HHsearch alignment for GI: 254780124 and conserved domain: pfam06023

>pfam06023 DUF911 Archaeal protein of unknown function (DUF911). This family consists of several archaeal proteins of unknown function.
Probab=98.27  E-value=5.2e-05  Score=52.40  Aligned_cols=204  Identities=16%  Similarity=0.120  Sum_probs=100.5

Q ss_pred             CCCHH--HHHH--CCCCCCCCHHHHHHHHHHHHHHHHHHCCC----CCCCCCCCCCCCCCCCHHH-HHHHHHHHHH----
Q ss_conf             18323--8862--13899989889998999999999972457----6534322010456453775-7889999999----
Q gi|254780124|r   17 KCPIA--PTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGV----DAETVSHQKLTFENDTRIV-DTEMASSVSM----   83 (388)
Q Consensus        17 ~CP~s--~~Le--~~~pd~~S~aA~~GT~~H~llE~~l~~~l----~~~~~~~~~~~~~~~~~~~-~~e~~~~v~~----   83 (388)
T Consensus        54 yCpT~RDvYLrrVlg~r~~~~~~~~~G~~iH~v~~~~~~~~kr~iysg~~~~~~~e~~~~~~~~~~~~e~~~~~~~l~~~  133 (290)
T pfam06023        54 YCPTGRDVYLKRVLGVRGEEGGPLVLGQAIHEAFAKAIEEVKSLIYSGEPPDSSLERSFMADEFGCPEDVREYAKALWKY  133 (290)
T ss_pred             CCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHH
T ss_conf             68985076888862645796354565189999999999999888744777755789987420225767888999999999


Q ss_pred             -------HHHHHHCC----CCC------CEEEEEEEEEEECCCEEEEEEEEEEEEECCEEEEEEEECCCCCCCCCCCCHH
Q ss_conf             -------99998503----787------3688775532000440589999999985997999981136887674466879
Q gi|254780124|r   84 -------VLAYVRTF----SGP------FLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQ  146 (388)
Q Consensus        84 -------~~~~~r~~----~~~------~~ve~E~~~~~~~~~~~~~GtiD~I~~~dg~l~IiDyKtGk~~~v~a~~n~Q  146 (388)
T Consensus       134 ~a~r~~a~~~ev~a~~~~~~~dsl~~~aiPv~~E~~VDGs~LGLS~~l~~Da~i~~~~--~Vve~K~G~~---~~~H~La  208 (290)
T pfam06023       134 LASRVSAELSEVRSKFPKATEDSAAFRVIPVAVEVRVDGSPLGLSSYLRVDAFIPILP--LVVEMKVGSY---QERHELA  208 (290)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCHHHHEECCEEEEECCCCCCCCCCCCCCCCHHHCCCC--EEEEEECCCH---HHHHHHH
T ss_conf             9999987788887404457730233210445788235884136764404442320466--4899961754---5678988


Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEEEEEEEEECCCCCCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             999999999843835676513899999830488775430-2589889999999999999999857765304776678886
Q gi|254780124|r  147 LMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINE-WVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND  225 (388)
Q Consensus       147 L~lYALgA~~~~~~~~~~~~~v~~~I~qpr~~~~~~vs~-~~~s~eeL~~~~~~v~~~a~~~~~~~a~~~~~~~~~~~~g  225 (388)
T Consensus       209 lAGYALAiEs~~e~PVD~G~----lVyv-~~~~~v~~~~~~~~I~d~LR~~FLE~RDe~~~~v~-------~~~DPG~a-  275 (290)
T pfam06023       209 LAGYALAIESDLEIPVDYGL----LVYV-TFNGGVKIKARLVYISDSLRTEFLEERDRAIEIVD-------NGSDPGLA-  275 (290)
T ss_pred             HHHHHHHHHHHHCCCCEEEE----EEEE-EECCCEEEEEEEEECCHHHHHHHHHHHHHHHHHHH-------CCCCCCCC-
T ss_conf             88899999887548714405----9999-97797589889998387899999998789999986-------27899998-


Q ss_pred             CCC-CCCCCCCCCC
Q ss_conf             666-7257644562
Q gi|254780124|r  226 DSC-RFCRAKVRCP  238 (388)
Q Consensus       226 ~~C-rfC~~k~~Cr  238 (388)
T Consensus       276 ~~C~~~CpF~~~Ch  289 (290)
T pfam06023       276 KKCPPTCPFYEVCH  289 (290)
T ss_pred             CCCCCCCCHHHHHC
T ss_conf             78998886477636