BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780123|ref|YP_003064536.1| hypothetical protein CLIBASIA_00010 [Candidatus Liberibacter asiaticus str. psy62] (107 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done >gi|254780123|ref|YP_003064536.1| hypothetical protein CLIBASIA_00010 [Candidatus Liberibacter asiaticus str. psy62] gi|254039800|gb|ACT56596.1| hypothetical protein CLIBASIA_00010 [Candidatus Liberibacter asiaticus str. psy62] gi|317120694|gb|ADV02517.1| hypothetical protein SC1_gp190 [Liberibacter phage SC1] gi|317120737|gb|ADV02559.1| hypothetical protein SC2_gp190 [Liberibacter phage SC2] gi|317120798|gb|ADV02619.1| hypothetical protein SC2_gp190 [Liberibacter phage SC2] gi|317120838|gb|ADV02659.1| hypothetical protein SC1_gp190 [Liberibacter phage SC1] Length = 107 Score = 205 bits (521), Expect = 2e-51, Method: Composition-based stats. Identities = 107/107 (100%), Positives = 107/107 (100%) Query: 1 MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYM 60 MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYM Sbjct: 1 MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYM 60 Query: 61 KRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQSDA 107 KRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQSDA Sbjct: 61 KRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQSDA 107 >gi|315121962|ref|YP_004062451.1| hypothetical protein CKC_01060 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|315122930|ref|YP_004063419.1| hypothetical protein CKC_05930 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495364|gb|ADR51963.1| hypothetical protein CKC_01060 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496332|gb|ADR52931.1| hypothetical protein CKC_05930 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 72 Score = 59.3 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 6/71 (8%) Query: 1 MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAV---DPDLKKRVTVLAI 57 MSV I+EA++AKD+ +L FL+LIT GL+E + + A DPDLK RVTVLA+ Sbjct: 1 MSVQAIKEAIRAKDVAKLCEFLALITNGLKEITHSSKPQTTTAPLQGDPDLKHRVTVLAL 60 Query: 58 SY---MKRCGD 65 S +RCG+ Sbjct: 61 SLHEEARRCGE 71 >gi|297852920|ref|XP_002894341.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297340183|gb|EFH70600.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 747 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Query: 5 FIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEA--VDPDLKKRVTVLAISYMKR 62 I +VK KDIP++LT L+ Q + +T ++ + V+ ++KK++++ ++S + Sbjct: 109 LIYASVKCKDIPEMLTLSELVGQRYGQRYVTTAIQVLPGNLVNTEIKKKLSIYSVSEHVK 168 Query: 63 C 63 C Sbjct: 169 C 169 >gi|219536309|gb|ACL18060.1| STK [Triticum monococcum] Length = 476 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 4/48 (8%) Query: 54 VLAISYMKRCGDKGKSQFLSEILVPALGTHKTFVD----CTDEDFRLV 97 V+AI + R G++G +FL E+L+ +L H+ V+ C DE+ RL+ Sbjct: 128 VVAIKQLNRDGNQGNKEFLVEVLMLSLLHHQNLVNLVGYCADEEQRLL 175 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.319 0.135 0.368 Lambda K H 0.267 0.0448 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,065,601,050 Number of Sequences: 13984884 Number of extensions: 41003926 Number of successful extensions: 79757 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 79753 Number of HSP's gapped (non-prelim): 5 length of query: 107 length of database: 4,792,584,752 effective HSP length: 75 effective length of query: 32 effective length of database: 3,743,718,452 effective search space: 119798990464 effective search space used: 119798990464 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 76 (33.8 bits)