BLAST/PSIBLAST alignment of GI: 254780124 and GI: 15837288 at iteration 1
>gi|15837288|ref|NP_297976.1| hypothetical protein XF0686 [Xylella fastidiosa 9a5c] Length = 425
>gi|9105568|gb|AAF83496.1|AE003912_8 phage-related protein [Xylella fastidiosa 9a5c] Length = 425
 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 135/391 (34%), Positives = 196/391 (50%), Gaps = 30/391 (7%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L        S +A EGT AH + A+ L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVPLTRTCKDDASPFADEGTVAHTVAANALRTGSDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            ++      T  V  EMA+SV   + YVR  +G  L E  + +   T E GA GTAD++I
Sbjct: 61  GERHEINGRTWEVTAEMAASVQEYVDYVRAIAGVRLVEQPLHIASITGEQGAKGTADVVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  IVD KYG GV V AE N QL LYA  AL ++G +    + + L I+QPR+   
Sbjct: 121 LAGDALTIVDLKYGKGVKVFAEGNEQLQLYALAALSEFGWVEDF-QQVRLVIVQPRLGHS 179

Query: 181 SPINEWVIS---ADDLLEKAKEFKERGTLALSLKSKRA-VSLEHYGVNDDSCRFCRAKVR 236
              +EWV +    +D  ++ K    R   A+   +    +S E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPEMEDFKQRVKRSATRCMEAIGHYTNVGELSSEYFGPAETPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKD---------PS---------TNTTVELSKAYSSISLIKSYVKACE 278
           CPAL+ HVL     D         P           NTT  L+  + +  LI+S+ KA  
Sbjct: 237 CPALATHVLTTVADDFVDLTQPVAPQLSHAALRTFDNTT--LASLFGATELIESWCKAVR 294

Query: 279 DEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV-LGEEAFKRI-LKTPKELE 336
            +    L +G+ + GY+LV+GR+G R + D   A++ L  + +G      + L +P   E
Sbjct: 295 AKAAAELRSGNAVPGYKLVQGRQGPRRWVDETAAEDALIQMRIGVAHLHDVSLISPTSAE 354

Query: 337 QLYKEQKVSDEFWEELQELITRGDGKPVIAP 367
           +L++   + +  W +LQ LI R  G PV+ P
Sbjct: 355 KLHQAGIIGESQWTQLQPLIHRATGAPVVVP 385