Query gi|254780123|ref|YP_003064536.1| hypothetical protein CLIBASIA_00010 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 107 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 22 08:03:46 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780123.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam08564 CDC37_C Cdc37 C term 76.0 2.4 6E-05 22.9 2.6 48 24-81 13-60 (87) 2 pfam07148 MalM Maltose operon 40.3 21 0.00054 17.4 2.2 20 4-23 238-257 (279) 3 KOG4496 consensus 38.0 36 0.00092 16.1 3.3 41 11-52 128-168 (194) 4 pfam07643 DUF1598 Protein of u 33.1 26 0.00067 16.9 1.7 41 25-66 32-73 (84) 5 PRK10564 maltose regulon perip 31.9 35 0.00089 16.2 2.2 19 5-23 263-281 (303) 6 cd00040 CSF2 Granulocyte Macro 29.0 51 0.0013 15.3 3.7 50 5-66 42-91 (121) 7 TIGR02408 ectoine_ThpD ectoine 28.8 19 0.00048 17.7 0.4 18 76-95 164-181 (278) 8 KOG0794 consensus 25.5 54 0.0014 15.1 2.2 53 47-102 56-108 (264) 9 pfam09505 Dimeth_Pyl Dimethyla 22.9 35 0.00088 16.2 0.8 18 2-19 302-319 (466) 10 pfam00674 DUP DUP family. This 21.2 58 0.0015 15.0 1.7 24 58-81 32-56 (108) No 1 >pfam08564 CDC37_C Cdc37 C terminal domain. Cdc37 is a protein required for the activity of numerous eukaryotic protein kinases. This domains corresponds to the C terminal domain whose function is unclear. It is found C terminal to the Hsp90 chaperone (Heat shocked protein 90) binding domain pfam08565 and the N terminal kinase binding domain of Cdc37 pfam03234. Probab=76.04 E-value=2.4 Score=22.93 Aligned_cols=48 Identities=29% Similarity=0.293 Sum_probs=35.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHC Q ss_conf 9998889887664556665238434345689999989970111278899985445422 Q gi|254780123|r 24 LITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALG 81 (107) Q Consensus 24 litqglqealitqdvkaveavdpdlkkrvtvlaisymkrcgdkgksqflseilvpalg 81 (107) -+...+|+|+-|+|+-.|..|=-.++- --|-.+|+||+|-| |++|.-+ T Consensus 13 slP~emq~a~es~dld~ln~vl~~M~~---eeAe~~~~~~~dsG-------l~~~~~~ 60 (87) T pfam08564 13 SLPPELQKAFETKDLDEVNKVLAKMPV---EEAEYHMERLIDSG-------LWVPNAK 60 (87) T ss_pred HCCHHHHHHHHHCCHHHHHHHHHCCCH---HHHHHHHHHHHHCC-------CCCCCCC T ss_conf 689999999985789999999980999---99999999987258-------6255532 No 2 >pfam07148 MalM Maltose operon periplasmic protein precursor (MalM). This family consists of several maltose operon periplasmic protein precursor (MalM) sequences. The function of this family is unknown. Probab=40.29 E-value=21 Score=17.45 Aligned_cols=20 Identities=45% Similarity=0.655 Sum_probs=15.9 Q ss_pred HHHHHHHHHHCHHHHHHHHH Q ss_conf 88888641203688999999 Q gi|254780123|r 4 HFIEEAVKAKDIPQLLTFLS 23 (107) Q Consensus 4 hfieeavkakdipqlltfls 23 (107) .-|+.|||+.|||+-|..+. T Consensus 238 ~aI~~AVk~~DI~KAL~Lld 257 (279) T pfam07148 238 SAIEQAVAKGDIPKALSLLD 257 (279) T ss_pred HHHHHHHHCCCHHHHHHHHH T ss_conf 99999997599999999999 No 3 >KOG4496 consensus Probab=37.96 E-value=36 Score=16.13 Aligned_cols=41 Identities=27% Similarity=0.457 Sum_probs=31.9 Q ss_pred HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH Q ss_conf 120368899999999988898876645566652384343456 Q gi|254780123|r 11 KAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRV 52 (107) Q Consensus 11 kakdipqlltflslitqglqealitqdvkaveavdpdlkkrv 52 (107) -.+|-|..-.++....-|.-|+-|.|..+ -|.+|||+-+|- T Consensus 128 ~ia~DP~YakY~KMlklGV~~~ai~nKMi-SEGlDPdiLeR~ 168 (194) T KOG4496 128 LIADDPAYAKYFKMLKLGVLEAAIINKMI-SEGLDPDILERG 168 (194) T ss_pred EECCCHHHHHHHHHHHHCCHHHHHHHHHH-HCCCCHHHHHCC T ss_conf 22268789999999985408999999998-736987887578 No 4 >pfam07643 DUF1598 Protein of unknown function (DUF1598). A family of Rhodopirellula baltica hypothetical proteins of about 500 amino acids in length. Probab=33.13 E-value=26 Score=16.92 Aligned_cols=41 Identities=44% Similarity=0.454 Sum_probs=32.7 Q ss_pred HHHHHHHHHHHHHHHHHHHCCHHHH-HHHHHHHHHHHHHHCCC Q ss_conf 9988898876645566652384343-45689999989970111 Q gi|254780123|r 25 ITQGLQEALITQDVKAVEAVDPDLK-KRVTVLAISYMKRCGDK 66 (107) Q Consensus 25 itqglqealitqdvkaveavdpdlk-krvtvlaisymkrcgdk 66 (107) +..|++|+|=.|||. |..|+||-. -||-|-|=--|||-|.. T Consensus 32 ~~~~l~~aLG~QdVt-V~Gvp~~thfArvLVeADYrMK~IgiG 73 (84) T pfam07643 32 LVRGLRQALGPQDVT-VTGVPADSHFARVLVEADYRMKRIGIG 73 (84) T ss_pred HHHHHHHHCCCCEEE-EECCCCCCHHHHHHHHHHHHHHHHCCC T ss_conf 999999970983479-953178536999999855677874056 No 5 >PRK10564 maltose regulon periplasmic protein; Provisional Probab=31.87 E-value=35 Score=16.21 Aligned_cols=19 Identities=37% Similarity=0.553 Sum_probs=14.4 Q ss_pred HHHHHHHHHCHHHHHHHHH Q ss_conf 8888641203688999999 Q gi|254780123|r 5 FIEEAVKAKDIPQLLTFLS 23 (107) Q Consensus 5 fieeavkakdipqlltfls 23 (107) -|+.|||+.|||.-|..+. T Consensus 263 aI~~AVk~~DI~KAL~Lld 281 (303) T PRK10564 263 AIKDAVKKGDVDKALKLLN 281 (303) T ss_pred HHHHHHHCCCHHHHHHHHH T ss_conf 9999997599999999999 No 6 >cd00040 CSF2 Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) is a member of the large family of polypeptide growth factors called cytokines. It stimulates a wide variety of hematopoietic and nonhematopoietic cell types via binding to members of the cytokine receptor family, mainly the GM-CSF receptor. Probab=29.03 E-value=51 Score=15.27 Aligned_cols=50 Identities=30% Similarity=0.446 Sum_probs=36.5 Q ss_pred HHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCC Q ss_conf 88886412036889999999998889887664556665238434345689999989970111 Q gi|254780123|r 5 FIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRCGDK 66 (107) Q Consensus 5 fieeavkakdipqlltflslitqglqealitqdvkaveavdpdlkkrvtvlaisymkrcgdk 66 (107) .+.|....+.-.-|-|-|.|..|||+..|. .||.-.|..|-.|-+.|--. T Consensus 42 vvse~Fd~qepTClQTRL~LYkqGLrGslT------------~Lkg~LtmmAshYk~hCPpT 91 (121) T cd00040 42 VVSEMFDPQEPTCLQTRLKLYKQGLRGSLT------------KLKGPLTMMASHYKQHCPPT 91 (121) T ss_pred HHHHCCCCCCCCHHHHHHHHHHHHCCCCHH------------HHCCHHHHHHHHHHHCCCCC T ss_conf 998704877872899999999835535078------------86058999999987149889 No 7 >TIGR02408 ectoine_ThpD ectoine hydroxylase; InterPro: IPR012774 Both ectoine and hydroxyectoine are compatible solvents that serve as protectants against osmotic and thermal stresses. A number of genomes synthesize ectoine. This enzyme allows conversion of ectoine to hydroxyectoine, which may be more effective for some purposes, and is found in a subset of ectoine-producing organisms.; GO: 0016725 oxidoreductase activity acting on CH or CH2 groups. Probab=28.79 E-value=19 Score=17.73 Aligned_cols=18 Identities=50% Similarity=1.036 Sum_probs=13.6 Q ss_pred HHHHHCCCCHHCCCCCHHHH Q ss_conf 44542264300002400356 Q gi|254780123|r 76 LVPALGTHKTFVDCTDEDFR 95 (107) Q Consensus 76 lvpalgthktfvdctdedfr 95 (107) ++| |.||||.-|.-|.=| T Consensus 164 ~~P--GSH~tF~~CvGETP~ 181 (278) T TIGR02408 164 VVP--GSHKTFLSCVGETPK 181 (278) T ss_pred EEC--CCCCCCCCCCCCCCC T ss_conf 526--863012668888986 No 8 >KOG0794 consensus Probab=25.54 E-value=54 Score=15.14 Aligned_cols=53 Identities=34% Similarity=0.492 Sum_probs=34.9 Q ss_pred HHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHCCCCCHHHHHHHHHHH Q ss_conf 34345689999989970111278899985445422643000024003567889976 Q gi|254780123|r 47 DLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLL 102 (107) Q Consensus 47 dlkkrvtvlaisymkrcgdkgksqflseilvpalgthktfvdctdedfrlveakll 102 (107) .+..||-.-||-||+|---+ +| +.||---.+.+.--|..|.-|.+.++.++++ T Consensus 56 klRQ~ViATAivY~rRfy~r-~S--~k~~~p~lla~TClyLAcKvEE~~i~~~r~l 108 (264) T KOG0794 56 KLRQRVIATAIVYFRRFYLR-KS--LKEIEPRLLAPTCLYLACKVEECPIVHIRLL 108 (264) T ss_pred HHHHHHHHHHHHHHHHHHHH-HH--HHCCCHHHHHHHHHHHHHHHHHCCHHHHHHH T ss_conf 89999999999999999999-76--6414888899999999862331641799999 No 9 >pfam09505 Dimeth_Pyl Dimethylamine methyltransferase (Dimeth_PyL). This family consists of dimethylamine methyltransferases from the genus Methanosarcina. It is found in three nearly identical copies in each of Methanosarcina acetivorans, Methanosarcina barkeri, and Methanosarcina mazei. It is one of a suite of three non-homologous enzymes with a critical UAG-encoded pyrrolysine residue in these species (along with trimethylamine methyltransferase and monomethylamine methyltransferase). It demethylates dimethylamine, leaving monomethylamine, and methylates the prosthetic group of the small corrinoid protein MtbC. The methyl group is then transferred by methylcorrinoid:coenzyme M methyltransferase to coenzyme M. Note that the pyrrolysine residue is variously translated as K or X, or as a stop codon that truncates the sequence. Probab=22.94 E-value=35 Score=16.23 Aligned_cols=18 Identities=56% Similarity=0.739 Sum_probs=14.8 Q ss_pred CHHHHHHHHHHHCHHHHH Q ss_conf 158888864120368899 Q gi|254780123|r 2 SVHFIEEAVKAKDIPQLL 19 (107) Q Consensus 2 svhfieeavkakdipqll 19 (107) .|.||.|||||..||--. T Consensus 302 avtfikeavkaspipchv 319 (466) T pfam09505 302 AVTFIKEAVKASPIPCHV 319 (466) T ss_pred HHHHHHHHHHCCCCCCEE T ss_conf 999999986068976134 No 10 >pfam00674 DUP DUP family. This family consists of several yeast proteins of unknown functions. Swiss-prot annotates these as belonging to the DUP family. Several members of this family contain an internal duplication of this region. Probab=21.20 E-value=58 Score=14.95 Aligned_cols=24 Identities=46% Similarity=0.457 Sum_probs=18.1 Q ss_pred HHHHHHCCCH-HHHHHHHHHHHHHC Q ss_conf 9899701112-78899985445422 Q gi|254780123|r 58 SYMKRCGDKG-KSQFLSEILVPALG 81 (107) Q Consensus 58 symkrcgdkg-ksqflseilvpalg 81 (107) -|.+|+-++. |.|||+||+--.-| T Consensus 32 f~~~r~~~~~~~~q~l~eii~~~P~ 56 (108) T pfam00674 32 FYNKRILDKDFKIQLLSEIITRKPA 56 (108) T ss_pred HCCCCCCCHHHHHHHHHHHHHCCCC T ss_conf 5157312208999999999860999 Done!