HSP's better than 100.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of query: 123
length of database: 328,796
effective HSP length: 64
effective length of query: 59
effective length of database: 249,884
effective search space: 14743156
effective search space used: 14743156
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 33 (17.3 bits)