HHsearch alignment for GI: 254780124 and conserved domain: TIGR00609

>TIGR00609 recB exodeoxyribonuclease V, beta subunit; InterPro: IPR004586 Exodeoxyribonuclease V, or RecBCD holoenzyme, (3.1.11.5 from EC) is a multifunctional nuclease with potent ATP-dependent exodeoxyribonuclease activity. Ejection of RecD, as occurs at chi recombinational hotspots, cripples exonuclease activity in favor of recombinagenic helicase activity. All proteins in this family for which functions are known are DNA-DNA helicases that are used as part of an exonuclease-helicase complex (made up of RecBCD homologs) that function to generate substrates for the initiation of recombination and recombinational repair. The complex catalyses exonucleolytic cleavage in either the 5' to 3' or 3' to 5' direction to yield 5-phosphooligonucleotides in the presence of ATP. This is the beta subunit .; GO: 0005524 ATP binding, 0008854 exodeoxyribonuclease V activity, 0006281 DNA repair.
Probab=97.93  E-value=5.7e-05  Score=52.12  Aligned_cols=55  Identities=16%  Similarity=0.257  Sum_probs=38.0

Q ss_pred             EEEEEEEEEEECC-EEEEEEEECCC-CCCCCC-------------CCCHHHHHHHHHHHH---HCCCCCCCCC
Q ss_conf             8999999998599-79999811368-876744-------------668799999999998---4383567651
Q gi|254780124|r  112 ATGTADILIFNST-QWIIVDFKYGA-GVPVKA-------------ENNTQLMLYACGALH---QYGDIFGRPE  166 (388)
Q Consensus       112 ~~GtiD~I~~~dg-~l~IiDyKtGk-~~~v~a-------------~~n~QL~lYALgA~~---~~~~~~~~~~  166 (388)
T Consensus      1207 L~GfiDLvF~~~g~~yyi~DYKsN~LG~~~s~Y~~~~l~~~i~~~~YdlQy~lY~~A~hryL~~r~~~y~~~~ 1279 (1324)
T TIGR00609      1207 LKGFIDLVFRHEGQRYYILDYKSNWLGKDASDYSPEALTEAILKERYDLQYLLYTLALHRYLKKRLKDYDYER 1279 (1324)
T ss_pred             HCCEEEEEEEECCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCHHH
T ss_conf             1551689997089837998621064468821014799999999735817899999999999973588853554