HHsearch alignment for GI: 254780124 and conserved domain: TIGR03491

>TIGR03491 RecB family nuclease, putative, TM0106 family. Members of this uncharacterized protein family are found broadly but sporadically among bacteria. The N-terminal region is homologous to the Cas4 protein of CRISPR systems, although this protein family shows no signs of association with CRISPR repeats.
Probab=98.63  E-value=4.6e-06  Score=59.32  Aligned_cols=193  Identities=15%  Similarity=0.112  Sum_probs=98.2

Q ss_pred             CCCCCHHHHHCCCHHHHHHCC----CCCCCCHHHH-HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             184236778718323886213----8999898899-98999999999972457653432201045645377578899999
Q gi|254780124|r    7 LSASSSHRWLKCPIAPTLESK----IPQTTSIYAS-EGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSV   81 (388)
Q Consensus         7 LSpSs~~rwl~CP~s~~Le~~----~pd~~S~aA~-~GT~~H~llE~~l~~~l~~~~~~~~~~~~~~~~~~~~~e~~~~v   81 (388)
T Consensus         1 is~~~L~~~~rC~rra~LD~~gd~~~~~~~~~~~~~l~~~~~~~~~~~l~~~--------------------~~----~~   56 (457)
T TIGR03491         1 ITDSDLLSFLRCRRRAWLDLYGDKQQKEAPPDFLLQLRQDKQAFVQLILEDP--------------------AA----RA   56 (457)
T ss_pred             CCHHHHHHHHCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCH--------------------HH----HH
T ss_conf             9878989885687088870258965589996778999999999999840473--------------------56----69


Q ss_pred             HHHHHHHHCCCCCCEEEEEEEEEEECCCEEEEEEEEEEEEECC-------EEEEEEEECCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             9999998503787368877553200044058999999998599-------799998113688767446687999999999
Q gi|254780124|r   82 SMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNST-------QWIIVDFKYGAGVPVKAENNTQLMLYACGA  154 (388)
Q Consensus        82 ~~~~~~~r~~~~~~~ve~E~~~~~~~~~~~~~GtiD~I~~~dg-------~l~IiDyKtGk~~~v~a~~n~QL~lYALgA  154 (388)
T Consensus        57 ~aT~~-am~~G~~~I~~~~L~~~~~-~~~~~~g~pdlLvk~~g~S~~G~~~Yepvd~Kl~r~~--k~~~~lqla~ys~lL  132 (457)
T TIGR03491        57 EAGLD-ACAAGADGIYGGRLKHDLP-QNLPHVSHPDLLVKDPGRSAWGDWAYEPVLIKLGKRP--KDEYRLVLAFHALLL  132 (457)
T ss_pred             HHHHH-HHHCCCCEEEEEEEECCCC-CCCCEEEECCEEEECCCCCCCCCCEEEEEEEEECCCC--CHHHHHHHHHHHHHH
T ss_conf             99999-9973886599999804667-7884047779899628988878832578776506779--899999999999999


Q ss_pred             HHHCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             98438356765138999998304887754302589889999999999999999857765304776678886666725764
Q gi|254780124|r  155 LHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK  234 (388)
Q Consensus       155 ~~~~~~~~~~~~~v~~~I~qpr~~~~~~vs~~~~s~eeL~~~~~~v~~~a~~~~~~~a~~~~~~~~~~~~g~~CrfC~~k  234 (388)
T Consensus       133 ~~~Qg~~p~-----~~~lil---g~~~---~~~~~~~~~~~~~~~---~l~~~~~~l~~-~~~P~-~~~~r~~C~~C~w~  196 (457)
T TIGR03491       133 ESFQGVAPK-----KGLIIL---RDGN---SLKVELIKLLPQLRQ---DLADFLLTLNA-DLEPE-VFISRKKCTLCSWR  196 (457)
T ss_pred             HHHHCCCCC-----EEEEEE---CCCC---EEEEEHHHHHHHHHH---HHHHHHHHHCC-CCCCC-CCCCCCCCCCCCHH
T ss_conf             986378887-----599997---8996---799788998999999---99999998526-78998-89985548869638


Q ss_pred             CCCCHHHHH
Q ss_conf             456201346
Q gi|254780124|r  235 VRCPALSRH  243 (388)
Q Consensus       235 ~~Cra~a~~  243 (388)
T Consensus       197 ~~C~~~~~~  205 (457)
T TIGR03491       197 KDCEAVAKE  205 (457)
T ss_pred             HHHHHHHHH
T ss_conf             898899884