HHsearch alignment for GI: 254780124 and conserved domain: pfam10926

>pfam10926 DUF2800 Protein of unknown function (DUF2800). This is a family of uncharacterized proteins found in bacteria and viruses. Some members of this family are annotated as being Phi APSE P51-like proteins.
Probab=100.00  E-value=0  Score=780.78  Aligned_cols=354  Identities=36%  Similarity=0.536  Sum_probs=329.0

Q ss_pred             CCCCCCCCHHHHHCCCHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             75618423677871832388621389998988999899999999997245765343220104564537757889999999
Q gi|254780124|r    4 HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVSM   83 (388)
Q Consensus         4 HA~LSpSs~~rwl~CP~s~~Le~~~pd~~S~aA~~GT~~H~llE~~l~~~l~~~~~~~~~~~~~~~~~~~~~e~~~~v~~   83 (388)
T Consensus         1 HA~LS~Ssa~RWl~Cp~S~~l~~~~pd~~S~~A~eGT~aH~l~E~~L~~~l~~~~~~~~~~--~~~~~~~~~eM~~~~~~   78 (363)
T pfam10926         1 HALLSASSAHRWLNCPPSARLEEGFPDKSSPAAAEGTAAHELAELKLRKGLDAITKLGRNS--EADGEYVDEEMAEYVQE   78 (363)
T ss_pred             CCCCCCCCCHHHHCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC--CCCCEEECHHHHHHHHH
T ss_conf             9867845124655698549987249998987899758999999999985169632256555--66880508899999999


Q ss_pred             HHHHHHCCC---CCCEEEEEEEEEEECCCEEEEEEEEEEEEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             999985037---87368877553200044058999999998599799998113688767446687999999999984383
Q gi|254780124|r   84 VLAYVRTFS---GPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGD  160 (388)
Q Consensus        84 ~~~~~r~~~---~~~~ve~E~~~~~~~~~~~~~GtiD~I~~~dg~l~IiDyKtGk~~~v~a~~n~QL~lYALgA~~~~~~  160 (388)
T Consensus        79 Yvd~v~e~~~~~~~~~~~iEqrvd~s~~~p~~fGTaD~vii~~~~L~IiDlKyG~GV~V~A~~N~QL~lYALGAl~~~~~  158 (363)
T pfam10926        79 YVDFVREQIELAKDGVLLIEQRVDFSQIVPEGFGTGDVVIIADGVLHIIDLKYGKGVLVSAEGNPQLMLYALGALDEFDV  158 (363)
T ss_pred             HHHHHHHHHHCCCCCEEEEEEEECHHHCCCCCCCCEEEEEEECCEEEEEECCCCCCCEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             99999999850679879999885223217887764128999388799998777877540246797899999999998166


Q ss_pred             CCCCCCEEEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             56765138999998304887754302589889999999999999999857765304776678886666725764456201
Q gi|254780124|r  161 IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL  240 (388)
Q Consensus       161 ~~~~~~~v~~~I~qpr~~~~~~vs~~~~s~eeL~~~~~~v~~~a~~~~~~~a~~~~~~~~~~~~g~~CrfC~~k~~Cra~  240 (388)
T Consensus       159 lyd-i~~V~mtI~QPR~~~---is~w~~s~~eL~~w~~~~-------~kp~A~~A~~g~gef~~G~~CrFCkak~~C~Ar  227 (363)
T pfam10926       159 LYD-FDTVRMTIFQPRLDN---ISTWEISAEELLEWAEEV-------VKPAAELAYAGDGEFKPGEHCRFCKAKATCRAR  227 (363)
T ss_pred             CCC-CCEEEEEEECCCCCC---CCEEEEEHHHHHHHHHHH-------HHHHHHHHHCCCCCCCCCCCCCCCCCHHHCHHH
T ss_conf             467-647999997457799---865887899999999999-------889999862799986789875306322228999


Q ss_pred             HHHHHHHHHCC---CC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCHHHHHHHH
Q ss_conf             34678763022---00-599999999995438999999999999999997898478523205888786116989999999
Q gi|254780124|r  241 SRHVLLEATKD---PS-TNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELL  316 (388)
Q Consensus       241 a~~~l~~~~~~---p~-~l~~~e~~~~l~~~~~l~~w~~~v~~~a~~~~~~G~~~~g~Klv~gr~~~r~~~d~~~~~~~l  316 (388)
T Consensus       228 a~~~l~la~~df~~~~~~Ls~~ei~~il~~~~~l~~W~~dv~~~a~~~~~~G~~~pG~KlV~GR-s~Rkw~de~~~~~~l  306 (363)
T pfam10926       228 AQAVLNLAKYDFEDPTLDLTDEELAELLEKADLLEKWAKDVEAYALDEARNGKEVPGYKLVEGR-SNRKWTDEEAVAAAL  306 (363)
T ss_pred             HHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCC-CCCCCCCHHHHHHHH
T ss_conf             9999988876215777689999999999714899999999999999999779987872661476-777647889999999


Q ss_pred             HHCCC--CCCHHHCCCCHHHHHHHHHHCCCCHHHHHHHHHHEECCCCCCEECCCCCCCHHH
Q ss_conf             86165--100000138988999974000242678987530015678982663078862000
Q gi|254780124|r  317 TSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQ  375 (388)
Q Consensus       317 ~~~~~--~~~~~~~l~~~~~~ek~~~~~~~~~~~~~~l~~~i~k~~gkp~l~p~~d~~~~~  375 (388)
T Consensus       307 ~~~g~~~~~~y~~kli~pt~~ekllgkk~----f~ell~~li~k~~GkptLvp~sDkRpa~  363 (363)
T pfam10926       307 KAAGLKDEDIYKKKLISPTQAEKLLGKKK----FKELLGALIVKPPGKPTLVPESDKRPAL  363 (363)
T ss_pred             HHCCCCHHHCCCCCCCCHHHHHHHHCHHH----HHHHHHHHEECCCCCCEEEECCCCCCCC
T ss_conf             98699655421013689899998878788----9999761263689961782478888999