RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780123|ref|YP_003064536.1| hypothetical protein CLIBASIA_00010 [Candidatus Liberibacter asiaticus str. psy62] (107 letters) >gnl|CDD|163713 cd08157, catalase_fungal, Fungal catalases similar to yeast catalases A and T. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. This family of fungal catalases has a relatively small subunit size, and binds a protoheme IX (heme b) group buried deep inside the structure. Fungal catalases also bind NADPH as a second redox-active cofactor. They form tetramers; in eukaryotic cells, catalases are typically located in peroxisomes. Saccharomyces cerevisiae catalase T is found in the cytoplasm, though. Length = 451 Score = 26.9 bits (60), Expect = 1.4 Identities = 7/30 (23%), Positives = 13/30 (43%) Query: 24 LITQGLQEALITQDVKAVEAVDPDLKKRVT 53 + G QE + + P+++KRV Sbjct: 403 VGKPGQQERFVKNVAGHLSGAPPEIRKRVY 432 >gnl|CDD|80319 cd04436, DEP_fRgd2, DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in fungal RhoGAP (GTPase-activator protein) Rgd2-like proteins. Rgd2-like proteins share a common domain architecture, containing, beside the RhoGAP domain, a DEP and a FCH (Fes/CIP4 homology) domain. Yeast Rgd2 is a GAP protein for Cdc42 and Rho5.. Length = 84 Score = 24.4 bits (53), Expect = 6.7 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 6/47 (12%) Query: 23 SLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRCGDKGKS 69 S I LQE + +D+ A EA DL L +++ G G + Sbjct: 33 SEIVSWLQENMPEKDLDAAEAFGQDL------LNQGFLRLVGGVGST 73 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.135 0.368 Gapped Lambda K H 0.267 0.0769 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,170,707 Number of extensions: 50835 Number of successful extensions: 103 Number of sequences better than 10.0: 1 Number of HSP's gapped: 103 Number of HSP's successfully gapped: 8 Length of query: 107 Length of database: 6,263,737 Length adjustment: 74 Effective length of query: 33 Effective length of database: 4,664,671 Effective search space: 153934143 Effective search space used: 153934143 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.3 bits)