BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780124|ref|YP_003064537.1| hypothetical protein
CLIBASIA_00015 [Candidatus Liberibacter asiaticus str. psy62]
         (388 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|260161777|emb|CAZ39321.1| putative phage protein [Streptococcus suis]
 gi|313575359|emb|CBR26888.1| hypothetical protein [Streptococcus phage phi-SsUD.1]
          Length = 373

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 107/390 (27%), Positives = 182/390 (46%), Gaps = 24/390 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAET 58
           M +HA LSAS+SHRWL CP +  L   +P TTS +A EG+ AH L A+ +E+ +  +A  
Sbjct: 1   MTNHAILSASASHRWLNCPPSARLTEDLPDTTSDFAIEGSDAHELCAYLVEKALGRNARD 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     + ++ +    E  + V   +   R +S       E  L+     P   GT D 
Sbjct: 61  PTEDLTFYNDEMQECAEEYRNYVMEQVEKARGYSRDPTVLIEQRLDFSKWVPEGFGTGDC 120

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           +I       ++D+K+G GV V A++N Q+M YA GAL  +G ++   + +T+TI QPR  
Sbjct: 121 IIVADGLLQVIDYKHGLGVQVDADHNPQMMCYALGALEMFGGLYNF-DNVTMTIFQPRKH 179

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               I+ + I   +LLE A+         L+ K++ A   E    +   C+FC+ K  C 
Sbjct: 180 N---ISTFKIEKTELLEWAENV-------LTPKAELAFKGEGEMQSGKHCQFCKLKNVCR 229

Query: 239 ALSRHVLLEATK---DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L  A     DP++    ++++    + L+ S+    +     +   G  I GY+
Sbjct: 230 KRAEDNLALAKMEFADPASLDNEDIAEILPKLDLLISWANDIKAYALNQATDGHPIPGYK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           LVEGR   R F D +   + +      + +++ L T   + +L  ++     F + L  L
Sbjct: 290 LVEGR-SVRKFSDESAVSQAVIEAGY-DPYEKKLLTITAMTKLLGKKT----FNDLLGGL 343

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           + +  GKP + P D    +       +EF+
Sbjct: 344 VVKPSGKPTLVPIDDSRQEMNL--AKNEFK 371


>gi|50261595|gb|AAT72363.1| unknown [Streptococcus pyogenes]
          Length = 373

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 107/390 (27%), Positives = 182/390 (46%), Gaps = 24/390 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAET 58
           M +HA LSAS+SHRWL CP +  L   +P TTS +A EG+ AH L A+ +E+ +  +A  
Sbjct: 1   MTNHAILSASASHRWLNCPPSARLTEDLPDTTSDFAIEGSDAHELCAYLVEKALGRNARD 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     + ++ +    E  + V   +   R +S       E  L+     P   GT D 
Sbjct: 61  PTEDLTFYNDEMQECAEEYRNYVMEQVEKARGYSRDPTVLIEQRLDFSKWVPEGFGTGDC 120

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           +I    +  ++D+K+G GV V A++N Q+M YA GAL  +  ++   + +T+TI QPR  
Sbjct: 121 IIVADGRLQVIDYKHGLGVQVDADHNPQMMCYALGALEMFDGLYNF-DNVTMTIFQPRKH 179

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               I+ + I   +LLE A+         L+ K++ A   E    +   C+FC+ K  C 
Sbjct: 180 N---ISTFKIEKTELLEWAENV-------LTPKAELAFKGEGEMQSGKHCQFCKLKNVCR 229

Query: 239 ALSRHVLLEATK---DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L  A     DP++    ++++    + L+ S+    +     +   G  I GY+
Sbjct: 230 KRAEDNLALAKMEFADPASLDNEDIAEILPKLDLLISWANDIKAYALNQATDGHPIPGYK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           LVEGR   R F D +   + +      + +++ L T   + +L  ++     F + L  L
Sbjct: 290 LVEGR-SVRKFSDESAVSQAVIEAGY-DPYEKKLLTITAMTKLLGKKT----FNDLLGGL 343

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           I +  GKP + P D    +       +EF+
Sbjct: 344 IIKPSGKPTLVPIDDSRQEMNL--AKNEFK 371


>gi|50914499|ref|YP_060471.1| unknown phage protein [Streptococcus pyogenes MGAS10394]
 gi|40218550|gb|AAR83204.1| hypothetical phage protein [Streptococcus pyogenes]
 gi|50903573|gb|AAT87288.1| unknown phage protein [Streptococcus pyogenes MGAS10394]
          Length = 381

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 107/390 (27%), Positives = 182/390 (46%), Gaps = 24/390 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAET 58
           M +HA LSAS+SHRWL CP +  L   +P TTS +A EG+ AH L A+ +E+ +  +A  
Sbjct: 9   MTNHAILSASASHRWLNCPPSARLTEDLPDTTSDFAIEGSDAHELCAYLVEKALGRNARD 68

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     + ++ +    E  + V   +   R +S       E  L+     P   GT D 
Sbjct: 69  PTEDLTFYNDEMQECAEEYRNYVMEQVEKARGYSRDPTVLIEQRLDFSKWVPEGFGTGDC 128

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           +I    +  ++D+K+G GV V A++N Q+M YA GAL  +  ++   + +T+TI QPR  
Sbjct: 129 IIVADGRLQVIDYKHGLGVQVDADHNPQMMCYALGALEMFDGLYNF-DNVTMTIFQPRKH 187

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               I+ + I   +LLE A+         L+ K++ A   E    +   C+FC+ K  C 
Sbjct: 188 N---ISTFKIEKTELLEWAENV-------LTPKAELAFKGEGEMQSGKHCQFCKLKNVCR 237

Query: 239 ALSRHVLLEATK---DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L  A     DP++    ++++    + L+ S+    +     +   G  I GY+
Sbjct: 238 KRAEDNLALAKMEFADPASLDNEDIAEILPKLDLLISWANDIKAYALNQATDGHPIPGYK 297

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           LVEGR   R F D +   + +      + +++ L T   + +L  ++     F + L  L
Sbjct: 298 LVEGR-SVRKFSDESAVSQAVIEAGY-DPYEKKLLTITAMTKLLGKKT----FNDLLGGL 351

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           I +  GKP + P D    +       +EF+
Sbjct: 352 IIKPSGKPTLVPIDDSRQEMNL--AKNEFK 379


>gi|167746064|ref|ZP_02418191.1| hypothetical protein ANACAC_00759 [Anaerostipes caccae DSM 14662]
 gi|167654579|gb|EDR98708.1| hypothetical protein ANACAC_00759 [Anaerostipes caccae DSM 14662]
          Length = 373

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 102/390 (26%), Positives = 169/390 (43%), Gaps = 24/390 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQ--GVDAET 58
           MA HA LSAS+SHRWL CP +  L +      S YA +GT AH L  H L++  G+ +  
Sbjct: 1   MAAHAILSASASHRWLNCPPSARLCADKEDPASEYALQGTDAHTLCEHKLKKAIGMKSRN 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            ++    ++ +      E A   S V+   +      +   E  L+     P   GT D 
Sbjct: 61  PTNNLTYYDEEMEQCAEEYAQYCSSVVEDAKKICKDPVVLIEQKLDFSKYVPEGFGTGDC 120

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           +I       ++D+K+G GV V A+NN Q+M YA G L+ +  I+   E +++TI QPR  
Sbjct: 121 VIIGDGTLYVIDYKHGKGVEVSAQNNPQMMCYALGTLNLFDGIYDITE-VSMTIFQPRRE 179

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               ++ +V+  +DL   A          L+  ++ A   E      + C+FC+AK  C 
Sbjct: 180 N---VSTFVMKKEDLYSWADTI-------LAPTAQLAFKGEGEFKAGNHCQFCKAKATCR 229

Query: 239 ALSRHVLLEATKDPS---TNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             + + +  A  D     T    E+S        + ++V   ++    +   G    G++
Sbjct: 230 KRAEYNMELAKYDFEMPSTLDDTEISVILEKADELVAWVTDIKEYALAQAMNGTHYDGFK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           +VEGR  NR + D  +  E +T       +++ L     +  L  + K    F E L  L
Sbjct: 290 IVEGR-SNRKYTDEEKVAETVTKAG-HNPYEQRLLGITAMTSLLGKTK----FNELLGNL 343

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           + +  GKP + P           +   +F 
Sbjct: 344 VYKPQGKPTLVPESDKRP--EMNTAKDDFS 371


>gi|291556516|emb|CBL33633.1| Protein of unknown function (DUF2800) [Eubacterium siraeum V10Sc8a]
          Length = 374

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 103/390 (26%), Positives = 174/390 (44%), Gaps = 24/390 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAET 58
           MA+HA LSASSSHRWL CP +  L        S +A+EGT AH L    L   +  +A+ 
Sbjct: 1   MANHALLSASSSHRWLNCPPSARLCEGYDDKGSDFAAEGTDAHALCEFKLRTALGIEAKD 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     + ++         + V  ++   +      +   E  L          GT D 
Sbjct: 61  PTEDLSWYNSEMEECANGYVAFVMELVEEAKKACPDPVILIEQRLNYSRYVKEGFGTGDC 120

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           +I       IVD+K+G GV V+A++N Q+ LYA GAL  +  I+   +A+++TI QPR  
Sbjct: 121 VIIADGTLHIVDYKHGRGVLVEADDNPQMKLYALGALELFDCIYD-IDAVSMTIYQPRRS 179

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               ++ + I   DL   A +        L+  +K A + +      + C+FC+AK  C 
Sbjct: 180 N---VSTFTIPKADLYAWADQV-------LAPTAKLAFNGDGEYHCGEWCQFCKAKADCR 229

Query: 239 ALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   +  A  +   P   T  E+ +    I  + ++V   +D   +   +G +  GY+
Sbjct: 230 ERANANMELARFEFRQPPLLTDEEVEEILGRIDELIAWVSDIKDYALQAAISGKQWSGYK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           LVEGR  NR + D N     +T+    + ++  +     +  L  ++    +F + L  L
Sbjct: 290 LVEGR-SNRKYTDENAVIAAVTAAGY-DPYEHKILGITAMTSLLGKK----QFNDILGGL 343

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           IT+  GKP + P        T  + + +F+
Sbjct: 344 ITKPQGKPTLVPDSDKRPAMT--TIIDDFK 371


>gi|313618509|gb|EFR90508.1| phage-associated protein [Listeria innocua FSL S4-378]
          Length = 378

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 108/388 (27%), Positives = 169/388 (43%), Gaps = 20/388 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M +HA LSASSSHRWL C  +  LE +    +   A EGT AH+L  H L++ +   +  
Sbjct: 1   MGNHAILSASSSHRWLNCLPSARLELEFEDQSGEAAKEGTAAHDLCEHKLKKALHMRSQR 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                  ++           V   +   +T     +   E  L+     P   GT D +I
Sbjct: 61  PISEYNSDEMEECTDAYVDFVMEQVELAKTKCNDPIVLIEQHLDFSCYVPDGFGTGDCVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  IVDFKYG GV V A +N Q+ LYA GAL  Y  ++   E +++TI QPR    
Sbjct: 121 IADDRLHIVDFKYGLGVLVDAVDNPQMKLYALGALGIYDHLYDIKE-VSMTIFQPRREN- 178

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             ++ W I  ++L   A+E        L  ++ +A + E   +    C FC+A  RC A 
Sbjct: 179 --VSTWTIPVEELKGWAEE-------ELKPRAVKAFNGEGEYIPGPWCTFCKAANRCRAR 229

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGDEIQGYQL 296
           +   L  A K+   P   T  E+ +    +  +  +             N G E  G+++
Sbjct: 230 AEEKLKLAEKEFKMPPLMTDAEIEEILLILPDLTKWANKITAYATDAAVNHGKEWNGFKV 289

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           VEGR   R +KD     E   +   ++ +++ L    E+++L  + K    F E L +LI
Sbjct: 290 VEGR-SVRKYKDEGAIAEKAVAGGYKDIYRKSLIPLTEMQKLMGKSK----FEEFLGDLI 344

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
            +  GKP + P           +  +EF
Sbjct: 345 FKPPGKPTLVPNSDKRPAINVVNAKNEF 372


>gi|317120738|gb|ADV02560.1| hypothetical protein SC2_gp195 [Liberibacter phage SC2]
 gi|317120799|gb|ADV02620.1| hypothetical protein SC2_gp195 [Liberibacter phage SC2]
          Length = 388

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 387/388 (99%), Positives = 387/388 (99%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS
Sbjct: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
           HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFL ETEVPLEPFTTEPGATGTADILI
Sbjct: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLLETEVPLEPFTTEPGATGTADILI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
           FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG
Sbjct: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
           SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL
Sbjct: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240

Query: 241 SRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGR 300
           SRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGR
Sbjct: 241 SRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGR 300

Query: 301 KGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGD 360
           KGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGD
Sbjct: 301 KGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGD 360

Query: 361 GKPVIAPRDIPTNKQTQKSQLSEFEVLG 388
           GKPVIAPRDIPTNKQTQKSQLSEFEVLG
Sbjct: 361 GKPVIAPRDIPTNKQTQKSQLSEFEVLG 388


>gi|262113720|emb|CAR95387.1| hypothetical protein [Streptococcus phage phi-m46.1]
          Length = 400

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 106/390 (27%), Positives = 180/390 (46%), Gaps = 24/390 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAET 58
           M +HA LSAS+SHRWL CP +  L   IP  TS +A EGT AH L A+ +E+ +  +A  
Sbjct: 28  MTNHAILSASASHRWLNCPPSVRLTEDIPDVTSEFALEGTDAHELCAYLVEKALGRNARD 87

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     +  + +    E  + V   +   R +S       E  L+     P   GT D 
Sbjct: 88  PTEDLAYYNEEMQYCAEEYRNYVMEQVDKARGYSRDPTVLIEQRLDFSKWVPEGFGTGDC 147

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           +I       ++D+K+G GV V A++N+Q+M YA GAL  +  ++   + +T+TI QPR  
Sbjct: 148 IIVADGLLQVIDYKHGLGVLVDADHNSQMMCYALGALEMFDGLYDF-DKVTMTIFQPRKH 206

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               I+ + I   +LLE A+         L+ K++ A   E    + + C+FC+ K  C 
Sbjct: 207 N---ISTFEIEKTELLEWAEN-------ELAPKAELAFKGEGEIQSGNHCQFCKLKNVCR 256

Query: 239 ALSRHVLLEATK---DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L  A     DP++    ++++    + L+ S+    +     +   G  I GY+
Sbjct: 257 KRAEDNLALAKMEFADPASLDNEDIAEILPKLDLLISWANDIKAYALNQATDGHPIPGYK 316

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           LVE R   R F D +   + +      + +++ L T   + +L  ++     F + L  L
Sbjct: 317 LVESR-SVRKFSDESAVSQAVIEAGF-DPYEKKLLTITAMTKLLGKKT----FNDLLGGL 370

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           + +  GKP + P D    +       +EF+
Sbjct: 371 VVKPSGKPTLVPIDDSRQEMNL--AKNEFK 398


>gi|254780124|ref|YP_003064537.1| hypothetical protein CLIBASIA_00015 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039801|gb|ACT56597.1| hypothetical protein CLIBASIA_00015 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|317120695|gb|ADV02518.1| hypothetical protein SC1_gp195 [Liberibacter phage SC1]
 gi|317120839|gb|ADV02660.1| hypothetical protein SC1_gp195 [Liberibacter phage SC1]
          Length = 388

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 388/388 (100%), Positives = 388/388 (100%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS
Sbjct: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
           HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI
Sbjct: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
           FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG
Sbjct: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
           SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL
Sbjct: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240

Query: 241 SRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGR 300
           SRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGR
Sbjct: 241 SRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGR 300

Query: 301 KGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGD 360
           KGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGD
Sbjct: 301 KGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGD 360

Query: 361 GKPVIAPRDIPTNKQTQKSQLSEFEVLG 388
           GKPVIAPRDIPTNKQTQKSQLSEFEVLG
Sbjct: 361 GKPVIAPRDIPTNKQTQKSQLSEFEVLG 388


>gi|302876793|ref|YP_003845426.1| hypothetical protein Clocel_3999 [Clostridium cellulovorans 743B]
 gi|307687475|ref|ZP_07629921.1| hypothetical protein Ccel74_04918 [Clostridium cellulovorans 743B]
 gi|302579650|gb|ADL53662.1| Protein of unknown function DUF2800 [Clostridium cellulovorans
           743B]
          Length = 380

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 100/390 (25%), Positives = 173/390 (44%), Gaps = 24/390 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDA--ET 58
           MA HA LSAS+SHRW+ CP +  L +     +S YA +GT AH L  + +E  +      
Sbjct: 1   MAKHALLSASASHRWINCPPSAKLCAVEENKSSPYAQQGTDAHELCQYKVEHALGKNVSD 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     F+ +      +  S V   LA  +          E  L+     P   GT D 
Sbjct: 61  PTANLEFFDTEMDYCSDQYCSYVMEQLAAAKELCNDPEILIEQRLDFSKWVPEGFGTGDC 120

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           +I    +  ++D+K+G GV V A NN+Q++ YA GAL  +  I+   + + +TI QPR  
Sbjct: 121 VIVADREIHVIDYKHGLGVLVSANNNSQMLCYALGALELFDGIYD-IQTVKMTIFQPRRD 179

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               ++ + IS ++LL+ A E        L+  ++ A + E      + C+FCR K  C 
Sbjct: 180 N---VSTYEISKEELLKWADEV-------LAPTAQLAFNGEGEFSAGEHCQFCRVKATCR 229

Query: 239 ALSRHVLLEATKDPST---NTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L  A  D          E++   S +  + S+    ++   ++  +G E +G++
Sbjct: 230 KRAEENLKLAQYDFEMPINLNDTEIAAILSQVDELVSWANDIKEYALQQALSGTEYEGFK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           +VEGR   R + D +    ++      + +++ L     +  L  ++K    F E L  L
Sbjct: 290 VVEGR-SIRKYTDEDAVAFIVKDHGF-DPYEKKLLGITAMTSLLGKKK----FEELLSGL 343

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           I +  GKP + P        +  +   +F+
Sbjct: 344 IAKPPGKPTLVPISDKRQAMS--TAKEDFK 371


>gi|319757795|gb|ADV69737.1| hypothetical protein SSUJS14_0646 [Streptococcus suis JS14]
          Length = 373

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 105/390 (26%), Positives = 177/390 (45%), Gaps = 24/390 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAET 58
           M +HA LSAS+SHRWL CP +  L   +P   S +A EGT AH L A+ +E+ +  +A  
Sbjct: 1   MTNHAILSASASHRWLNCPPSVRLTEDMPDVNSEFALEGTDAHELCAYLVEKALGRNARD 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     + ++ +    E  + V   +   R +S       E  L+     P   GT D 
Sbjct: 61  PTEDLAFYNHEMQDCAEEYRNYVMEQVEKARGYSRDPTVLIEQRLDFSKWVPEGFGTGDC 120

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           LI       ++D+K+G GV V A++N Q+M Y  GAL  +  ++   + +T+TI QPR  
Sbjct: 121 LIVADGLLQVIDYKHGLGVLVDADHNPQMMCYTLGALEMFDGLYDF-DKVTMTIFQPRKH 179

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               I+ + I   +LLE A+         L+ K++ A   E    +   C+FC+ K  C 
Sbjct: 180 N---ISTFEIEKTELLEWAEN-------ELAPKAELAFKGEGDMQSGKHCQFCKLKTVCR 229

Query: 239 ALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L  A  +   P+T    ++++    + L+ S+    +     +   G  I GY+
Sbjct: 230 KRAEDNLALAKMEFANPATLDNEDIAEILPKLDLLISWANDIKAYALNQATDGYSIPGYK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           LVEGR   R F D +     +      + +++ L T   + +L  ++     F + L  L
Sbjct: 290 LVEGR-SVRKFSDESAVSHAVIEAGY-DPYEKKLLTITAMTKLLGKKT----FNDLLGGL 343

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           + +  GKP + P D    +       +EF+
Sbjct: 344 VIKPTGKPTLVPIDDSRQEMNL--AKNEFK 371


>gi|304389853|ref|ZP_07371812.1| phage protein [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|304327029|gb|EFL94268.1| phage protein [Mobiluncus curtisii subsp. curtisii ATCC 35241]
          Length = 378

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 111/389 (28%), Positives = 175/389 (44%), Gaps = 20/389 (5%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH 61
           + HA LSAS +HRWL CP +  LES  P++TS  A +GT AH L  H L + +   +   
Sbjct: 4   SDHALLSASGAHRWLNCPPSARLESDEPESTSAAAEQGTAAHALAEHKLRRALKQRSKRP 63

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIF 121
                +++   +  +  + V   ++      G      E  L+     PG  GT D +I 
Sbjct: 64  VSAWIDDEMETLTDDYIAYVQEHISLAEQSCGDPQVLIEQRLDFSHIVPGGFGTGDCVII 123

Query: 122 NSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGS 181
                 I+D KYG GV V+A NN QLMLYA GALH +G ++   E + +TI QPR     
Sbjct: 124 AEPVLQIIDLKYGQGVLVEAANNPQLMLYALGALHAFGSLYD-IETVAVTIYQPRRGN-- 180

Query: 182 PINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALS 241
            ++ W IS  +L + A+         +  K++ A + E        C+FC+    C A +
Sbjct: 181 -VDTWEISVAELEQWAET-------EVKPKAELASAGEGEFCPGSWCQFCKIAPTCRARA 232

Query: 242 RHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMF-KRLNAGDEIQGYQLV 297
              L  A  +   P+  + VE++   + I  +K++    E     K +N G   +G++LV
Sbjct: 233 EANLQLAKLEFAPPAELSDVEIADVLTRIPQLKTWAADVEAYALSKAVNQGVVFEGFKLV 292

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
            GR   R +           +    + + R L T   +E+L  +      F E L +L+T
Sbjct: 293 AGR-SVRKYSSETDVAAAAEAAGYRDIYDRKLITLTAMEKLMGK----PTFNEILGDLVT 347

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEFEV 386
           +  GKP + P           S  S+F+ 
Sbjct: 348 KPAGKPTLVPVSDKRPALDLVSAASDFQP 376


>gi|325662091|ref|ZP_08150710.1| hypothetical protein HMPREF0490_01448 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471754|gb|EGC74973.1| hypothetical protein HMPREF0490_01448 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 373

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 104/389 (26%), Positives = 170/389 (43%), Gaps = 23/389 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAET 58
           MA HAFLSAS+SHRW+ CP +  L   I   +S YA EGT  H L A+ +E+ +  D E 
Sbjct: 1   MAKHAFLSASASHRWINCPPSAKLCKGIKDESSPYAQEGTDCHELCAYLVEKALGRDVED 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     +  + +    E    V       + F    +   E  L+         GT D 
Sbjct: 61  PTENLTYYSGEMQNCAEEYRDYVLEQFERSKKFCSDPMVFIEQRLDFSRWVENGFGTGDC 120

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           +I       I+D+K+G GV V++E N+Q+M YA GAL  + D++     + +TI QPR  
Sbjct: 121 VIIADEVIHIIDYKHGLGVLVESEGNSQMMCYALGALEAFDDLYD-ISTIEMTIFQPRRE 179

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               ++   IS +DLL+ A++        L   +  A   +      D C+FC+ K  C 
Sbjct: 180 N---VSTSSISKEDLLKWAEDV-------LKPTTTLAYEGKGEFKAGDHCQFCKVKATCR 229

Query: 239 ALSRHVLLEATKDPS---TNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L  A  D     T    E++     I  + S+    +D    +  +G    G++
Sbjct: 230 KRAETNLELAKYDFEMPATLDDFEIAAILPRIDQLISWGNDIKDYALTQAQSGTHYDGFK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           +VEGR  NR + D +   E +T+    + +++ L     +  L  ++K    F + L  L
Sbjct: 290 IVEGR-SNRKYTDDDAVAEAVTAAGY-DPYEKKLLGITAMSSLLGKKK----FEQLLGGL 343

Query: 356 ITRGDGKPVIAPRDIPT-NKQTQKSQLSE 383
           + +  GKP + P         T     ++
Sbjct: 344 VYKPPGKPALVPESDKRLAMNTAADDFND 372


>gi|269976592|ref|ZP_06183577.1| phage-associated protein [Mobiluncus mulieris 28-1]
 gi|269935393|gb|EEZ91942.1| phage-associated protein [Mobiluncus mulieris 28-1]
          Length = 421

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 98/385 (25%), Positives = 167/385 (43%), Gaps = 19/385 (4%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            HA LSASS+HRWL CP +  L + + +  S  A +GT AH L  H L + +  ++    
Sbjct: 6   KHALLSASSAHRWLHCPPSAKLTAGVTEAPSEAALQGTAAHALAEHKLRRALKQQSKRPI 65

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
               +++      +  + V       +  +   +   E  L+     PG  GT + LI  
Sbjct: 66  SEYEDDEMEAYTDDYVAYVLEQYEQAKQATPGAVIYIEQRLDFSHLVPGGFGTGNCLIVA 125

Query: 123 STQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSP 182
                ++D KY  GV V+AE N Q+MLY  GAL  +  ++   E + LT+ QPR      
Sbjct: 126 DGTLHVIDLKYCLGVLVEAEWNPQMMLYTIGALALFDALYD-IEQVALTVFQPRREN--- 181

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSR 242
           ++ W IS  +L + A+         L   ++ A + E        C+FCR    C A + 
Sbjct: 182 VSTWTISVTELNKWAE-------QTLKPAAELAANGEGEFCAGTWCQFCRIASTCRARAE 234

Query: 243 HVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEG 299
             L  A  +   P+  +  E++   + I  +  +    +D    +  +G+  +G++LV G
Sbjct: 235 ANLELAKFEFAPPAELSPAEVADVLAQIPELTRWASDVQDYALSQALSGELYEGFKLVAG 294

Query: 300 RKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRG 359
           R   R + D     E   +    + +KR L T   +E+L  ++     F E L  L+ + 
Sbjct: 295 R-SIRKYTDETAVAEAAKAAGYRDIYKRSLLTITAMERLMGKK----HFSEILGNLVVKP 349

Query: 360 DGKPVIAPRDIPTNKQTQKSQLSEF 384
           +GKP + P      +    +   +F
Sbjct: 350 EGKPTLVPVTDKRPELQVSTAADDF 374


>gi|315654971|ref|ZP_07907876.1| phage protein [Mobiluncus curtisii ATCC 51333]
 gi|315490932|gb|EFU80552.1| phage protein [Mobiluncus curtisii ATCC 51333]
          Length = 385

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 101/385 (26%), Positives = 172/385 (44%), Gaps = 19/385 (4%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            HA LSASS+HRWL CP +  L + + +  S  A +GT AH L  H L + +  ++    
Sbjct: 6   KHALLSASSAHRWLHCPPSAKLTAGVTEAPSEAALQGTAAHALAEHKLRRALKQQSKRPV 65

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
               +++      +  S V       +  +   +   E  L+     PG  GT D LI  
Sbjct: 66  SKYEDDEMNTHTDDYVSYVLEQYEQAKQATPGAVIYIEQHLDFSNVVPGGFGTGDCLIVA 125

Query: 123 STQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSP 182
                ++D KYG GV V+AE N Q+MLYA GAL  +  ++   E + LT+ QPR      
Sbjct: 126 DGTLHVIDLKYGLGVLVEAEWNPQMMLYAIGALALFDALYD-IEQVALTVFQPRREN--- 181

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSR 242
           ++ W IS  +L + A+         L   ++ A + E        C+FC+    C A + 
Sbjct: 182 VSTWTISVTELNKWAE-------QTLKPAAELAANGEGEFCAGSWCQFCKIASTCRARAE 234

Query: 243 HVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEG 299
             L  A  +   P+  +  E+++  + I  +  +    +D    +  +G++ +G++LV G
Sbjct: 235 ANLELAKFEFAPPAELSAGEVAEVLAQIPELTRWASDVQDYALSQALSGEQYEGFKLVAG 294

Query: 300 RKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRG 359
           R   R + D     E   +    + +KR L T   +E+L  ++    +F E L  L+ + 
Sbjct: 295 R-SIRKYTDETAVAEAAKAAGYRDIYKRSLLTITAMEKLMGKK----QFSEILGNLVVKP 349

Query: 360 DGKPVIAPRDIPTNKQTQKSQLSEF 384
           +GKP + P      +    +   +F
Sbjct: 350 EGKPTLVPLSDKRPELQISTAADDF 374


>gi|167761127|ref|ZP_02433254.1| hypothetical protein CLOSCI_03525 [Clostridium scindens ATCC 35704]
 gi|167661246|gb|EDS05376.1| hypothetical protein CLOSCI_03525 [Clostridium scindens ATCC 35704]
          Length = 376

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 97/387 (25%), Positives = 166/387 (42%), Gaps = 24/387 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLE--QGVDAETVS 60
            HA LSASSS RW+ CP +  L        S YA+EGT AH L  + L+   G+  E  +
Sbjct: 5   QHAILSASSSDRWIHCPPSARLCETYEDKGSDYAAEGTDAHALGEYKLKTALGLSTEDPT 64

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                +  +     +  +  V   +   +      +   E  ++         GTAD +I
Sbjct: 65  ESLKWYSEEMEDCASGYSEYVLEQVEAAKKTCADPVVLIEQRVDFSRWVEQGFGTADCII 124

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  ++D+K+G GV V AE N Q+  YA GAL  + DI+   + +++TI QPR +  
Sbjct: 125 IADGTLRVIDYKHGLGVLVSAEANPQMQCYALGALELFDDIYN-IDTVSMTIYQPRRQN- 182

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             ++ + IS +DL   A E        L   ++ A + +   +  + C FC+AK  C A 
Sbjct: 183 --VSTYEISKEDLYRWADEV-------LKPTAELAFAGDGNFLCGEWCGFCKAKNECRAR 233

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLV 297
           +   L  A  D   P   T  E+      +  + S+    ++   ++  +G E  G++LV
Sbjct: 234 AEANLKLAQHDFKLPPLLTDTEIEVILGKVDELVSWAYDIKEYALQQALSGKEWSGFKLV 293

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR  NR + +     + +      + +++ L     +++L  +      F E L   I 
Sbjct: 294 EGRA-NRKYSNETAVIDAVEKAGF-DPYEKKLLGITAMQKLLGK----SRFDELLSAYIE 347

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +  GKP + P           +  ++F
Sbjct: 348 KPQGKPTLVPESDKRPA--MNTAKNDF 372


>gi|297242720|ref|ZP_06926658.1| conserved hypothetical protein [Gardnerella vaginalis AMD]
 gi|296888931|gb|EFH27665.1| conserved hypothetical protein [Gardnerella vaginalis AMD]
          Length = 376

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 107/389 (27%), Positives = 166/389 (42%), Gaps = 20/389 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M  HA LS SS+HRW+KC  +  LE K   TTS+ A EGT AH    + L + ++     
Sbjct: 1   MTKHALLSPSSAHRWIKCTPSAVLEEKFENTTSVAAEEGTAAHAWCEYKLNKLLNRPCEK 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                  N+ +         V       +      +   E  ++     P   GTAD +I
Sbjct: 61  PSTEYDSNEMQECSDAYVDFVMEKYEQAKLNCQDPILLIEQKVDFSAYVPDGFGTADCII 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  ++DFKYG GV V A  N Q+  YA GAL  +  ++   +++ ++I QPR    
Sbjct: 121 VGEKTLQVIDFKYGQGVLVDAYENPQMKCYALGALTLFDSLY-EIQSVEMSIFQPRRDN- 178

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             ++ + +   +L+  A+         L  K++ A+  E      D CRFCRAK  C   
Sbjct: 179 --VSTFTLPVAELICWAESV-------LKPKAELAIKGEGEFEAGDWCRFCRAKAVCRKR 229

Query: 241 SRHVLLEA---TKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEIQGYQL 296
           +   L  A    K+PS  T  E+ +   +I  +  +            +N G E  G++L
Sbjct: 230 AEENLKLAELEFKEPSVLTDSEIEEVLKTIPTLTKWADDVLAYATDSAINHGKEWSGFKL 289

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           VEGR   R FKD     E   +    + FK  L    E+++L  ++K    F + L +LI
Sbjct: 290 VEGR-SVRKFKDETAVIEKAKAAGFTDIFKTSLIGLTEMQKLMGKKK----FEDILGDLI 344

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
            +  GK  + P      K    +   EF+
Sbjct: 345 IKPSGKLTLVPDSDKRAKVNVTNVNQEFK 373


>gi|77412081|ref|ZP_00788407.1| phi APSE P51-like protein [Streptococcus agalactiae CJB111]
 gi|77161886|gb|EAO72871.1| phi APSE P51-like protein [Streptococcus agalactiae CJB111]
          Length = 373

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 109/390 (27%), Positives = 179/390 (45%), Gaps = 24/390 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAET 58
           M +HA LSAS+SHRWL CP +  L   +P  TS +A EGT AH L A+ +E+ +   A  
Sbjct: 1   MTNHAVLSASASHRWLNCPPSVRLTEDMPDVTSEFALEGTDAHELCAYLVEKALGRKARD 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     +  + +    E  + V   +   + +S       E  L+     P   GT D 
Sbjct: 61  PTEDLSFYNEEMQNCAEEYRNYVMEQVEKAKDYSHDPTVLIEQRLDFSKWVPEGFGTGDC 120

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           LI       ++D+K+G G+ V A++N Q+M YA GAL  +  I+   + +T+TI QPR  
Sbjct: 121 LIVADGLLQVIDYKHGLGILVDADHNPQMMCYALGALEMFDGIYDF-DNVTMTIFQPRKN 179

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               I+ + +   +LLE A++        LS K++ A   E    +   C+FC+ K  C 
Sbjct: 180 N---ISTFEMDKAELLEWAED-------QLSPKAELAFKGEGELKSGKHCQFCKIKNVCR 229

Query: 239 ALSRHVLLEATK---DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L  A     DP+T    ++++    + L+ S+    +    K    G  I GY+
Sbjct: 230 KRAEDNLALAKMEFADPATLDYEDIAEILPKLDLLVSWANDVKAYALKEATEGHSIPGYK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           LVEGR   R F D     + +      + +++ L T   + +L  ++     F + L  L
Sbjct: 290 LVEGR-SVRKFSDEAAVSQAVMDAGF-DPYEKKLLTITAMTKLLGKKT----FNDLLGGL 343

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           I +  GKP + P D    +    +  +EF+
Sbjct: 344 IVKQSGKPTLVPLDDSRQELNLAT--NEFK 371


>gi|317501101|ref|ZP_07959307.1| phage protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|316897488|gb|EFV19553.1| phage protein [Lachnospiraceae bacterium 8_1_57FAA]
          Length = 379

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 98/387 (25%), Positives = 166/387 (42%), Gaps = 24/387 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD--AETVS 60
            HA LSASSS RWL CP +  L        S YA+EGT AH L  H L+  +   ++  +
Sbjct: 5   AHAILSASSSDRWLHCPPSARLCETYEDKGSDYAAEGTDAHALGEHKLKTALGLPSDDPT 64

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                +  +     +  A  V   +   +      +   E  ++         GTAD +I
Sbjct: 65  DSLKWYSEEMEDCTSGYAEYVLEQIEAAKETCADPVVLIEQRVDFSRWVEQGFGTADCVI 124

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  ++D+K+G GV V AE N Q+  YA GAL  + DI+   + +++TI QPR +  
Sbjct: 125 IADGTLRVIDYKHGLGVLVSAEENPQMQCYALGALELFDDIYD-IDQVSMTIYQPRRQN- 182

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             ++ + IS DDL   A E        L   +  A + +   +  + C FC+AK  C A 
Sbjct: 183 --VSTYEISKDDLYRWADEV-------LKPTADLAFAGDGNFLCGEWCGFCKAKNECRAR 233

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLV 297
           +   L  A  D   P   T  E+      +  + S+    ++   ++  +G E  G+++V
Sbjct: 234 AEANLKLAQHDFKLPPLLTDTEIEVILGKVDELVSWASDIKEYALQQALSGKEWTGFKIV 293

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR  NR + + +   + +      + +++ L     +++L  +      F E L   I 
Sbjct: 294 EGR-SNRRYSNESAVIDAVEKAG-LDPYEKKLLGITAMQKLLGK----SRFDELLTAYIE 347

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +  GKP + P           +  ++F
Sbjct: 348 KPQGKPTLVPDSDKRPA--MNTAKNDF 372


>gi|76788560|ref|YP_329356.1| hypothetical protein SAK_0728 [Streptococcus agalactiae A909]
 gi|76563617|gb|ABA46201.1| conserved hypothetical protein [Streptococcus agalactiae A909]
          Length = 373

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 109/390 (27%), Positives = 180/390 (46%), Gaps = 24/390 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAET 58
           M +HA LSAS+SHRWL CP +  L   +P  TS +A EGT AH L A+ +E+ +   A  
Sbjct: 1   MTNHAVLSASASHRWLNCPPSVRLTEDMPDVTSEFALEGTDAHELCAYLVEKALGRKARD 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     +  + +    E  + V   +   + +S       E  L+     P   GT D 
Sbjct: 61  PTEDLSFYNEEMQNCAEEYRNYVMEQVEKAKDYSHDPTVLIEQRLDFSKWVPEGFGTGDC 120

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           LI       ++D+K+G G+ V A++N Q+M YA GAL  +  I+   + +T+TI QPR  
Sbjct: 121 LIVADGLLQVIDYKHGLGILVDADHNPQMMCYALGALEMFDGIYDF-DNVTMTIFQPRKN 179

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               I+ + +   +LLE A++        LS K++ A   E    +   C+FC+ K  C 
Sbjct: 180 N---ISTFEMDKAELLEWAED-------QLSPKAELAFKGEGELKSGKHCQFCKIKNVCR 229

Query: 239 ALSRHVLLEATK---DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L  A     DP+T    ++++  + + L+ S+    +    K    G  I GY+
Sbjct: 230 KRAEENLALAKMEFADPATLDYEDIAEILTKLDLLVSWANDVKAYALKEATEGHSIPGYK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           LVEGR   R F D     + +      + +++ L T   + +L  ++     F + L  L
Sbjct: 290 LVEGR-SVRKFSDEAAVSQAVMDAGF-DPYEKKLLTITAMTKLLGKKT----FNDLLGGL 343

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           I +  GKP + P D    +    +  +EF+
Sbjct: 344 IVKQSGKPTLVPLDDSRQELNLAT--NEFK 371


>gi|317132756|ref|YP_004092070.1| hypothetical protein Ethha_1814 [Ethanoligenens harbinense YUAN-3]
 gi|315470735|gb|ADU27339.1| hypothetical protein Ethha_1814 [Ethanoligenens harbinense YUAN-3]
          Length = 380

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 98/388 (25%), Positives = 165/388 (42%), Gaps = 24/388 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD--AETVS 60
            HA LSASSS RW+ CP +  L        S YA EGT AH L  + L + +   A+  +
Sbjct: 6   QHAVLSASSSDRWIHCPPSVRLSEGFEDKGSDYALEGTCAHALAEYKLRKALGYPAQDPT 65

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                +  +         S V   +   +      +   E  ++         GT+D LI
Sbjct: 66  EDLAFYNEEMEEATDGYVSYVLEKVEAAKEACSDPVVLVEQRVDYSRWVRQGFGTSDALI 125

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  I+D KYG G+ V AE+N QL  Y+ GAL  + DI+   +++ ++I QPR +  
Sbjct: 126 IADGTLRIIDLKYGTGIAVSAEDNPQLKCYSLGALELFDDIYD-IDSVAMSIYQPRRQN- 183

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             ++EW IS +DLL  A E        L   ++ A   +        CRFC+AK  C   
Sbjct: 184 --VSEWQISKNDLLAWADEV-------LKPTAELAWDGKGEFSCGPWCRFCKAKTICRKR 234

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLV 297
           +   L  A  +   P   +  E+    S +  + S+    ++   ++  +G E +G++LV
Sbjct: 235 AEENLKLAQHEFRLPPELSDAEIEVILSQVDELVSWASDIKEYALQQALSGKEWRGFKLV 294

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR   R + +     + +      + +++ L     +++L  +      F E L   I 
Sbjct: 295 EGR-SVRKYANETAVAKTVEDAGF-DPYEKKLLGITAMQKLLGKN----RFNELLSGFIE 348

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           +  GKP + P           +  ++F+
Sbjct: 349 KPQGKPTLVPDSDKRPA--MNTAKNDFK 374


>gi|226323294|ref|ZP_03798812.1| hypothetical protein COPCOM_01066 [Coprococcus comes ATCC 27758]
 gi|225208484|gb|EEG90838.1| hypothetical protein COPCOM_01066 [Coprococcus comes ATCC 27758]
          Length = 373

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 99/389 (25%), Positives = 166/389 (42%), Gaps = 23/389 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAET 58
           MA HAFLSAS+SHRW+ CP +  L   I   +S YA EGT  H L A+ +E  +  D E 
Sbjct: 1   MAKHAFLSASASHRWINCPPSAKLCEGIKDESSHYAQEGTDCHELCAYLVEMALGRDVED 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     +  + +    E    V       + F    +   E  L+         GT D 
Sbjct: 61  PTENLTYYSGEMQNCAEEYRDYVLEQFERSKKFCSDPMVFIEQRLDFSRWVENGFGTGDC 120

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           +I       I+D+K+G GV V++E N+Q+M YA GAL  + D++     + +TI Q R  
Sbjct: 121 VIIADEVLHIIDYKHGLGVLVESEGNSQMMCYALGALEAFDDLYD-ISTIEMTIFQQRRE 179

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               ++   I  DDLL+ A++        L   +  A   +      D C+FC+ K  C 
Sbjct: 180 N---VSTSSIRKDDLLKWAEDV-------LKPTAALAYEGKGEFKAGDHCQFCKVKATCR 229

Query: 239 ALSRHVLLEATKDPS---TNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L     +     T    E++     I  + ++    ++    +  +G    G++
Sbjct: 230 KRAETNLELVKYNFEMPATLDDFEIAAILPRIDQLITWGNDIKNYTLTQAQSGTHYDGFK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           +VEGR  NR + D +   E +T+    + +++ L     +  L  ++    +F E L  L
Sbjct: 290 IVEGR-SNRKYTDDDAVAEAVTTAGY-DPYEKKLLGITAMSSLLGKK----QFDEILGGL 343

Query: 356 ITRGDGKPVIAPRDIPT-NKQTQKSQLSE 383
           + +  GKP + P         T     ++
Sbjct: 344 VYKPPGKPALVPESDKRSAMNTAADDFND 372


>gi|298253793|ref|ZP_06977382.1| DUF2800 family protein [Gardnerella vaginalis 5-1]
 gi|297532129|gb|EFH71102.1| DUF2800 family protein [Gardnerella vaginalis 5-1]
          Length = 388

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 104/388 (26%), Positives = 161/388 (41%), Gaps = 20/388 (5%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH 61
             HA LS SS+HRW+KC  +  LE K   TTS  A EGT AH    + L + ++      
Sbjct: 14  TKHALLSPSSAHRWIKCTPSAVLEEKFENTTSAAAKEGTAAHAWCEYKLNKLLNRPCEKP 73

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIF 121
                 N+ +         V       +      +   E  ++     P   GTAD +I 
Sbjct: 74  STEYDSNEMQECSDAYVDFVMEKYEQAKLNCQDPILLIEQKVDFSAYVPDGFGTADCIIV 133

Query: 122 NSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGS 181
                 ++DFKYG GV V A  N Q+  YA GAL  +  ++   + + ++I QPR     
Sbjct: 134 GDKTLQVIDFKYGQGVLVDAYENPQMKCYALGALTLFDSLY-EIQTVEMSIFQPRRDN-- 190

Query: 182 PINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALS 241
            ++ + +   +L+  A+         L  K+  A+  E      D CRFCRAK  C   +
Sbjct: 191 -VSTFTLPVAELICWAESV-------LKPKAGLAIKGEGEFEAGDWCRFCRAKAVCRKRA 242

Query: 242 RHVLLEA---TKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEIQGYQLV 297
              L  A    K PS  T  E+ +  + I  +  +            +N G E  G++LV
Sbjct: 243 EENLKLAEFEFKPPSVLTDSEIEEVLTLIPQLTKWADDVLAYATDSAINHGKEWSGFKLV 302

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR   R FKD     E   +    + FK  L    E++++  ++K    F + L +L+ 
Sbjct: 303 EGR-SVRKFKDETAVIEKAKAHGFTDIFKTSLIGLTEMQKMMGKKK----FEDILGDLVI 357

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           +  GK  + P      K    +   EF+
Sbjct: 358 KPSGKLTLVPDSDKRAKVNVTNVNQEFK 385


>gi|293401131|ref|ZP_06645275.1| phage protein [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305257|gb|EFE46502.1| phage protein [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 376

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 100/387 (25%), Positives = 168/387 (43%), Gaps = 24/387 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAE--TVS 60
            HA LSAS+SHRWL CP +  L        S YA+E T AH L  + L + ++ +    +
Sbjct: 5   AHAVLSASASHRWLHCPPSARLCETYEDKGSDYAAERTDAHELCEYKLRKALNMKASDPT 64

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                +  +        AS +   +   +      +   E  ++         GTAD +I
Sbjct: 65  ENLTWYSEEMDDCANGYASYILEQVESAKETCADPVVLIEQRVDFSRWVEQGFGTADCII 124

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  I+D+K+G GV V AE+N Q+  YA GAL  + DI+   + +++TI QPR +  
Sbjct: 125 IADGTLRIIDYKHGLGVLVSAEDNPQMKCYALGALELFDDIYD-IDNVSMTIYQPRRQN- 182

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             I+ + +S +DL   A E        L   +  A + +   +  + C FC+AK  C A 
Sbjct: 183 --ISTYELSKEDLYAWADEV-------LKPTAGLAFAGDGNFLCGEWCGFCKAKHECRAR 233

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLV 297
           +   LL A  D   P      E+    S +  + ++    ++   ++  +G E  G++LV
Sbjct: 234 AEANLLLAQHDFKLPPLLEDTEIEVILSRVDELVAWASDIKEYALQQAISGKEWTGWKLV 293

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR  NR + +     E +T     + +++ L     +++L  +      F E L   I 
Sbjct: 294 EGR-SNRKYSNEAAVIEAVTDAGF-DPYEKKLLGITAMQKLLGK----SRFDELLAAYIE 347

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +  GKP + P           +  S+F
Sbjct: 348 KPQGKPTLVPESDKRPA--MNNAKSDF 372


>gi|57234130|ref|YP_181817.1| hypothetical protein DET1102 [Dehalococcoides ethenogenes 195]
 gi|57224578|gb|AAW39635.1| conserved hypothetical protein [Dehalococcoides ethenogenes 195]
          Length = 379

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 96/387 (24%), Positives = 164/387 (42%), Gaps = 24/387 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD--AETVS 60
            HA LSASSS RWL CP +  L        S YA+EGT AH L    L+  +   AE  +
Sbjct: 5   AHAILSASSSDRWLHCPPSARLCESYEDKGSDYAAEGTDAHALGEFKLKTALGLPAEDPT 64

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                +  +     +  A  V   +   +      +   E  ++         GTAD +I
Sbjct: 65  ESLKWYSEEMEDCTSGYAEYVLEQVEAAKETCADPVVLIEQRVDFSRWVEQGFGTADCII 124

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  ++D+K+G GV V AE N Q+  Y+ GAL  +  ++   + +++TI QPR +  
Sbjct: 125 IADGTLRVIDYKHGLGVLVSAEENPQMQCYSLGALELFDALYD-IDKVSMTIYQPRRQN- 182

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             ++ + IS +DL   A E        L   ++ A + +   +  + C FC+AK  C A 
Sbjct: 183 --VSTYEISKEDLYRWADEV-------LKPTAELAFAGDGNFLCGEWCGFCKAKNECRAR 233

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLV 297
           +   L  A  D   P   T  E+      +  + S+    ++   ++  +G E  G++LV
Sbjct: 234 AEANLKLAQHDFKLPPLLTDTEIEVILGKVDELVSWASDIKEYALQQALSGKEWSGFKLV 293

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR  NR + +     + +      + +++ L     +++L  +      F E L   I 
Sbjct: 294 EGRA-NRRYSNEAAVIDAVEKAGF-DPYEKKLLGITAMQKLLGK----SRFDELLTAYIE 347

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +  GKP + P           +  ++F
Sbjct: 348 KPQGKPTLVPESDKRPA--MNTAKNDF 372


>gi|268610650|ref|ZP_06144377.1| hypothetical protein RflaF_14282 [Ruminococcus flavefaciens FD-1]
          Length = 371

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 98/388 (25%), Positives = 163/388 (42%), Gaps = 23/388 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAET 58
           M+ HA LS SSS RW+ CP +   E+ +  T S YA +GT AH L  + +++ +      
Sbjct: 1   MSGHALLSPSSSERWINCPPSAK-ENAVGDTGSSYAQQGTDAHALCEYKVKKALGFKVRD 59

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            + +   F+ +           V   +   +      L   E  L+       + GTAD 
Sbjct: 60  PTDELEYFDEEMAECTDAYCEFVMEQVQAAKETCADPLVLVEQRLDFTRWVAESFGTADC 119

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           ++       ++DFKYG GV V+AENN+Q+ +YA GAL+ +  ++     + + I QPR  
Sbjct: 120 IVVADGVMTVIDFKYGLGVLVEAENNSQMRMYALGALNLFESLYD-INTVRMIIFQPRRD 178

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               ++   ++ ++LL  A E        L   +  A + E        C+FCR K  C 
Sbjct: 179 N---VSTAEVTTEELLRWADEV-------LIPAAALAATGEGEYSAGKHCQFCRIKATCR 228

Query: 239 ALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             + + L  A  D   P T    E+S           +V   ++   ++  +G    G++
Sbjct: 229 KRAEYNLQLAQYDFAVPDTLADDEISMILDRADTFIGWVNDVKEYALEQAISGKCYPGFK 288

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           +VEGR  NR + D +     +T     + F++ L     + +L   +K    F   L  L
Sbjct: 289 VVEGR-SNRRYTDTDAVAAAVTEAGY-DPFEKKLMGVTAMTKLLGAKK----FNTLLGSL 342

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSE 383
           I +  GKP + P        T      E
Sbjct: 343 IEKPKGKPTLVPESDKRPAWTIDDFKEE 370


>gi|197303498|ref|ZP_03168537.1| hypothetical protein RUMLAC_02220 [Ruminococcus lactaris ATCC
           29176]
 gi|197297496|gb|EDY32057.1| hypothetical protein RUMLAC_02220 [Ruminococcus lactaris ATCC
           29176]
          Length = 377

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 103/395 (26%), Positives = 174/395 (44%), Gaps = 29/395 (7%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAE--T 58
           M  HA+LSAS+SHRWL CP +  L + I    S YA +GT  H L A+ +E+ +  +   
Sbjct: 1   MPKHAYLSASASHRWLACPPSAKLCANILDQASEYAQQGTDCHELCAYLVEKALGRDVID 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     ++ + +    E  + V   +   + F        E  L+         GT D 
Sbjct: 61  PTENLTYYDAEMQNCAEEYRNYVLEQIEAAKEFCKDPQVMIEQRLDFSRWVENGFGTGDC 120

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAEN-----NTQLMLYACGALHQYGDIFGRPEALTLTII 173
           +I       I+D+K+G G+ V A +     N+Q+M YA GAL  +GDI+     + +TI 
Sbjct: 121 VIVADEVLQIIDYKHGLGILVSAGDDEYGGNSQMMCYALGALEVFGDIYD-INQIKMTIF 179

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR      I+ + IS +DLL+ A E        L+  ++ A   +      D C FC+ 
Sbjct: 180 QPRRNN---ISTYTISKEDLLKWADEV-------LAPTAQLAYVGKGEFNAGDHCTFCKV 229

Query: 234 KVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDE 290
           K  C   + + L  A  D   P+T    E++     +  + S+    +D   ++  +G  
Sbjct: 230 KATCRKRAEYNLELAKYDFKMPATLDDTEIAAILEKVDEMISWGNDIKDYALQQAQSGVH 289

Query: 291 IQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWE 350
            +G+++VEGR  NR + D N   + +      + +++ L     +  L  ++K    F E
Sbjct: 290 FEGWKIVEGR-SNRKYTDENAVADTVKDAGF-DPYEKKLLGITSMSTLLGKKK----FEE 343

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
            L  LI +  GKP +             +   +F+
Sbjct: 344 LLGGLIYKPPGKPTLVLESDKRPA--MNTAKDDFK 376


>gi|323693315|ref|ZP_08107533.1| phage protein [Clostridium symbiosum WAL-14673]
 gi|323502798|gb|EGB18642.1| phage protein [Clostridium symbiosum WAL-14673]
          Length = 376

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 100/387 (25%), Positives = 170/387 (43%), Gaps = 24/387 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAE--TVS 60
            HA LSASSS RWL CP +  L        S YA+EGT AH+L  + L + +  E    +
Sbjct: 5   GHAILSASSSDRWLHCPPSARLCETYEDKGSDYAAEGTDAHSLCEYKLRKALGMEATDPT 64

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
              + +  +     T  AS +  +L   +      +   E  ++         GT+D ++
Sbjct: 65  ENLVWYNAEMEDCATGYASFIMELLEEAKQTCSDPVVLIEQRVDFSRWVEQGFGTSDAIL 124

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
            +     ++D+K+G GV V A +N Q+  YA GAL  + DI+   + +++TI QPR +  
Sbjct: 125 ISDGTMHVIDYKHGLGVLVDATDNPQMKCYALGALELFDDIYD-IDNVSMTIYQPRRQN- 182

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             I+ + IS D L + A E        L   +  A + +   +  + C FC+AK  C A 
Sbjct: 183 --ISTFEISKDKLYKWADEV-------LKPTADLAFAGDGNFLCGEWCGFCKAKHECRAR 233

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLV 297
           +   LL A  D   P   T  E+    S    + S+    ++   ++  +G E  G++LV
Sbjct: 234 AEANLLLAQHDFKLPPLLTDSEIEVILSRADELISWAGDIKEYALQQAISGKEWAGWKLV 293

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR  NR + +     + +T     + +++ L     +++   +      F E L   I 
Sbjct: 294 EGR-SNRKYSNDEAVIQAVTDAGF-DPYEKKLLGITAMQKRLGK----SRFDELLTAYIE 347

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +  GKP + P           +  ++F
Sbjct: 348 KPQGKPTLVPESDKRPA--MNNAKTDF 372


>gi|315656938|ref|ZP_07909825.1| phage protein [Mobiluncus curtisii subsp. holmesii ATCC 35242]
 gi|315492893|gb|EFU82497.1| phage protein [Mobiluncus curtisii subsp. holmesii ATCC 35242]
          Length = 378

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 110/388 (28%), Positives = 171/388 (44%), Gaps = 21/388 (5%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD-AETVSH 61
            H+ LSAS +HRWL CP +  LES+ P T+S  A +GT AH L    L + +  A     
Sbjct: 4   QHSLLSASGAHRWLNCPPSAVLESREPDTSSAAAEQGTAAHALAEWKLRRALHQAPAFKP 63

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIF 121
           +    + +   +  +  + V   ++  R   G      E  L+     PG  GT D +I 
Sbjct: 64  ESDWIDTEMEHLTDDYVAFVQEHISIARETCGDPQVLIEQRLDFSHIVPGGFGTGDAVII 123

Query: 122 NSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGS 181
                 I+D KYG GV V+AE N QLMLYA GALH +G ++   E + +TI QPR     
Sbjct: 124 AEPTLQIIDLKYGQGVLVEAEQNPQLMLYALGALHAFGSLYD-IETVAVTIYQPRRGN-- 180

Query: 182 PINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALS 241
            ++ W  S  +L   A+         +  K++ A + E        C+FC+    C A +
Sbjct: 181 -VDTWETSVAELEHWAET-------DVKPKAELAAAGEGEFCPGSWCQFCKITPTCRARA 232

Query: 242 RHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMF-KRLNAGDEIQGYQLV 297
              L  A  +   P+  T VE++   + I  +K++    E     K +N G   +G++LV
Sbjct: 233 EANLQLAKLEFAPPAELTDVEIADVLTRIPQLKTWASDVEAYALSKAVNQGVVFEGFKLV 292

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
            GR   R +       +   +    + + R L T   +E+L  +      F E L E +T
Sbjct: 293 AGR-SVRKYTSETDVAKAAEAAGYRDIWDRKLITLTAMEKLMGK----PAFNEILSEYVT 347

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           +  GKP + P           S  ++F 
Sbjct: 348 KPAGKPTLVPASDKRPALDLVSAATDFS 375


>gi|225573256|ref|ZP_03782011.1| hypothetical protein RUMHYD_01447 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039388|gb|EEG49634.1| hypothetical protein RUMHYD_01447 [Blautia hydrogenotrophica DSM
           10507]
          Length = 372

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 108/389 (27%), Positives = 175/389 (44%), Gaps = 23/389 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAET 58
           M  HA LSASSSHRWL CP +  L  K   T S YA EGT AH+L  + L++ +  DA  
Sbjct: 1   MGKHALLSASSSHRWLNCPPSARLCEKYEDTGSEYAQEGTDAHSLCEYKLKRALGMDAAD 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     +  +      + A+ V  ++   +      +   E  L+         GT D 
Sbjct: 61  PTENLSFYNEEMEQCALDYAAYVLELVEDAKKTCKDPVVLIEQRLDFSRFVKDGFGTGDC 120

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           +I       IVD+K+G GV V A  N Q+MLYA GAL  +  I    + + +TI QPR  
Sbjct: 121 VIIADGILDIVDYKHGKGVEVSAVENPQMMLYALGALELFDGI-HDIDTVRMTIFQPRRD 179

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               ++  +++ DDLL+            L+ K+K A          D CRFC+AK  C 
Sbjct: 180 N---VSVCIMAKDDLLQW-------AYNELTYKAKLAYEGRGEFACGDWCRFCKAKAACR 229

Query: 239 ALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             + + L  A  D   P T    E++     +  + ++    ++   ++  +G E  GY+
Sbjct: 230 KRAEYNLELAKYDFEMPDTLEDAEIAAILDKVDELTAWAADVKEYALRQALSGTEYPGYK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           +VEGR  NR +   +   + ++     + + + +    E+++L  ++K    F E L  L
Sbjct: 290 VVEGR-SNRRYISEDAVADAVSQAGY-DPYAKKVLGLTEMQRLLGKKK----FDELLGGL 343

Query: 356 ITRGDGKPVIAPRDIPT-NKQTQKSQLSE 383
           I +  GKPV+ P         T ++   +
Sbjct: 344 IEKPQGKPVLVPLSDKRQPMNTAQNDFKD 372


>gi|295114048|emb|CBL32685.1| Protein of unknown function (DUF2800). [Enterococcus sp. 7L76]
          Length = 380

 Score =  363 bits (931), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 99/391 (25%), Positives = 161/391 (41%), Gaps = 22/391 (5%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQ--GVDAETV 59
             HA LSASSS+RW+ CP +  L       +S YA +GT AH L  + L +  G D    
Sbjct: 3   TQHAVLSASSSNRWIHCPPSVRLSEHFENKSSPYAQQGTDAHTLCEYKLNKFIGNDVTDP 62

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADIL 119
           +     ++ +        A+ V   +A  +  +   +   E  L+     P   GT D L
Sbjct: 63  TSTLEFYDEEMEQCAESYATFVMEEVAKAKQTTVDPIVIVEQRLDFSRYVPDGFGTGDCL 122

Query: 120 IFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRT 179
           +       ++D KYG G+ V A  N Q+M YA GAL  +  I+   + + +TI QPR   
Sbjct: 123 VIADGTLSVIDMKYGLGILVDAYQNPQMMCYALGALELFDGIYD-IQEVKMTIFQPRREN 181

Query: 180 GSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA 239
              ++ + +  ++LL+ AK+        LS  +  A   E        C FC AK  C A
Sbjct: 182 ---VSTYTLLKEELLQWAKDV-------LSPAADLAFKGEGEYQCGKWCGFCPAKNSCRA 231

Query: 240 LSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQL 296
            + H L  A  +   P   +  E+ +    +  + S+    +D   K    G +   ++L
Sbjct: 232 RADHNLKLAQYEFKPPELLSDDEIEEIIGKVDDLVSWSNDIKDCALKLALGGKQWTHHKL 291

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           VEGR   R + + N     +      + + + L     + +   ++K    F E L E I
Sbjct: 292 VEGR-STRKYSNDNDVAAAVIKAGY-DPYDKKLLGVTAMTKALGKEK----FNEILGEYI 345

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
            +  GK  +          T  +   EF+ L
Sbjct: 346 IKPKGKLTLVDGSDKRQAVTVNNLNEEFKPL 376


>gi|227498334|ref|ZP_03928484.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226903796|gb|EEH89714.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 375

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 104/387 (26%), Positives = 169/387 (43%), Gaps = 24/387 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAETVS 60
            HA LSASS +RWL CP +    +K+P T+S +A +GT AH L    ++  +    E  +
Sbjct: 4   KHAVLSASSCYRWLACPPSAKECAKLPDTSSEFARQGTDAHTLCEFKVKTALGQKLEDPT 63

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            +   F+ +      E A  V   LA  +      L   E  L+     PG  GT D LI
Sbjct: 64  KELTFFDEEMAECTDEYAQFVMECLATAKASCKDPLIMIEQRLDFSKWVPGGFGTGDCLI 123

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  ++D+K+G GV V AE N Q+M YA GAL  +  I+     +++TI QPR    
Sbjct: 124 VADDTLTVIDYKHGLGVLVDAEKNPQMMCYALGALKLFDGIYD-IRQVSMTIFQPRRDN- 181

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             ++   +S ++LL+ A+         L   ++ A   E      D CRFC+ K  C   
Sbjct: 182 --VSTCTMSKEELLQWAETV-------LKPAAELAAKGEGEYKAGDHCRFCKIKATCRKR 232

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLV 297
           + + L  A  D   PST    E+    +    + ++    ++   ++  +G    G++LV
Sbjct: 233 AEYNLELAQYDFAVPSTLQDEEIEAVLAKADELVNWAGDVKEYALQQALSGKHWDGWKLV 292

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR  NR +         +      + ++R L     + +   ++     F E L +L+ 
Sbjct: 293 EGR-SNRRYVSEEAVAAKVEDAGF-DPYERKLLGITAMTKQLGKK----RFEELLSDLVE 346

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +  GKPV+ P        T  +   +F
Sbjct: 347 KPQGKPVLVPESDKRP--TMHTAADDF 371


>gi|227875069|ref|ZP_03993214.1| phage-associated protein [Mobiluncus mulieris ATCC 35243]
 gi|304390312|ref|ZP_07372265.1| phage protein [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|306817356|ref|ZP_07451101.1| phage protein [Mobiluncus mulieris ATCC 35239]
 gi|227844347|gb|EEJ54511.1| phage-associated protein [Mobiluncus mulieris ATCC 35243]
 gi|304326068|gb|EFL93313.1| phage protein [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|304649797|gb|EFM47077.1| phage protein [Mobiluncus mulieris ATCC 35239]
          Length = 378

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 108/389 (27%), Positives = 172/389 (44%), Gaps = 20/389 (5%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH 61
           + HA LSAS +HRWL C  +  LES  P++TS  A +GT AH L  H L + +   +   
Sbjct: 4   SDHALLSASGAHRWLNCTPSARLESDEPESTSAAAEQGTAAHALAEHKLRRALKQRSKRP 63

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIF 121
                +++   +  +  + V   ++  R   G      E  L+     PG  GT D +I 
Sbjct: 64  VSTWIDDEMETLTDDYVAYVQEHISLARETCGDPQVLIEQRLDFSHVVPGGFGTGDCVII 123

Query: 122 NSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGS 181
                 I+D KYG GV V+AE N QLMLYA GALH +GD++   E + +TI QPR     
Sbjct: 124 AEPTLQIIDLKYGQGVLVEAERNPQLMLYALGALHTFGDLYD-IERVAVTIYQPRRGN-- 180

Query: 182 PINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALS 241
            ++ W IS  +L   A+         +  K++ A + E        C+FC+    C A +
Sbjct: 181 -VDTWEISVTELEHWAE-------AEVKPKAELAAAGEGEFCPGSWCQFCKIAPTCRARA 232

Query: 242 RHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGDEIQGYQLV 297
              L  A  +   P+  +  E++   + I  +K++    E     +  N G   +G++LV
Sbjct: 233 EANLALARLEFAPPAELSDSEIADVLARIPQLKTWAADVEAYALSQAVNQGVVFEGFKLV 292

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
            GR   R +           +    + + R L T   +E+L  +      F E L +L+T
Sbjct: 293 AGR-SIRKYTSETDVAAAAEAAGYRDIWDRKLITLTAMERLMGK----PAFNEILGDLVT 347

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEFEV 386
           +  GKP +             S  ++F+ 
Sbjct: 348 KPAGKPTLVLASDKRPALDLVSAATDFQP 376


>gi|300764692|ref|ZP_07074683.1| hypothetical protein LMHG_11076 [Listeria monocytogenes FSL N1-017]
 gi|300514578|gb|EFK41634.1| hypothetical protein LMHG_11076 [Listeria monocytogenes FSL N1-017]
          Length = 380

 Score =  362 bits (928), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 99/391 (25%), Positives = 160/391 (40%), Gaps = 22/391 (5%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQ--GVDAETV 59
             HA LSASSS+RW+ CP +  L       +S YA +GT AH L  + L +  G D    
Sbjct: 3   TQHAVLSASSSNRWIHCPPSVRLSEHFENKSSPYAQQGTDAHTLCEYKLNKFIGNDVTDP 62

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADIL 119
           +     ++ +        A+ V   +A  +  +   +   E  L+     P   GT D L
Sbjct: 63  TSTLEFYDEEMEQCAESYATFVMEEVAKAKQTTVDPIVIVEQRLDFSRYVPDGFGTGDCL 122

Query: 120 IFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRT 179
           +       ++D KYG G+ V A  N Q+M YA GAL  +  I+   + + +TI QPR   
Sbjct: 123 VIADGTLSVIDMKYGLGILVDAYQNPQMMCYALGALELFDGIYD-IQEVKMTIFQPRREN 181

Query: 180 GSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA 239
              ++ + +  ++LL+ AK+        LS  +  A   E        C FC AK  C A
Sbjct: 182 ---VSTYTLLKEELLQWAKDV-------LSPAADLAFKGEGEYQCGKWCGFCPAKNSCRA 231

Query: 240 LSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQL 296
            + H L  A  +   P   +  E+ +    +  + S+    +D   K    G +    +L
Sbjct: 232 RADHNLKLAQYEFKPPELLSDDEIEEIIGKVDDLVSWSNDIKDCALKLALGGKQWTHQKL 291

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           VEGR   R + + N     +      + + + L     + +   ++K    F E L E I
Sbjct: 292 VEGR-STRKYSNDNDVAAAVIKAGY-DPYDKKLLGVTAMTKALGKEK----FNEILGEYI 345

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
            +  GK  +          T  +   EF+ L
Sbjct: 346 IKPKGKLTLVDGSDKRQAVTVNNLNEEFKPL 376


>gi|167039877|ref|YP_001662862.1| hypothetical protein Teth514_1232 [Thermoanaerobacter sp. X514]
 gi|300915372|ref|ZP_07132686.1| conserved hypothetical protein [Thermoanaerobacter sp. X561]
 gi|307724799|ref|YP_003904550.1| hypothetical protein Thet_1677 [Thermoanaerobacter sp. X513]
 gi|166854117|gb|ABY92526.1| hypothetical protein Teth514_1232 [Thermoanaerobacter sp. X514]
 gi|300888648|gb|EFK83796.1| conserved hypothetical protein [Thermoanaerobacter sp. X561]
 gi|307581860|gb|ADN55259.1| hypothetical protein Thet_1677 [Thermoanaerobacter sp. X513]
          Length = 375

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 105/401 (26%), Positives = 168/401 (41%), Gaps = 46/401 (11%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTT-------------SIYASEGTFAHNLLA 47
           M+ HA LSAS +HRW+ C  +  LE +    +             S              
Sbjct: 1   MSKHAILSASGAHRWMNCTPSARLELEFDDNSGEAAAEGTAAHALS-------------E 47

Query: 48  HCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFT 107
           H L + +   +         ++           V  V+   +      L   E  L+   
Sbjct: 48  HKLRKALKMRSKKPVSPYDSDEMDNYTDGYVEFVLEVIEQAKKICSDPLILIEQRLDFSK 107

Query: 108 TEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEA 167
             P   GT D LI       I+DFKYG GV V AE+N Q+ LYA GAL  +  I+   E 
Sbjct: 108 YVPEGFGTGDCLIIADGTLHIIDFKYGQGVLVSAEDNPQMKLYALGALDLFDGIYD-IEM 166

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           +++TI QPR      ++   +S ++L + A+E        L  K++ A + +      + 
Sbjct: 167 VSMTIYQPRREN---VSTSTVSKENLYQWAEEV-------LKPKAELAFNGDGNYCPGEW 216

Query: 228 CRFCRAKVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKR 284
           C+FCRA V+C A +   +  AT +   P   +  E++   SSI  + ++           
Sbjct: 217 CQFCRAAVKCRARAEAKMKLATFEFALPPLLSDEEIADILSSIGDLTNWANEIIAYATDA 276

Query: 285 L-NAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQK 343
             N G +  G+++VEGR  NR +KD     E   +    + +K+ L T  E+E+L  + K
Sbjct: 277 AVNHGKKWTGFKVVEGR-SNRKYKDEEAVAEAAKNAGYRDIYKQSLITITEMEKLMGKSK 335

Query: 344 VSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
               F E L EL+ +  GKP + P      +    S  ++F
Sbjct: 336 ----FNEILGELVMKPPGKPTLVPVSDKRPEMNTSSAKNDF 372


>gi|167757897|ref|ZP_02430024.1| hypothetical protein CLOSCI_00228 [Clostridium scindens ATCC 35704]
 gi|167664551|gb|EDS08681.1| hypothetical protein CLOSCI_00228 [Clostridium scindens ATCC 35704]
          Length = 387

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 108/387 (27%), Positives = 172/387 (44%), Gaps = 23/387 (5%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAETVS 60
            HA LSASSSHRWL CP +  L  K   T S YA EGT AH+L  + L+Q +  DA   +
Sbjct: 18  GHALLSASSSHRWLNCPPSARLCEKYEDTGSEYAQEGTDAHSLCEYKLKQALGMDAADPT 77

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                +  +      + A+ V  ++   +      +   E  L+         GT D +I
Sbjct: 78  ENLSFYNEEMEQCALDYAAYVLELVEEAKKTCKDPVMLIEQRLDFSRFVKDGFGTGDCVI 137

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  IVD+K+G GV V A  N Q+MLYA GAL  +  I+   + + +TI QPR    
Sbjct: 138 IADGTLDIVDYKHGKGVEVSAVENPQMMLYALGALELFDGIYD-IDTVRMTIFQPRRDN- 195

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             ++  +++ DDLL+            L+ K+K A          D CRFC+AK  C   
Sbjct: 196 --VSVCMMAKDDLLQW-------AYNDLTYKAKLAYEGSGEFACGDWCRFCKAKAVCRKR 246

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLV 297
           + + L  A  D   P T    E++        +  +    ++   ++  +G E  GY++V
Sbjct: 247 AEYNLELAKYDFEMPDTLEDAEIAAILDKADELTVWAVDVKEYALRQALSGTEYPGYKVV 306

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR  NR +   +   + ++     + + + +    E+ +L  ++K    F E L  LI 
Sbjct: 307 EGR-SNRRYISEDAVADAVSQAGY-DPYAKKVLGLTEMHRLLGKKK----FDELLGGLIE 360

Query: 358 RGDGKPVIAPRDIPT-NKQTQKSQLSE 383
           +  GKPV+ P         T ++   +
Sbjct: 361 KPQGKPVLVPLSDKRQPMNTAQNDFKD 387


>gi|307244285|ref|ZP_07526400.1| conserved hypothetical protein [Peptostreptococcus stomatis DSM
           17678]
 gi|306492435|gb|EFM64473.1| conserved hypothetical protein [Peptostreptococcus stomatis DSM
           17678]
          Length = 391

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 111/386 (28%), Positives = 169/386 (43%), Gaps = 20/386 (5%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            HA LS SSSHRWL C  +  LE +   T+S  A EGT AH    H L++ +   +    
Sbjct: 18  GHAVLSPSSSHRWLNCTPSAMLELEFENTSSSAAEEGTAAHTFCEHKLKKVLHMRSKRPV 77

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
                ++ +         V   L   +      +   E  ++     P   GTAD LI +
Sbjct: 78  SDYDSDEMQECTDAYVDYVMEQLEIAKQVCKDPMILIEQKVDFSEYVPDGFGTADCLIVS 137

Query: 123 STQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSP 182
                I+DFKYG GV V+A  N Q+  YA GAL  Y  ++   E +++TI QPR      
Sbjct: 138 DEILHIIDFKYGLGVLVEAYENPQMKCYALGALAIYESLYDIKE-ISMTIFQPRREN--- 193

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSR 242
           I+ + IS  +L + A+E        L  K++ A+  E    + + C+FCRA VRC A + 
Sbjct: 194 ISTYTISTSELKKWAEEV-------LKPKAEMAIKGEGEYCSGEWCKFCRASVRCRARAE 246

Query: 243 HVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGDEIQGYQLVE 298
             L  A ++   P   T  E+ +  S I  +  +     +   +   N   +  G+++VE
Sbjct: 247 DKLKLAKEEFKLPPLLTDEEIEEILSIIPDLTKWANEIMNYATEAAVNHAKKWTGFKIVE 306

Query: 299 GRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITR 358
           GR   R +KD N   +        + FK  L T  E+++L  + K    F E L +LI +
Sbjct: 307 GR-SIRKYKDENAVIQKAKEHGYTDIFKSSLITLTEMQKLMGKAK----FEEVLGDLIIK 361

Query: 359 GDGKPVIAPRDIPTNKQTQKSQLSEF 384
             GKP +             +   EF
Sbjct: 362 PSGKPTLVQESDKRKAMNISNINDEF 387


>gi|331090259|ref|ZP_08339146.1| hypothetical protein HMPREF1025_02729 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330401878|gb|EGG81453.1| hypothetical protein HMPREF1025_02729 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 376

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 100/389 (25%), Positives = 168/389 (43%), Gaps = 20/389 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M  HA LSAS+S RW+ C  +  LE +     SIYA+EGT AH L  H L++ +   +  
Sbjct: 1   MGQHAILSASASKRWMNCTPSALLEKQFADEESIYAAEGTAAHALAEHKLKRFLKKRSKR 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                  ++      +  S     +   +      +   E  L+     P   GT D++I
Sbjct: 61  PVSDYDCDEMEECTDDYVSFAMEQIEKAKQSCSDPVVMIEQRLDFSRWVPEGFGTGDLVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  IVD KYG G+ V AE N Q++LY+ GAL  +  ++   E + +TI QPR+   
Sbjct: 121 VADDTLYIVDLKYGKGIAVSAEWNPQMLLYSLGALELFDSLYD-IEKVNMTIHQPRLEN- 178

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             ++ + I+  DL+E A+         L  K++ A   E      D CRFC+AK  C A 
Sbjct: 179 --VSTFEITVHDLMEWAE-------QELMPKAEMAAKGEGEFAVGDWCRFCKAKNTCRAR 229

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLN-AGDEIQGYQL 296
           +   L  A  +   P   +  E+++       +  +               G    G++L
Sbjct: 230 AEEYLRLAQMEFKPPELLSEEEIAEVLKVADELAKWSADVYAYAQDEAITHGRVWNGFKL 289

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           VEGR  NR + +     +   +   E+ +K+ L    E+E+L  ++    +F + L  L+
Sbjct: 290 VEGR-SNRKYVNEEEVADAAKAAGYEDIYKKSLIGITEMEKLMGKK----DFQKILGSLV 344

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
            +  GK  + P          ++  ++F+
Sbjct: 345 YKPQGKITLVPESDKRPPIQTETAEADFK 373


>gi|323484116|ref|ZP_08089486.1| phage-associated protein [Clostridium symbiosum WAL-14163]
 gi|323402558|gb|EGA94886.1| phage-associated protein [Clostridium symbiosum WAL-14163]
          Length = 379

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 105/390 (26%), Positives = 168/390 (43%), Gaps = 21/390 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKI-PQTTSIYASEGTFAHNLLAHCLEQGVDAETV 59
           M  HA LSASSS RWL C ++  LE +    T S+YA EGT AH L  H L++ +   + 
Sbjct: 1   MGRHALLSASSSKRWLNCTLSARLEEQFTRDTGSVYAEEGTAAHALAEHKLKRLLKRRSK 60

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADIL 119
                   ++      E  S     +   R      +   E  L+     P   GT D++
Sbjct: 61  RPVSDYDCDEMEECTDEYVSYAMEQIELARQNCKDPIVLIEQHLDYSDYVPEGFGTGDLV 120

Query: 120 IFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRT 179
           I       ++D KYG GV V+AE N Q+MLY  GAL  +  I+   + + +TI QPR+ +
Sbjct: 121 IVADGTLTVIDLKYGKGVAVEAEWNPQMMLYGLGALELFDAIYD-IDMVRMTIYQPRLES 179

Query: 180 GSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA 239
              ++ W IS  DL++  +         L  K++ A++ E        CRFC+AK  C A
Sbjct: 180 ---VSTWEISVSDLMDWVET-------ELKPKAQLAINGEGEFRCGSWCRFCKAKNTCRA 229

Query: 240 LSRHVLLEATKDPST---NTTVELSKAYSSISLIKSYVKACEDEMFKRLN-AGDEIQGYQ 295
            +   L  A  +  T    +  E+++       +  +               G +  G++
Sbjct: 230 RAEEYLRLAQMEFQTPALLSDEEIAEVLKVADDLAKWAADVYAFATDEAITHGKQWAGFK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           LVEGR  NR + D     E   +    + +K  L    E+E+L  ++K    F E L +L
Sbjct: 290 LVEGR-SNRKYTDEEEVAEAAKAAGYTDIYKSTLVGITEMEKLMGKKK----FSEVLGKL 344

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           + +  GK  +             +  ++F+
Sbjct: 345 VYKPQGKITLVTESDKREAVMTATAEADFK 374


>gi|284048477|ref|YP_003398816.1| hypothetical protein Acfer_1134 [Acidaminococcus fermentans DSM
           20731]
 gi|283952698|gb|ADB47501.1| conserved hypothetical protein [Acidaminococcus fermentans DSM
           20731]
          Length = 382

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 100/389 (25%), Positives = 171/389 (43%), Gaps = 24/389 (6%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAETV 59
            +HA LSASSS+RWL CP +    +++P   S +A +GT AH L  + +++ +    +  
Sbjct: 3   GNHAVLSASSSYRWLACPPSAIECARLPDVQSDFAKQGTEAHALCEYKMKKALGQKGKDP 62

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADIL 119
           +     F+ +        A  V   LA  +T     L   E  L+     P   GT D L
Sbjct: 63  TKSLTYFDEEMAECTDAYAQFVLETLAAAKTTCKDPLVLVEQRLDFSRWVPEGFGTGDCL 122

Query: 120 IFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRT 179
           I       ++D+K+G GV V+AE N Q+M YA GAL  +  I+   + +++TI QPR   
Sbjct: 123 IVADDTLSVIDYKHGLGVLVEAEKNPQMMCYALGALELFDGIYD-IQKVSMTIFQPRREN 181

Query: 180 GSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA 239
              ++   +S ++LL+ A+         L   ++ A   E      D CRFC+ +  C  
Sbjct: 182 ---VSTCTLSKEELLQWAETV-------LKPTAELASGGEGEYKAGDHCRFCKIRATCRK 231

Query: 240 LSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQL 296
            + + L  A  D   PST    E+    +    + ++    ++   ++  +G    G+++
Sbjct: 232 RAEYNLELAKYDFAMPSTLEDTEVEAILAKADELVTWAGDVKEYALQQALSGKNWAGWKV 291

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           VEGR  NR + +       +        +++ L     L +L  +      F E L +LI
Sbjct: 292 VEGR-SNRRYVNEEAVAAKVEEAGYS-PYEKKLLGITALTKLLGK----RRFDELLTDLI 345

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
            +  GKPV+ P        +  +   +F 
Sbjct: 346 EKPQGKPVLVPETDKRP--SMHTAADDFS 372


>gi|150391704|ref|YP_001321753.1| hypothetical protein Amet_4012 [Alkaliphilus metalliredigens QYMF]
 gi|149951566|gb|ABR50094.1| conserved hypothetical protein [Alkaliphilus metalliredigens QYMF]
          Length = 378

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 108/388 (27%), Positives = 168/388 (43%), Gaps = 20/388 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M +HA LSASSSHRWL C  +  LE +   T+   A  G  AH L  H L++ +   +  
Sbjct: 1   MGNHAILSASSSHRWLHCLPSARLELEFENTSGEAAKAGAAAHELSEHKLKKALHIRSKR 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                  ++      +  + +   +   R      +   E  L+     P   GT D +I
Sbjct: 61  PVSEYDSDEMEECTDDYVAFIMEQVELARKSCTDPIVLIEQRLDFSCYVPDGFGTGDCVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
            +  +  IVDFKYG GV V AENN Q+ LYA GAL  Y  ++   E +++TI QPR    
Sbjct: 121 ISDDRLHIVDFKYGIGVLVDAENNPQMKLYALGALEIYDSLYDIKE-VSMTIFQPRREN- 178

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             ++ W +  ++L   A+E        L  K+ +A   E   +    C FCRA  RC A 
Sbjct: 179 --VSTWTVPVEELKAWAEE-------ELKPKAAKAYQGEGEYIPGPWCTFCRASTRCRAR 229

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGDEIQGYQL 296
           +   L  A  +   P   T  E+ +    I  +  +             N G E  G+++
Sbjct: 230 ADEKLKLAQMEFKMPPLLTDSEIEEILMIIPDLTKWANEITAYATDAAVNHGKEWSGFKV 289

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           VEGR   R +KD +   +       ++ +++ L    E+++L  + K    F E L  LI
Sbjct: 290 VEGR-SVRKYKDEDAVAQKAVESGYKDIYRKSLIPLTEMQKLMGKTK----FEEILGSLI 344

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
            +  GKP + P+          +  +EF
Sbjct: 345 VKPPGKPTLVPKTDKRVAMNVTNAKNEF 372


>gi|284048440|ref|YP_003398779.1| hypothetical protein Acfer_1095 [Acidaminococcus fermentans DSM
           20731]
 gi|283952661|gb|ADB47464.1| conserved hypothetical protein [Acidaminococcus fermentans DSM
           20731]
          Length = 382

 Score =  353 bits (905), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 104/389 (26%), Positives = 170/389 (43%), Gaps = 24/389 (6%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAE--TV 59
            +HA LSASSS+RWL CP +    +K+P   S +A +GT AH L  + +++ +  +    
Sbjct: 3   GNHAVLSASSSYRWLACPPSALECAKLPDVQSDFAKQGTEAHALCEYKVKKALGEKVTNP 62

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADIL 119
           +    TF+ +        A  V   LA  +T     L   E  L+     P   GT D L
Sbjct: 63  TKSLTTFDEEMAECTDAYAQFVLESLAAAKTVCKDPLVLVEQRLDFSRWVPEGFGTGDCL 122

Query: 120 IFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRT 179
           I       ++D+K+G GV V AE N Q+M YA GAL  +  I+   + +++TI QPR   
Sbjct: 123 IVADDTLTVIDYKHGLGVLVDAEKNPQMMCYALGALDLFDGIYD-IQKVSMTIFQPRREN 181

Query: 180 GSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA 239
              ++ + +  ++LL+ A+         L   +  A   E      D CRFC+ +  C  
Sbjct: 182 ---VSTYTLPKEELLQWAETV-------LKPTADLAAKGEGEYKAGDHCRFCKIRATCRK 231

Query: 240 LSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQL 296
            + + L  A  D   PST    E+    +    + S+V   +D   ++  +G    G+++
Sbjct: 232 RAEYNLELAKYDFAMPSTLEDPEMEAILAKADELVSWVGDVKDYALQQALSGKTWAGWKV 291

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           VEGR  NR + +       +        +++ L     L +L  +      F E L +LI
Sbjct: 292 VEGR-SNRRYVNEEAVAAKVEEAGYS-PYEKKLLGITALTKLLGK----RRFDELLTDLI 345

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
            +  GKPV+ P           +   +F 
Sbjct: 346 EKPQGKPVLVPETDKRPA--MHTAADDFS 372


>gi|304436357|ref|ZP_07396333.1| phage protein [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304370626|gb|EFM24275.1| phage protein [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 374

 Score =  352 bits (902), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 101/388 (26%), Positives = 166/388 (42%), Gaps = 24/388 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDA--ETVS 60
            HA LSASS+ RW+ CP +  L +    T S YA++GT AH L  + L + +       +
Sbjct: 4   KHAILSASSAARWIACPPSARLNASQSDTPSEYAAQGTDAHTLCEYKLRKALGERVRDPT 63

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            +  +++ +           V  ++A  R  S   +   E  ++     P   GTAD LI
Sbjct: 64  KKLSSYDCEMEECAEFYVQFVMGLVAQFREESKDTMVSVEQRVDFSDFVPDGFGTADTLI 123

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
            +     IVD+K+G G+ V AE N Q+M YA G +  +  ++   E++ + I QPR+   
Sbjct: 124 ISGKTVCIVDYKHGKGIEVSAERNPQMMCYALGCIQMFDGLYD-IESIWMIIFQPRLSN- 181

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             I+E+ IS  DLL             L   +K A + E        C+FCR K  C   
Sbjct: 182 --ISEYTISKVDLLTW-------AADTLVPAAKLAHAGEGEFCAGAHCQFCRIKATCRKR 232

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLV 297
           + + L  A  D   P T    E+    +   ++ ++V   ++   +R   G     ++LV
Sbjct: 233 AEYNLELARYDFEMPPTLEDSEVEAVLAKADMLAAWVSDIKEYALQRAIQGKRWTDWKLV 292

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR  NR + D     + +      E +++ L     +  L  + K    F E L   + 
Sbjct: 293 EGR-SNRKYTDEAAVAKTVKEAGY-EPYEQKLLGITAMTGLLGKNK----FEELLGGFVI 346

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           +  GKP +AP           +   +F+
Sbjct: 347 KPQGKPTLAPMSDKRPV--MNTAAEDFK 372


>gi|313813476|gb|EFS51190.1| conserved hypothetical protein [Propionibacterium acnes HL025PA1]
 gi|315106929|gb|EFT78905.1| conserved hypothetical protein [Propionibacterium acnes HL030PA1]
          Length = 380

 Score =  351 bits (901), Expect = 9e-95,   Method: Composition-based stats.
 Identities = 110/387 (28%), Positives = 174/387 (44%), Gaps = 21/387 (5%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV-DAETVSH 61
            HA LSAS +HRWL CP +  LES+ P +TS  A +GT AH L    L + + DA T   
Sbjct: 4   QHALLSASGAHRWLNCPPSAVLESREPDSTSAAAEQGTVAHALAEWKLRRALNDAPTFKP 63

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIF 121
           +    + +   +  +  + V   ++  R   G      E  L+     PG  GT D +I 
Sbjct: 64  ESGWIDTEMEDLTDDYVAFVQEHISLAREACGDPQVLIEQRLDFSHVVPGGFGTGDCVII 123

Query: 122 NSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGS 181
              +  I+D KYG G+ V+A +N QLMLYA GA+H +GD++   + + +TI QPR     
Sbjct: 124 AEPKLQIIDLKYGQGILVEAAHNPQLMLYALGAVHAFGDLYDITD-VAVTIYQPRRGN-- 180

Query: 182 PINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALS 241
            ++ W  S  DLL  A+         +  K++ A +          C+FCR    C A +
Sbjct: 181 -VDTWETSVADLLAWAET-------EVKPKAELAAAGGGEFCPGSWCQFCRIAPTCRARA 232

Query: 242 RHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGDEIQGYQLV 297
              L  A  +   P+  +  E++   + I  +K++    E     +  N G    G++LV
Sbjct: 233 EANLALAQHEFAPPAELSGSEIADVLTRIPQLKTWAADVEAYALSQAVNQGKHWDGFKLV 292

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
            GR   R + + N   E   +    + + R L T   +E+L  ++     F E L +L+ 
Sbjct: 293 AGR-SVRKYTEENAVAEAAEAAGYADIYDRRLITLTAMERLMDKKT----FNEVLGDLVV 347

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +  GKP +             S  +EF
Sbjct: 348 KPVGKPTLVSDTDKRPALEIHSAQTEF 374


>gi|50843072|ref|YP_056299.1| phage-associated protein [Propionibacterium acnes KPA171202]
 gi|50840674|gb|AAT83341.1| conserved phage-associated protein [Propionibacterium acnes
           KPA171202]
          Length = 380

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 110/387 (28%), Positives = 174/387 (44%), Gaps = 21/387 (5%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV-DAETVSH 61
            HA LSAS +HRWL CP +  LES+ P +TS  A +GT AH L    L + + DA T   
Sbjct: 4   QHALLSASGAHRWLNCPPSAVLESREPDSTSAAAEQGTVAHALAEWKLRRALNDAPTFKP 63

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIF 121
           +    + +   +  +  + V   ++  R   G      E  L+     PG  GT D +I 
Sbjct: 64  ESGWIDTEMEDLTDDYVAFVQEHISLAREACGDPQVLIEQRLDFSHVVPGGFGTGDCVII 123

Query: 122 NSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGS 181
              +  I+D KYG G+ V+A +N QLMLYA GA+H +GD++   + + +TI QPR     
Sbjct: 124 AEPKLQIIDLKYGQGILVEAAHNPQLMLYALGAVHAFGDLYDITD-VAVTIYQPRRGN-- 180

Query: 182 PINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALS 241
            ++ W  S  DLL  A+         +  K++ A +          C+FCR    C A +
Sbjct: 181 -VDTWETSVADLLAWAET-------EVKPKAELAAAGGGEFCPGSWCQFCRIAPTCRARA 232

Query: 242 RHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGDEIQGYQLV 297
              L  A  +   P+  +  E++   + I  +K++    E     +  N G    G++LV
Sbjct: 233 EANLALAQHEFAPPAELSGSEIADVLTRIPQLKTWAADVEAYALSQAVNQGKHWDGFKLV 292

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
            GR   R + + N   E   +    + + R L T   +E+L  ++     F E L +L+ 
Sbjct: 293 AGR-SVRKYTEENAVAEAAEAAGYADIYDRRLITLTAMERLMDKKT----FNEVLGDLVV 347

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +  GKP +             S  +EF
Sbjct: 348 KPVGKPTLVSDTDKRPALEIHSVQTEF 374


>gi|167630955|ref|YP_001681454.1| hypothetical protein HM1_2934 [Heliobacterium modesticaldum Ice1]
 gi|167593695|gb|ABZ85443.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 373

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 95/377 (25%), Positives = 159/377 (42%), Gaps = 23/377 (6%)

Query: 14  RWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAE--TVSHQKLTFENDTR 71
           RWL CP +  L        S YA+EGT AH L  + L+  +       +     +  +  
Sbjct: 14  RWLNCPPSARLCESYEDKGSDYAAEGTDAHTLCEYKLKTALGIRAKDPTSDLTYYNEEME 73

Query: 72  IVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDF 131
                 A+ +  ++   +      +   E  L+      G  GT D L+       IVD+
Sbjct: 74  DCANGYAAYILEIVETAKQTCADPVVLIEQRLDFSKYVEGGFGTGDCLVIADGTLYIVDY 133

Query: 132 KYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISAD 191
           K+G GV V+AE+N Q+MLYA GAL  + DI+     +++TI QPR      ++ + +S +
Sbjct: 134 KHGQGVLVEAEDNPQMMLYALGALEIFDDIYDIV-TVSMTIYQPRRDN---VSTYTVSKE 189

Query: 192 DLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEATKD 251
            L + A+E        L   ++ A +        + C+FC+ K  C A + H L  A  D
Sbjct: 190 SLYQWAEEV-------LKPAAELAYAGGGRFNCGEWCQFCKVKHECRARAEHNLELARYD 242

Query: 252 ---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKD 308
              P      E+      I  + S+    +D   +    G +  G++LVEGR  NR + D
Sbjct: 243 FKLPPLLEDAEVEDILGKIDDLVSWANDIKDYALQAALGGKQWNGWKLVEGR-SNRRYTD 301

Query: 309 INRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPR 368
            +   + +++    + ++R +     +  L  ++     F E L   I +  GKP + P 
Sbjct: 302 ESAVADAVSAAGF-DPYERKVLGITAMTSLLGKK----RFEEVLGGFIDKPPGKPTLVPE 356

Query: 369 DIPTNKQ-TQKSQLSEF 384
                   T +   SEF
Sbjct: 357 SDKRPAIHTAQQDFSEF 373


>gi|297583084|ref|YP_003698864.1| hypothetical protein Bsel_0769 [Bacillus selenitireducens MLS10]
 gi|297141541|gb|ADH98298.1| conserved hypothetical protein [Bacillus selenitireducens MLS10]
          Length = 375

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 103/388 (26%), Positives = 162/388 (41%), Gaps = 20/388 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M  HA +SASSSHRWL C  +  LE     T+   A EGT AH L  H +   +   +  
Sbjct: 1   MGTHAVVSASSSHRWLYCTPSARLEQAFEDTSGEAAKEGTAAHELAEHKIRSALKIPSER 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
              +    +           V  V+A V+      +   E  L      P   GT D +I
Sbjct: 61  PTSVYDSEELEQFTDGYVQYVLDVIAEVQEACRDPMILIEQRLNFSHYVPEGFGTGDCVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  ++DFKYG  V V+AE N Q+ LYA GAL     ++     + +TI QPR    
Sbjct: 121 IADGTLHVIDFKYGQNVIVEAEENPQMKLYALGALAIADHLYDVAN-VMMTIYQPRRH-- 177

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             I+ +  S + L + A E        L  K+  A   +    + + C+FCRA+VRC A 
Sbjct: 178 -HISTFHCSTEALYQWADE-------ELKPKAALAFQGKGPFCSGEWCQFCRAQVRCRAK 229

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKR-LNAGDEIQGYQL 296
           +   L  A+ +   P+  T  E++     I  + S+ +  +       +N G +  G++L
Sbjct: 230 AEEKLALASYEFVNPNLLTDEEIADVLKRIEDLASWGQKVKTYAINASINQGKQWPGFKL 289

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           V G+   R ++D       L     E+ +K+ L    +LE+          F + +   +
Sbjct: 290 VAGK-SQRKYRDEQAVARALHEAGHEDVYKQSLLPLTKLEKKLGRTA----FQDLVGPHL 344

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           TR   KP + P      +    +  S+F
Sbjct: 345 TRSTTKPTLVPVSDERPESLIGTAKSDF 372


>gi|256617074|ref|ZP_05473920.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|257088363|ref|ZP_05582724.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|256596601|gb|EEU15777.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256996393|gb|EEU83695.1| conserved hypothetical protein [Enterococcus faecalis D6]
          Length = 380

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 93/388 (23%), Positives = 156/388 (40%), Gaps = 22/388 (5%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDA--ETV 59
             HA LSASSS+RW+ CP +  L  +    TS +A +GT AH L  + L + +    E  
Sbjct: 3   TQHALLSASSSNRWIHCPPSVRLSEQFENKTSDFARQGTDAHTLCEYKLHKLLGDDVEDP 62

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADIL 119
           +     ++ +        A+ V   +A  R  +   +   E  L+     P   GT D L
Sbjct: 63  TPSLEFYDEEMEQCAESYATFVMEEVAKARQTTADPIVIVEQRLDFSRFVPDGFGTGDCL 122

Query: 120 IFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRT 179
           +       ++D KYG G+ V A  N Q+M YA GAL  +  I+   + + +TI QPR   
Sbjct: 123 VIADGTLSVIDMKYGLGILVDAYQNPQMMCYALGALELFDGIYD-IQEVKMTIFQPRREN 181

Query: 180 GSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA 239
              ++ + +S DDLL+ A E        L   ++ A   E        C FC AK  C A
Sbjct: 182 ---VSTYTLSKDDLLQWADEI-------LVPAAQLAFKGEGEYQCGKWCGFCPAKNSCRA 231

Query: 240 LSRHVLLEATKDPS---TNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQL 296
            +   L  +  +          E+ +    +  + S+    ++   +   +G +   ++L
Sbjct: 232 RAEQNLELSKYEFQKPELLEDDEIEEILEKVDDLISWSNDIKEYALQLALSGKQWANHKL 291

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           VEGR   R + + N     +      + + + L     + +   + K    F E L + I
Sbjct: 292 VEGR-STRKYSNDNDVAAAVIKAGY-DPYDKKLLGVTAMTKALGKAK----FDELLSDYI 345

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
            +   K  +   D         +   EF
Sbjct: 346 VKPPCKLTLVTNDDKRQAVKINNVNDEF 373


>gi|153940578|ref|YP_001391680.1| hypothetical protein CLI_2438 [Clostridium botulinum F str.
           Langeland]
 gi|152936474|gb|ABS41972.1| conserved hypothetical protein [Clostridium botulinum F str.
           Langeland]
 gi|295319709|gb|ADG00087.1| conserved hypothetical protein [Clostridium botulinum F str.
           230613]
          Length = 381

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 103/399 (25%), Positives = 177/399 (44%), Gaps = 32/399 (8%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD--AET 58
           M  HA LSAS + RWL CP +  LE   P  +S +A EGT AH L    L++ ++  +  
Sbjct: 1   MTKHAILSASGASRWLACPPSARLEQDFPNKSSEFAKEGTLAHELGELGLKKNLELISTR 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPG 111
             + +       ++   +M   V + +          +  +   L + E  L+     P 
Sbjct: 61  KYNSEFKKIEVDKLFTKDMPDYVEVYVDTCMEKVAEAKAKTPDALFKIEQRLDFSEWVPD 120

Query: 112 ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLT 171
             GT D +I       I D KYG GVPV A NN Q+ LYA GA+ ++  ++   E + +T
Sbjct: 121 GFGTGDFVIIADGTMEICDLKYGKGVPVSAVNNKQMRLYALGAIAEFSFLYD-IENIKMT 179

Query: 172 IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
           IIQPR+ +   I+   +  ++LL+ A+E        L   +K A   +      D C+FC
Sbjct: 180 IIQPRLDS---ISTDEMKVEELLKWAEE-------ELKPIAKLAYEGKGEFCAGDHCKFC 229

Query: 232 RAKVRCPALSRHVLLEATKDPS---TNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG 288
           RAK  C A +   +  A  D     T    +++        + ++ K  ++   ++   G
Sbjct: 230 RAKAVCKARADKNMELAKYDFQEPITLDNNDVAFILGKADELINWAKDVQEYALEQALQG 289

Query: 289 DEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSD 346
           +E  G+++VEGR  NR + D  +  ++L      E   + + L     +E+   +++V+ 
Sbjct: 290 EEFDGFKVVEGR-SNRKWTDEEKIGKILLGQGFLEDIIYTKKLTGITNMEKAIGKKEVTK 348

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
                L + I +  GKP +A            S  ++F+
Sbjct: 349 ----LLGDYIIKPQGKPTLATITDKRPV--YNSAEADFK 381


>gi|300933389|ref|ZP_07148645.1| phage-associated protein [Corynebacterium resistens DSM 45100]
          Length = 377

 Score =  345 bits (885), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 109/387 (28%), Positives = 172/387 (44%), Gaps = 22/387 (5%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV-DAETVSH 61
            HA LSAS +HRWL+CP + TLE+ +P+ +S  A +GT AH L    L + + DA T   
Sbjct: 4   QHALLSASGAHRWLECPPSATLEAGLPEYSSQAAEQGTAAHALAEWKLRRALHDAPTAKP 63

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIF 121
                +    ++  +    V   L  VR          E  L+     PG  GT D +I 
Sbjct: 64  VSSWHDEQMDVLTDDYVVFVQERLRDVRQACADPQVLIEQRLDFSHVVPGGFGTGDCVII 123

Query: 122 NSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGS 181
                 I+D KYG GV V+AE N QLMLYA GAL  +G ++   E + +TI QPR     
Sbjct: 124 AEPTLQIIDLKYGQGVMVEAEENPQLMLYALGALEAFGSLYDITE-VAVTIFQPRRSN-- 180

Query: 182 PINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALS 241
            ++ W I   +L   A++        +  ++  A S +      + CRFC+    C   +
Sbjct: 181 -VSTWTIPVSELEAWAEQV-------VKPRAALAASGDGEFAPGEWCRFCKLAPTCRTRA 232

Query: 242 RHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEIQGYQLV 297
              L  A  +   P+  +  E+++  + +  +K++    E       +N G    G++LV
Sbjct: 233 EANLALAQHEFAPPAELSDAEIAQVLAQLPDLKAWAADVEAHALSLAVNQGKTWPGFKLV 292

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR   R + D +   +   +    + + R LKT   LE+   ++     F   L +L+ 
Sbjct: 293 EGR-SIRKYSDESAVAQAAEAAGV-DVWDRKLKTITALEKQLGKK----RFTTLLGDLVV 346

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +  GKP + P          +S   EF
Sbjct: 347 KPAGKPTLVPESDKRPALEIQSATDEF 373


>gi|226949735|ref|YP_002804826.1| conserved phage-associated protein [Clostridium botulinum A2 str.
           Kyoto]
 gi|226842707|gb|ACO85373.1| conserved phage-associated protein [Clostridium botulinum A2 str.
           Kyoto]
          Length = 381

 Score =  345 bits (885), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 103/399 (25%), Positives = 174/399 (43%), Gaps = 32/399 (8%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD--AET 58
           M  HA LSAS + RWL CP +  LE   P  +S +A EGT AH L    L++ ++  +  
Sbjct: 1   MVKHAILSASGASRWLACPPSARLEENYPNKSSEFAKEGTLAHELGELGLKKNLELISTR 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPG 111
             +  L      ++   +M   V + +          +  +   L + E  L+     P 
Sbjct: 61  KFNSGLKKIEADKLYTIDMPDYVEVYVDTCMEKVAEAKAKTPDALFKIEQRLDFSEWVPD 120

Query: 112 ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLT 171
             GT D +I       I D KYG GVPV A  N Q+ LYA GA+  +  ++   E + +T
Sbjct: 121 GFGTGDFVIIADGTMEICDLKYGKGVPVSAIGNKQMRLYALGAIAAFSFLYD-IEKIKMT 179

Query: 172 IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
           IIQPR+ +   I+   +  ++LL+            L   +K A   +      D C+FC
Sbjct: 180 IIQPRLDS---ISTDEMLVEELLKW-------AQEELKPIAKLAYEGKGEFCAGDHCKFC 229

Query: 232 RAKVRCPALSRHVLLEATKDPS---TNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG 288
           RAK  C A +   +  A  D     T    +++        + ++ K  ++   ++   G
Sbjct: 230 RAKAVCKARADKNMELAQYDFQEPNTLDNNDIAFILGKADELINWAKDVQEYALEQALQG 289

Query: 289 DEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSD 346
           +E  G+++VEGR  NR + D ++  E+L      E   + + L     +E+   +++V+ 
Sbjct: 290 EEFDGFKVVEGR-SNRKWTDEDKIGEILLGQGFLENIIYTKKLTGITNMEKAIGKKEVNR 348

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
                L + IT+  GKP +A            S  ++F+
Sbjct: 349 ----LLGDYITKPQGKPTLATITDKRPV--YNSAEADFK 381


>gi|300853537|ref|YP_003778521.1| phage-like protein [Clostridium ljungdahlii DSM 13528]
 gi|300433652|gb|ADK13419.1| phage-related protein [Clostridium ljungdahlii DSM 13528]
          Length = 387

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 101/398 (25%), Positives = 164/398 (41%), Gaps = 40/398 (10%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHN----------LLAHCL 50
           M  HA LSAS SHRWL C  +  LE +     S                     L  H L
Sbjct: 1   MGSHAILSASGSHRWLNCLPSARLELEFEDKES----------TAAAEGTAAHALCEHKL 50

Query: 51  EQGVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP 110
            + +   +         ++           V   L   +      L   E  L+     P
Sbjct: 51  RKALRMRSKRPVSSYDTDEMEEHSDAYVDFVIEQLEIAKQNCKDPLVLIEQRLDFSCYVP 110

Query: 111 GATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTL 170
              GT D +I    +  I+DFKYG GV V A +N Q+ LYA GAL  +  ++   E +++
Sbjct: 111 QGFGTGDCIIIADEELHIIDFKYGMGVLVDAVDNPQMKLYALGALEIFDSLYDIKE-VSM 169

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRF 230
           TI QPR      I+ W IS ++L + A+         L  K++ A++ E   +  + C F
Sbjct: 170 TIFQPRREN---ISTWTISVEELKDWAEN-------ELKPKAQMAINGEGEYLPGEWCTF 219

Query: 231 CRAKVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-N 286
           C+A V+C A +   L  A  +   P   T +E+ +    I  +  +             N
Sbjct: 220 CKASVKCRARAEAKLELARAEFMLPPLLTDMEIEEIIHKIPDLTKWANEIMAYATDAAIN 279

Query: 287 AGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSD 346
            G +  G+++VEGR  NR +KD +   +   +   ++ + + L T  E+++L  ++    
Sbjct: 280 HGKQWSGFKVVEGR-SNRKYKDEDAVADAAKTNGYKDIYHQRLITITEMQKLMGKK---- 334

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +F + L  LI +  GKP + P           +  +EF
Sbjct: 335 QFEKILGCLIYKPPGKPTLVPITDKRTAMDTSNANNEF 372


>gi|260579054|ref|ZP_05846953.1| phage protein [Corynebacterium jeikeium ATCC 43734]
 gi|300933487|ref|ZP_07148743.1| phage-associated protein [Corynebacterium resistens DSM 45100]
 gi|258602805|gb|EEW16083.1| phage protein [Corynebacterium jeikeium ATCC 43734]
          Length = 377

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 108/387 (27%), Positives = 173/387 (44%), Gaps = 22/387 (5%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV-DAETVSH 61
            HA LSAS +HRWL CP + TLE+ +P++TS  A +GT AH L    L + + DA T   
Sbjct: 4   QHALLSASGAHRWLACPPSATLEAGLPESTSQAAEQGTAAHELAEWKLRRALHDAPTTKP 63

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIF 121
                + +   +  +  + V   L  VR          E  L+     PG  GT D +I 
Sbjct: 64  VSSWHDEEMDALTDDYVAFVQERLRDVRQVCADPQVLIEQRLDFSHVVPGGFGTGDCVII 123

Query: 122 NSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGS 181
                 I+D KYG GV V+AE+N QLMLYA GAL+ +G ++     + +TI QPR     
Sbjct: 124 AEPTLQIIDLKYGQGVMVEAEHNPQLMLYALGALNAFGSLYD-INEVAVTIFQPRRSN-- 180

Query: 182 PINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALS 241
            ++ W     +L   A++        +  ++  A S +      + CRFC+    C   +
Sbjct: 181 -VSTWRAPVAELEAWAEQV-------VKPRAALAASGDGEFAPGEWCRFCKLAPTCRTRA 232

Query: 242 RHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEIQGYQLV 297
              L  A  +   P+  +  E+++  + +  +K++    E       +N G    G++LV
Sbjct: 233 EANLALAKYEFAPPAEFSDAEIAQVLAQLPDLKAWAADVEAHALSLAVNQGKTWPGFKLV 292

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR   R + D     +   +    + + R LKT   LE+   ++     F + L +L+ 
Sbjct: 293 EGR-SIRKYSDEAAVAQTAEAAGV-DVWDRKLKTITALEKQLGKK----RFSDLLGDLVV 346

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +  GKP + P          +S   EF
Sbjct: 347 KPAGKPTLVPESDKRPALEIQSATDEF 373


>gi|168179453|ref|ZP_02614117.1| phage protein [Clostridium botulinum NCTC 2916]
 gi|182669541|gb|EDT81517.1| phage protein [Clostridium botulinum NCTC 2916]
          Length = 381

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 104/399 (26%), Positives = 178/399 (44%), Gaps = 32/399 (8%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD--AET 58
           MA HA LSAS + RWL CP +  LE   P  +S +A EGT AH L    L++ ++  +  
Sbjct: 1   MAKHAILSASGASRWLACPPSARLEENYPNKSSEFAKEGTLAHELGELGLKKNLELISTR 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPG 111
             + +       ++   +M   V + +          +  +   L + E  L+     P 
Sbjct: 61  KYNSEFKKIETDKLFTKDMPDYVEVYVDTCMEKVAEAKAKTPDALFKMEQRLDFSEWVPD 120

Query: 112 ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLT 171
             GT D +I       I D KYG GVPV A NN Q+ LYA GA+ ++  ++   E + +T
Sbjct: 121 GFGTGDFVIIADGTMEICDLKYGKGVPVSAVNNKQMRLYALGAIAEFSFLYD-IENIKMT 179

Query: 172 IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
           IIQPR+ +   I+   +  ++LL+ A+E        L   +K A   +      D C+FC
Sbjct: 180 IIQPRLDS---ISTDEMKVEELLKWAEE-------ELKPIAKLAFEGKGEFCAGDHCKFC 229

Query: 232 RAKVRCPALSRHVLLEATKDPS---TNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG 288
           RAK  C A +   +  A  D     T    +++        + ++ K  ++   ++   G
Sbjct: 230 RAKAVCKARADKNMELAKYDFQEPNTLDNNDIAFILGKADELINWAKDVQEYALEQALKG 289

Query: 289 DEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSD 346
           +E  G+++VEGR  NR + D  +  ++L      E   + + L     +E+   +++V+ 
Sbjct: 290 EEFDGFKVVEGR-SNRKWTDEEKIGKILLGQGFLEDIIYTKKLTGITNMEKAIGKKEVTK 348

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
                L + I +  GKP +A            S  ++F+
Sbjct: 349 ----LLGDYIIKPQGKPTLATITDKRPV--YNSAEADFK 381


>gi|313896485|ref|ZP_07830036.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312974909|gb|EFR40373.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 374

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 96/388 (24%), Positives = 162/388 (41%), Gaps = 24/388 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAETVS 60
            HA LSASS+ RW+ CP +  L +      S YA++GT AH L  + L + +   A   +
Sbjct: 4   KHAVLSASSAARWIACPPSARLNADKSDMPSEYAAQGTDAHALCEYKLRKALGEKARDPT 63

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
               +++ +           V  ++   R  S   +   E  ++     P   GTAD LI
Sbjct: 64  KHLASYDTEMEECAEAYCQFVMELVGQFRAESKDTMVSVEQRVDFSAFVPDGFGTADTLI 123

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
            +     IVD+K+G G+ V A++N Q+M YA G +  +  ++     + + I QPR+   
Sbjct: 124 VSGKTVCIVDYKHGKGIEVSADHNPQMMCYALGCVQLFDGLYD-IGDVRMVIFQPRLAN- 181

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             I+E+ IS  +LL             L   +K   + E        C+FC+ K  C   
Sbjct: 182 --ISEFSISKANLLAW-------AADTLVPAAKLTHAGEGEFSAGAHCQFCKIKATCRKR 232

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLV 297
           + + L  A  D   P T    E+    +    + ++V   ++   +R   G +   ++LV
Sbjct: 233 AEYNLELARYDFEMPPTLEDAEVEAVLAKADTLAAWVSDIKEYALQRAIQGKQWADWKLV 292

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR  NR + D     + +      E +++ L     +  L  + K    F E L   I 
Sbjct: 293 EGR-SNRKYTDETAVAKTVKEAGF-EPYEQKLLGITAMTALLGKSK----FEELLGGFIV 346

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           +  GKP +AP           +   +F+
Sbjct: 347 KPQGKPTLAPMSDKRPV--MNTAAEDFK 372


>gi|315121963|ref|YP_004062452.1| hypothetical protein CKC_01065 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495365|gb|ADR51964.1| hypothetical protein CKC_01065 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 388

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 275/384 (71%), Positives = 325/384 (84%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M  HAFLSASSSHRWLKCPIAPTLESKIPQTTS YA EGTFAHNLLAHCLE+GVDAET +
Sbjct: 1   MTRHAFLSASSSHRWLKCPIAPTLESKIPQTTSSYALEGTFAHNLLAHCLEKGVDAETFA 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
           ++K+TFENDTRIVD EMASSV M   YVR+FSG  LSETEVPLEPFTTE GATGTADI+I
Sbjct: 61  NRKITFENDTRIVDAEMASSVQMACEYVRSFSGNLLSETEVPLEPFTTEKGATGTADIII 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
           FN+  W+I DFKYGAGVPV  E+N QLMLYA GALHQYGDIFG PE +TLTIIQPR+R G
Sbjct: 121 FNNKHWVIADFKYGAGVPVNPEHNPQLMLYALGALHQYGDIFGSPETVTLTIIQPRIRAG 180

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
           SP+ EW IS+++L EKAKEF+ +G  ALSLK KRA+    YGV++D+CRFCRAK RCPAL
Sbjct: 181 SPLQEWTISSEELREKAKEFQAKGKHALSLKGKRAIPQNVYGVDEDACRFCRAKTRCPAL 240

Query: 241 SRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGR 300
           SRHVLLE  +DP +   V+LSKAYSS+ LI+ Y+KA ++E+FKRL+ G+E++GYQLVEGR
Sbjct: 241 SRHVLLETIRDPKSGCEVDLSKAYSSLPLIEQYIKALKEEVFKRLSEGEEVKGYQLVEGR 300

Query: 301 KGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGD 360
           KGNR+FKDI +A E LT VLG++AFK+IL +PKE+EQ  K+Q +S + WEELQELITRGD
Sbjct: 301 KGNRTFKDIEQATEYLTGVLGDKAFKKILLSPKEVEQFRKDQTLSSDVWEELQELITRGD 360

Query: 361 GKPVIAPRDIPTNKQTQKSQLSEF 384
           GKPVIAPRDIP   + QK+++S+F
Sbjct: 361 GKPVIAPRDIPPVPRIQKAEISDF 384


>gi|153814239|ref|ZP_01966907.1| hypothetical protein RUMTOR_00448 [Ruminococcus torques ATCC 27756]
 gi|145848635|gb|EDK25553.1| hypothetical protein RUMTOR_00448 [Ruminococcus torques ATCC 27756]
          Length = 375

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 100/389 (25%), Positives = 167/389 (42%), Gaps = 20/389 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M  HA  S SS  R L+CP +  LE + P   S +A+EGT  H +  + + + +   T  
Sbjct: 1   MGGHARYSPSSGKRRLECPPSLLLEEQFPDEESPFAAEGTAGHAMAEYLINKYLKKRTKR 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                + ++      +        +   R          E+ +          GTAD+++
Sbjct: 61  PVSDYYSDELLEAVDDYVEYNICQIEQARKDCDDPFIGVELKVSLAHRIRDCFGTADMVV 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
            +S +  I+D K G GV V AE N QLM+Y  G L   G ++   + + LTI+QPR+   
Sbjct: 121 VDSHKIHIIDLKLGKGVVVDAEQNVQLMIYGLGVLDMLGFLY-EIDTVELTIVQPRIE-- 177

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
              + W ISA++LL   K+  E         + +A++ E      D CRFC+A+  C A 
Sbjct: 178 -HFSTWEISAEELLVWGKDVLE-------PGAAKALAGEGEFKTGDHCRFCKARFTCRAR 229

Query: 241 SRHVLLEATK---DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGDEIQGYQL 296
           +   L  A     +P+  +  E+++  S    +K + +               E  GY+L
Sbjct: 230 AEEYLKLAQMEFAEPALMSDEEIAEVLSKADALKKWAEEVYTYAQNEAVVNHKEWPGYKL 289

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           V GR  NR + D +   E        + +K+ L    E+E+L  ++K    F E L  L+
Sbjct: 290 VLGR-SNRKYTDEDEVAEAAQKAGYTDIYKKNLIGITEMERLMGKKK----FNEILGSLV 344

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
            + DGK  + P           +  ++F+
Sbjct: 345 YKPDGKVTLVPDSDKREAVKTATAEADFK 373


>gi|154504842|ref|ZP_02041580.1| hypothetical protein RUMGNA_02352 [Ruminococcus gnavus ATCC 29149]
 gi|153794725|gb|EDN77145.1| hypothetical protein RUMGNA_02352 [Ruminococcus gnavus ATCC 29149]
          Length = 375

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 102/389 (26%), Positives = 165/389 (42%), Gaps = 20/389 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M  HA  S SS  R L+CP +  LE + P   S +A+EG+  H +  + + + +   T  
Sbjct: 1   MGGHARFSPSSGKRRLECPPSLLLEEQFPDEESPFAAEGSAGHAMAEYLINKYLKKRTKR 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                + ++      +        +   R          E+ +       G  GTAD+++
Sbjct: 61  PVSDYYSDELLEAVDDYVEYNITQIEQARKDCDEPFIGVELKVSLAHRIEGCFGTADMVV 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
            +S +  I+D K G GV V AE N QLM+Y  G L   G ++   + + LTI+QPR+   
Sbjct: 121 VDSHKIHIIDLKLGKGVVVDAEQNVQLMIYGLGVLDMLGFLY-EIDTVELTIVQPRIE-- 177

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
              + W ISA +LL   K+  E           +A+S E      D CRFC+A+  C A 
Sbjct: 178 -HFSTWEISAGELLAWGKDVLE-------PGVAKALSGEGEFKAGDHCRFCKARFTCRAR 229

Query: 241 SRHVLLEATK---DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGDEIQGYQL 296
           +   L  A     +P+  +  E+++  S    +K + +               E  GY+L
Sbjct: 230 AEEYLKLAQMEFAEPALMSDAEIAEVLSKADALKKWAEEVYTYAQNEAVVNHKEWPGYKL 289

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           V GR  NR + D     E        + FK+ L    E+E+L  ++K    F E L  L+
Sbjct: 290 VLGR-SNRKYTDEEDVAEAAQKAGYTDIFKKSLIGITEMERLMGKKK----FNEILGSLV 344

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
            + DGK  + P           +  ++F+
Sbjct: 345 YKPDGKVTLVPDSDKREAVKTATAEADFK 373


>gi|315122931|ref|YP_004063420.1| hypothetical protein CKC_05935 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496333|gb|ADR52932.1| hypothetical protein CKC_05935 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 388

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 277/384 (72%), Positives = 330/384 (85%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M  HAFLSASSSHRWLKCPIAPTLESKIPQTTS YA EGTFAHNLLAHCLE+GVDAET +
Sbjct: 1   MTRHAFLSASSSHRWLKCPIAPTLESKIPQTTSSYALEGTFAHNLLAHCLEKGVDAETFA 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
           ++K+TFENDTRIVD EMASSV M   YVR+FSG  LSETEVPLEPFTTE GATGTADI+I
Sbjct: 61  NRKITFENDTRIVDAEMASSVQMACEYVRSFSGNLLSETEVPLEPFTTEKGATGTADIII 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
           FN+  W+I DFKYGAGVPV  E+N QLMLYA GALHQYGDIFG PE +TLTIIQPR+R G
Sbjct: 121 FNNKHWVIADFKYGAGVPVNPEHNPQLMLYALGALHQYGDIFGSPETVTLTIIQPRIRAG 180

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
           SP+ EW IS+++L EKAKEF+ +G LALSLK KR+++LEHYGV++D+CRFCRAK RCPAL
Sbjct: 181 SPLQEWTISSEELREKAKEFQAKGKLALSLKGKRSITLEHYGVDEDACRFCRAKTRCPAL 240

Query: 241 SRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGR 300
           SRHVLLE  +DP +   V+LSKAYSS+ LI+ Y+K+ ++E+FKRL+ G+E++GYQLVEGR
Sbjct: 241 SRHVLLETIRDPKSGYEVDLSKAYSSLPLIEQYIKSLKEEVFKRLSEGEEVKGYQLVEGR 300

Query: 301 KGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGD 360
           KGNR+FKDI +A E LT VLG++AFK+IL +PKE+EQ  K+Q +S + WEELQELITRGD
Sbjct: 301 KGNRTFKDIEQATEYLTGVLGDKAFKKILLSPKEVEQFRKDQTLSSDVWEELQELITRGD 360

Query: 361 GKPVIAPRDIPTNKQTQKSQLSEF 384
           GKPVIAPRDIP   + QK+++S+F
Sbjct: 361 GKPVIAPRDIPPVPRIQKAEISDF 384


>gi|134299051|ref|YP_001112547.1| hypothetical protein Dred_1188 [Desulfotomaculum reducens MI-1]
 gi|134051751|gb|ABO49722.1| conserved hypothetical protein [Desulfotomaculum reducens MI-1]
          Length = 397

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 105/401 (26%), Positives = 180/401 (44%), Gaps = 33/401 (8%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD--AET 58
           M  HAFLSAS S RW++CP +  LE +     S YA+EG+FAH+L    L   ++  ++ 
Sbjct: 1   MTAHAFLSASGSKRWMECPPSAMLEKQFKDVQSAYAAEGSFAHSLAELHLNLYLENISKH 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAY-------VRTFSGPFLSETEVPLEPFTTEPG 111
             + +            EM   V + + +        R  +   + + E  L+     P 
Sbjct: 61  KFNSEWNKLQQNEFFSQEMIDYVDVYVGFAIERINAARARTKDAVIQIEQRLDYSPWVPN 120

Query: 112 ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLT 171
             GT D++        I D KYG GVPV A +N Q+ LYA GA++Q+  ++   + + +T
Sbjct: 121 GFGTGDLITIADEIMEIADLKYGKGVPVSALDNPQMKLYALGAINQFNLLYDF-QIVRMT 179

Query: 172 IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
           I+QPR+ +   I+   +S  +LL+ A+         +   +  A+  E      + C+FC
Sbjct: 180 IVQPRLDS---ISIAELSVKELLDWAEN-------TVKPLAAMAIKGEGEFKAGNHCQFC 229

Query: 232 RAKVRCPALSRHVLLEAT---KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NA 287
           +A+  C A +   L  A    +DP   T  E+++  +    ++ + K   D    +  N 
Sbjct: 230 KARFTCRARADKNLELAKLDFQDPPLLTIDEIAEVLAKAEELQKWAKDVSDYALDQAVNH 289

Query: 288 GDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFK-RILKTPKELEQLYKEQKV 344
             +  G++LVEGR   R + D      +L +    E   +K + L     +E+   ++K 
Sbjct: 290 DVKFPGWKLVEGR-SKRVYSDEKEVANVLLAANYAEDIIYKPKELVGITAMEKALGKKK- 347

Query: 345 SDEFWEELQELITRGDGKPVIAPRDIPTNKQ-TQKSQLSEF 384
              F   L  LI +  GKPV+ P      +  +  S  ++F
Sbjct: 348 ---FGILLDGLIIKPAGKPVLVPESDKRPEICSTDSAKADF 385


>gi|331085758|ref|ZP_08334841.1| hypothetical protein HMPREF0987_01144 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406681|gb|EGG86186.1| hypothetical protein HMPREF0987_01144 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 376

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 102/389 (26%), Positives = 168/389 (43%), Gaps = 20/389 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M  HA  S SS HR++ CP A  LE + P   S YA+EGT  H L  H +++ +   +  
Sbjct: 1   MGKHAKYSPSSGHRYMNCPPALLLEEQFPDEESPYAAEGTAGHKLAEHLIKKHLKIRSRR 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                + ++           V   +   +      +   E  ++         GTAD++I
Sbjct: 61  PTSDYYSDELLEAVDGYVQYVIEQIEEAKHICSDPVFSVEQKVDLSFHVKDCFGTADMVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  I+D K G GV V AENNTQLM+Y  G L     +F   E + LTI+QPR+   
Sbjct: 121 VTDKKVHIIDLKLGKGVQVDAENNTQLMIYGLGMLDIAEMLFD-IETIELTIVQPRI--- 176

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
           S  + W ISA++L + A+            K+K A+  +      + CRFC+A+ +C A 
Sbjct: 177 SHFSTWEISAEELHQWAE-------QEFEPKAKMALDGKGEYKAGEWCRFCKARFQCRAR 229

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLN-AGDEIQGYQL 296
           +   L  A  +   P+  +  E+++  S    +K + +               E  G++L
Sbjct: 230 AEEYLCLAQMEFSQPALLSDEEIAEVLSKADALKKWAEEIYTYAQNEAITNRKEWPGFKL 289

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           V GR  NR + D     E   +    + ++  L +  E+E+L  ++K    F E L   +
Sbjct: 290 VLGR-SNRKYTDEEEVAEAAKTAGYTDIYRTSLISITEMEKLMGKKK----FNEILGSYV 344

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
            + DGK  + P           +  ++F 
Sbjct: 345 YKPDGKVTLVPDSDKREAIYISTAEADFS 373


>gi|220930224|ref|YP_002507133.1| hypothetical protein Ccel_2859 [Clostridium cellulolyticum H10]
 gi|220000552|gb|ACL77153.1| conserved hypothetical protein [Clostridium cellulolyticum H10]
          Length = 378

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 105/397 (26%), Positives = 165/397 (41%), Gaps = 38/397 (9%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTS---------IYASEGTFAHNLLAHCLE 51
           M+ HA LSAS SHRWL C  +  LE +   + S                    L  H L+
Sbjct: 1   MSDHAVLSASGSHRWLNCLPSARLELEFENSESNAAAEGTAAH---------ALCEHKLK 51

Query: 52  QGVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPG 111
           + +   +     +   ++           V   L   +      L   E  L+     P 
Sbjct: 52  KALHMRSKRPVSVYNSDEMEEHSDAYVEFVMEQLELAKQSCTDPLILIEQRLDFSCYVPQ 111

Query: 112 ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLT 171
             GT D +I    +  I+DFKYG GV V A +N Q+ LYA GAL  Y  ++   E +++T
Sbjct: 112 GFGTGDCIIIADKKLHIIDFKYGMGVLVDAVDNPQMKLYALGALEIYDSLYD-IEEVSMT 170

Query: 172 IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
           I QPR      ++ W I   +L + A+         L  K+K+A   E   +  + C FC
Sbjct: 171 IFQPRREN---VSTWTIPVKELKDWAEN-------ELRPKAKKAYKGEGDYLPGEWCTFC 220

Query: 232 RAKVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NA 287
           RA V+C A +   L  A  +   P   T  E+ +  S +S +  +             N 
Sbjct: 221 RAAVKCRARAEEKLKLAQMEFKLPPLLTDSEIEEVLSKLSDLTKWANEIIAYATDAAVNH 280

Query: 288 GDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDE 347
           G E  G+++VEGR   R +KD     E   +   ++ +++ L T  E+++L  ++K    
Sbjct: 281 GKEWHGFKVVEGR-SVRKYKDEKAVAEAAKANGYKDIYRQNLITLTEMQKLMGKKK---- 335

Query: 348 FWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           F + L  LI +  GKP + P           +  +EF
Sbjct: 336 FEQILGGLIHKPPGKPTLVPNSDKRPAMNISNVKNEF 372


>gi|153955281|ref|YP_001396046.1| hypothetical protein CKL_2663 [Clostridium kluyveri DSM 555]
 gi|219855704|ref|YP_002472826.1| hypothetical protein CKR_2361 [Clostridium kluyveri NBRC 12016]
 gi|146348139|gb|EDK34675.1| Hypothetical protein CKL_2663 [Clostridium kluyveri DSM 555]
 gi|219569428|dbj|BAH07412.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 378

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 105/397 (26%), Positives = 163/397 (41%), Gaps = 38/397 (9%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTS---------IYASEGTFAHNLLAHCLE 51
           M+ HA LSAS SHRWL C  +  LE +   + S                    L  H L+
Sbjct: 1   MSDHAVLSASGSHRWLNCLPSARLELEFENSESNAAAEGTAAH---------ALCEHKLK 51

Query: 52  QGVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPG 111
           + +   +         ++           V       R      L   E  L+     P 
Sbjct: 52  KALHMRSKRPVSAYNTDEMEEHSDAYVEFVMEQFELARQSCTDPLILIEQRLDFSCYVPQ 111

Query: 112 ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLT 171
             GT D +I    +  I+DFKYG GV V A +N Q+ LYA GAL  Y  ++   E +++T
Sbjct: 112 GFGTGDCIIIGDKKLHIIDFKYGMGVLVDAVDNPQMKLYALGALEIYDSLYD-IEEVSMT 170

Query: 172 IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
           I QPR      ++ W I   +L + A+         L  K+K+A   E   +  + C FC
Sbjct: 171 IFQPRREN---VSTWTIPVKELKDWAEN-------ELKPKAKKAYEGEGDYLPGEWCTFC 220

Query: 232 RAKVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NA 287
           RA V+C A +   L  A  +   P   T  E+ +  S +S +  +             N 
Sbjct: 221 RAAVKCRARAEEKLKLAQMEFKLPPLLTDSEIEEVLSKLSDLTKWANEIIAYATDAAVNH 280

Query: 288 GDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDE 347
           G E  G+++VEGR   R +KD     E   +   ++ +++ L T  E+++L  ++K    
Sbjct: 281 GKEWHGFKVVEGR-SVRKYKDEEAVAEAAKANGYKDIYRQSLITLTEMQKLMGKKK---- 335

Query: 348 FWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           F + L  LI +  GKP + P           +  +EF
Sbjct: 336 FEQILGGLIHKPPGKPTLVPNSDKRPAMNISNVKNEF 372


>gi|300856816|ref|YP_003781800.1| phage-like protein [Clostridium ljungdahlii DSM 13528]
 gi|300436931|gb|ADK16698.1| phage-related protein [Clostridium ljungdahlii DSM 13528]
          Length = 383

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 111/398 (27%), Positives = 172/398 (43%), Gaps = 33/398 (8%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS-- 60
            HA LSASSSHRWL+CP    LE K P  TS YA+EGT AH L    L+  +        
Sbjct: 4   QHAVLSASSSHRWLECPPCVRLEEKFPPKTSEYAAEGTLAHELGEITLKHNLKEMATRTY 63

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPGAT 113
           + +L    D  +   +M   V   +          +  +   + + E  L      P   
Sbjct: 64  NSRLKKIQDNELFTADMPDYVETYVDTCMEKFSEAKAKTKDAIFKIEQKLNFSKWVPEGF 123

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D +        I D KYG GVPV A+ N Q+ LYA GA+ ++  ++   + + +TII
Sbjct: 124 GTGDFVTIADGTMEICDLKYGKGVPVSAKGNPQMRLYALGAIAEFSFLYD-IKKVKMTII 182

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+ +   I+   I  +DLLE A++        L   ++ A   E      + C FCRA
Sbjct: 183 QPRLDS---ISTDEILVNDLLEWAEKV-------LKPTAELAFKGEGEFKAGEHCGFCRA 232

Query: 234 KVRCPALSRHVLLEATKDPS---TNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDE 290
           K  C A +   +  A  +     T    +++        +  + K  +D    +   G+E
Sbjct: 233 KAVCKARADKNMELAKYEFQEPTTLDNDDIAYILGKAEELAKWAKDVQDYALDQALKGEE 292

Query: 291 IQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKR-ILKTPKELEQLYKEQKVSDE 347
             G+++VEGR  NR F D N   + L      +   FK   L     +E+   ++K+   
Sbjct: 293 FTGFKVVEGR-SNRKFTDENMVAKTLYDNGYTDNVIFKPAQLLGISAMEKAIGKKKL--- 348

Query: 348 FWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
             + L+  I +  GKPV+ P           S  ++F+
Sbjct: 349 -NQLLKGFIEKPQGKPVLVPETDKREV--FNSAKADFQ 383


>gi|253581723|ref|ZP_04858947.1| phage protein [Fusobacterium varium ATCC 27725]
 gi|251836072|gb|EES64609.1| phage protein [Fusobacterium varium ATCC 27725]
          Length = 385

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 108/396 (27%), Positives = 185/396 (46%), Gaps = 28/396 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAE---TV 59
            HA LSAS + RW+ C  +  LE + P +TS YA EGT AH L    + + +        
Sbjct: 2   AHAILSASGASRWMACTPSARLEEQFPDSTSEYAKEGTLAHELCELKVRKNLIEPMHTRT 61

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVR----TFSGPFLSETEVPLEPFTTEPGATGT 115
            + KL    +  +   EM       L Y++    +FS       E  ++  +  P   GT
Sbjct: 62  YNSKLKKIKEHELWQDEMDRHTDTYLEYIQGLLHSFSCTPAVMVEKKVDFSSYVPDGFGT 121

Query: 116 ADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
           AD +I       ++DFKYG GV V AENN+Q+ LY  GA  +Y  ++   + + +TI+QP
Sbjct: 122 ADCIIIAEGVLHVIDFKYGKGVAVSAENNSQMKLYGLGAYLEYSFLYA-IDKVKMTIVQP 180

Query: 176 RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV 235
           R+     I+E+ IS  +L+E A+E        +   +++A   E   +  + C+FCRAK 
Sbjct: 181 RLDEV--ISEYEISVTELMEWAEEI-------VKPLAEKAYKGEGTYIAGNHCKFCRAKA 231

Query: 236 RCPALSRHVLLEAT---KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQ 292
            C   +R  L  A    K+P+  +  E+ +A      +  + +  +D        G  I 
Sbjct: 232 TCRERARMNLEVAKFDFKEPALLSDEEVGEALKQAQDLAKWAEDLKDYALAESLKGKLIP 291

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++ VEGR G+R F D   A ++L     +E   ++R   T  ++E++   +    +F E
Sbjct: 292 GWKAVEGR-GSRVFTDNEEALKVLMGSGIDETMLYERKQLTLAQIEKVLGPK----QFKE 346

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQT-QKSQLSEFE 385
            +  ++ +  GKP +          + + + + +F+
Sbjct: 347 LVGNMVEKSPGKPTLVLDTDKREAISNKTTAVEDFK 382


>gi|295114920|emb|CBL35767.1| Protein of unknown function (DUF2800). [butyrate-producing
           bacterium SM4/1]
          Length = 375

 Score =  335 bits (858), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 102/387 (26%), Positives = 163/387 (42%), Gaps = 24/387 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD--AETVS 60
            HA LSASSS RWL CP +  L        S YA+EGT AH+L    L+Q +   A+   
Sbjct: 4   KHAVLSASSSERWLNCPPSARLCEAYEDKGSDYAAEGTDAHSLCEFRLKQALGIPADDPI 63

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                +  +        A+ VS +L   +      +   E  ++         GTAD ++
Sbjct: 64  ENLSWYNEEMEDCAAGYAAYVSELLETAKQTCADPVILIEQRVDFSRWVQDGFGTADCIV 123

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  IVD+K+G GV V A +N Q+MLYA GAL  +  I+   +++ +TI QPR    
Sbjct: 124 IADGELNIVDYKHGKGVEVSAVDNPQMMLYALGALEIFDGIYD-IDSVRMTIYQPRKSN- 181

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             I+  V+  D LLE            L+ K+K A          + CRFC+AK  C   
Sbjct: 182 --ISVCVMEKDGLLEW-------AQNDLTYKAKLAYEGGGDFHCGEWCRFCKAKAECRER 232

Query: 241 SRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLV 297
           +   L  A  D   P   T  E++     +  + ++    ++   ++  +G    G++LV
Sbjct: 233 AEANLALARYDFEEPPLLTDEEIAGILDKVDALTAWAADVKEYALQQAVSGTAFPGWKLV 292

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           EGR  NR +              G   +++ L     +++L  +      F E L   I 
Sbjct: 293 EGR-SNRKYTSEAAVAAA-VEGAGFNPYEKKLLGITAMQKLLGK----SRFEELLAPYIE 346

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +  G+P +        +    +  +EF
Sbjct: 347 KPQGRPTLVRSSDKRPEW--NTAKNEF 371


>gi|220930429|ref|YP_002507338.1| hypothetical protein Ccel_3066 [Clostridium cellulolyticum H10]
 gi|220000757|gb|ACL77358.1| conserved hypothetical protein [Clostridium cellulolyticum H10]
          Length = 411

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 108/409 (26%), Positives = 182/409 (44%), Gaps = 38/409 (9%)

Query: 1   MAH----HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDA 56
           M +    HA LSAS S RWL CP +  LE + P++TS +A EGT+AH+     L   +  
Sbjct: 1   MGNTQRAHAILSASGSKRWLSCPPSAKLEEQFPESTSEFAEEGTYAHSFAELKLRGYITT 60

Query: 57  ETV---SHQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPF 106
           +       +KL            +   +   +  V       +  S       E  L+  
Sbjct: 61  DLKPSVYKKKLAEIKKDPFYSQSLDDYIEQYINIVGEKYLAAKKNSSDSFVMLEQKLDFS 120

Query: 107 TTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPE 166
              P   GT D+++ +     IVD KYG GVPV AE NTQ+ LYA GAL+QYG ++   +
Sbjct: 121 EWVPDGFGTGDVVLISPGILEIVDLKYGQGVPVSAEGNTQMRLYALGALNQYGMLYDF-D 179

Query: 167 ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
            + +TIIQPR+ +   I+E  I+  +LL+  +         +   +  A++ E    + D
Sbjct: 180 KIKMTIIQPRLDS---ISEDEITVQELLDWGESV-------VKPTADMAIAGEGEFKSGD 229

Query: 227 SCRFCRAKVRCPALSRHVLLEATK---DPSTNTTVELSKAYSSISLIKSYVKACEDEMFK 283
            C+FCRAK  C   +   L  A     DP+  +  E++   +  + ++ +    +     
Sbjct: 230 HCQFCRAKAVCRKRAEDNLEMARYEFEDPNILSNDEIADILAKAAELQKWASDVQAYALD 289

Query: 284 RL-NAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFK-RILKTPKELEQLY 339
           +  N G +  G++LVEGR  NR + D +     L       +  ++ + +    E+E+  
Sbjct: 290 QAENHGVKFTGWKLVEGR-SNRKYTDEDAVATKLKDEGYASDVIYQPQKIWGISEMEKKI 348

Query: 340 KEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQ-TQKSQLSEFEVL 387
            +      F + L E + +  GK  + P      +  +  S + +F+ L
Sbjct: 349 GK----RLFADYLTEFVVKPAGKATLVPESDKRPEISSVASAVRDFDDL 393


>gi|291283826|ref|YP_003500644.1| Bbp38 [Escherichia coli O55:H7 str. CB9615]
 gi|290763699|gb|ADD57660.1| Bbp38 [Escherichia coli O55:H7 str. CB9615]
          Length = 433

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 128/426 (30%), Positives = 192/426 (45%), Gaps = 49/426 (11%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET----- 58
           HA LS SS+HRW++CP +  LE+  P   + +A EGT AH L    L             
Sbjct: 5   HAQLSPSSAHRWMRCPGSLALEATQPDKETTFAIEGTAAHALAEKVLRNRQSHPEHYAGC 64

Query: 59  --------VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTT 108
                      ++   +     VD EM  +V   +  V T +     L E  V     T 
Sbjct: 65  NVSMFLGSYPLRENPDDTSGPQVDDEMVEAVGRYVDTVWTLAQNNELLVEQRVDFSHITG 124

Query: 109 EPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              + GTAD +I    +  I D KYG GV + AE N QL LYA GAL Q+  ++   E +
Sbjct: 125 VEESFGTADGIIIAGNELQIHDLKYGKGVRIDAEQNEQLQLYALGALEQFSMLYDF-ETV 183

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLAL------SLKSKRAVSLEHYG 222
            L I QPR+     ++EW ++  +L    K  +E  T A+        +    + LE++ 
Sbjct: 184 RLFIHQPRLN---HVSEWSLTVQELQSFGKRAQEAATSAILVLNIAECEGIETLPLENFI 240

Query: 223 VNDDSCRFCRAKVRCPALSRHVLLEATKDP------------------STNTTVELSKAY 264
             +  CRFC+AK  C A     L  A  D                      T  +L++ Y
Sbjct: 241 PGEKQCRFCKAKAICTAQKMQHLQTAASDFEDLTKPVSEIITNASARVPLLTIEQLAEIY 300

Query: 265 SSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTS---VLG 321
           S    I+S++KA  D +   LNAG  + G++LV G++GNR++ D   A+ LL        
Sbjct: 301 SQADFIESWLKAVRDRVHNELNAGHPVPGFKLVTGKQGNRAWSDEEAARALLKDQFRYKT 360

Query: 322 EEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQL 381
           EE F   L +P + E+L   +K S   W +++ LITR DGKP + P   P       + +
Sbjct: 361 EEVFDFKLISPTKAEKLI--KKASPRRWSKVEALITRADGKPTVVPESDPRPALNI-NPV 417

Query: 382 SEFEVL 387
           ++F+ +
Sbjct: 418 NDFDDV 423


>gi|302873660|ref|YP_003842293.1| hypothetical protein Clocel_0759 [Clostridium cellulovorans 743B]
 gi|307686616|ref|ZP_07629062.1| hypothetical protein Ccel74_00591 [Clostridium cellulovorans 743B]
 gi|302576517|gb|ADL50529.1| Protein of unknown function DUF2800 [Clostridium cellulovorans
           743B]
          Length = 388

 Score =  334 bits (856), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 106/401 (26%), Positives = 169/401 (42%), Gaps = 32/401 (7%)

Query: 1   MAH--HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET 58
           M+   HA LSAS S RWL C  +  LE +  + TSI+A  GT AH +    L   +   T
Sbjct: 1   MSGKAHATLSASGSKRWLACTPSAQLELQFKEETSIHAETGTLAHEIGELMLAMHLKLIT 60

Query: 59  VSHQKLTFEN--DTRIVDTEMASSVSMVLAY-------VRTFSGPFLSETEVPLEPFTTE 109
                   +      +   EM   V + + Y           +   +   E  L+     
Sbjct: 61  KQAYSKELKRLKKNSLYSKEMDDYVQVYVDYAIEKINEAYARAKDSIILLEQMLDFSNYV 120

Query: 110 PGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALT 169
           P   GT D++I +     +VD KYG GV V A+ N+Q+ LYA GAL+ +  +F   + + 
Sbjct: 121 PDGFGTGDLVIISEDVLDVVDLKYGMGVAVSAKENSQMKLYALGALNLFDSLFD-IKRIR 179

Query: 170 LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
           +TI QPR+     I+ + I+ DDL+  A+         L  K++ A + E   +  + C 
Sbjct: 180 MTICQPRLD---SISTYEIAIDDLISWAET-------ELKPKAQLATNGEGDYLPGEHCG 229

Query: 230 FCRAKVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RL 285
           FCRA+  C A +   L     D   P   +  E+++  S    I S+V           +
Sbjct: 230 FCRARKTCRARADQRLAMTKYDFKLPPLLSDEEIAEVLSVAEGISSWVNDVYAYATNLSI 289

Query: 286 NAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVS 345
           N G    G++LVEGR  NR +       ++       E + + L     +E+L  +    
Sbjct: 290 NEGKRWSGFKLVEGR-SNRKYISEEAVIKVCNDNGITEIYTKSLLGITAMEKLLGK---- 344

Query: 346 DEFWEELQELITRGDGKPVIAPRDIPTNKQTQKS-QLSEFE 385
           D F   L +L+ +  GKP + P           +   ++F 
Sbjct: 345 DSFNSILGDLVEKPKGKPTLVPFSDKRKAIEINNMAEADFR 385


>gi|331648296|ref|ZP_08349385.1| putative protein p51 [Escherichia coli M605]
 gi|331042845|gb|EGI14986.1| putative protein p51 [Escherichia coli M605]
          Length = 433

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 127/426 (29%), Positives = 191/426 (44%), Gaps = 49/426 (11%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET----- 58
           HA LS SS+HRW++CP +  LE+  P   + +A EGT AH L    L             
Sbjct: 5   HAQLSPSSAHRWMRCPGSLALEATQPDKETTFAIEGTAAHALAEKVLRNRQSHPEHYAGC 64

Query: 59  --------VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTT 108
                      ++   +     VD EM  +V   +  V T +     L E  V     T 
Sbjct: 65  NVSMFLGSYPLRENPDDTSGPQVDDEMVEAVGRYVDTVWTLAQNNELLVEQRVDFSHITG 124

Query: 109 EPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              + GTAD +I    +  I D KYG GV + AE N QL LYA GAL Q+  ++   E +
Sbjct: 125 VEESFGTADGIIIAGNELQIHDLKYGKGVRIDAEQNEQLQLYALGALEQFSMLYDF-ETV 183

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLAL------SLKSKRAVSLEHYG 222
            L I QPR+     ++EW ++  +L    +   E  T A+        +    + LE++ 
Sbjct: 184 RLFIHQPRLN---HVSEWSLTVQELQSFGERALEAATSAILVLNIAECEGIETLPLENFI 240

Query: 223 VNDDSCRFCRAKVRCPALSRHVLLEATKDP------------------STNTTVELSKAY 264
             +  CRFC+AK  C A     L  A  D                      T  +L++ Y
Sbjct: 241 PGEKQCRFCKAKAICTAHKMQHLQTAASDFEDLTKPVSEIITNASARVPLLTIEQLAEIY 300

Query: 265 SSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTS---VLG 321
           S    I+S++KA  D +   LNAG  + G++LV G++GNR++ D   A+ LL        
Sbjct: 301 SQADFIESWLKAVRDRVHNELNAGHPVPGFKLVTGKQGNRAWSDEEAARALLKDQFRYKT 360

Query: 322 EEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQL 381
           EE F   L +P + E+L   +K S   W +++ LITR DGKP + P   P       + +
Sbjct: 361 EEVFDFKLISPTKAEKLI--KKASPRRWSKVEALITRADGKPTVVPESDPRPALNI-NPV 417

Query: 382 SEFEVL 387
           ++F+ +
Sbjct: 418 NDFDDV 423


>gi|218555131|ref|YP_002388044.1| hypothetical protein ECIAI1_2661 [Escherichia coli IAI1]
 gi|218361899|emb|CAQ99499.1| conserved hypothetical protein from bacteriophage origin
           [Escherichia coli IAI1]
          Length = 433

 Score =  333 bits (854), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 128/426 (30%), Positives = 194/426 (45%), Gaps = 49/426 (11%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET----- 58
           HA LS SS+HRW++CP +  LE+  P   + +A EGT AH L    L             
Sbjct: 5   HAQLSPSSAHRWMRCPGSLALEATQPDKETTFAIEGTAAHALAEKVLRNRQSHPEHYAGC 64

Query: 59  --------VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTT 108
                      ++   +     VD EM  +V   +  V T +     L E  V     T 
Sbjct: 65  NVSMFLGSYPLRENPDDTSGPQVDDEMVEAVGRYVDTVWTLAQNNELLVEQRVDFSHITG 124

Query: 109 EPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              + GTAD +I   ++  I D KYG GV + AE N QL LYA GAL Q+  ++   E +
Sbjct: 125 VEESFGTADGIIIAGSELQIHDLKYGKGVRIDAEQNEQLQLYALGALEQFSMLYDF-ETV 183

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLAL------SLKSKRAVSLEHYG 222
            L I QPR+     ++EW ++ ++L    +  +E  T A+        +    + LE++ 
Sbjct: 184 RLFIHQPRLN---HVSEWALTVEELQAFGERAQEAATSAILVLNIAECEGIETLPLENFI 240

Query: 223 VNDDSCRFCRAKVRCPALSRHVLLEATKDP------------------STNTTVELSKAY 264
             +  CRFC+AK  C A     L  A  D                      T  +L++ Y
Sbjct: 241 PGEKQCRFCKAKAICTAQKMQHLQTAASDFEDLTKPVSEIITNASARVPLLTIEQLAEIY 300

Query: 265 SSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTS---VLG 321
           S    I+S++KA  D +   LNAG  + G++LV G++GNR++ D   A+ LL        
Sbjct: 301 SQADFIESWLKAVRDRVHNELNAGHPVPGFKLVTGKQGNRAWSDEEAARALLKDQFRYKT 360

Query: 322 EEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQL 381
           EE F   L +P + E+L   +K S   W +++ LITR DGKP I P   P       + +
Sbjct: 361 EEVFDFKLISPTKAEKLI--KKASPRRWSKVEALITRADGKPTIVPESDPRPALNI-NPV 417

Query: 382 SEFEVL 387
           ++F+ +
Sbjct: 418 NDFDDV 423


>gi|309702937|emb|CBJ02268.1| putative phage protein [Escherichia coli ETEC H10407]
          Length = 433

 Score =  333 bits (853), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 128/426 (30%), Positives = 192/426 (45%), Gaps = 49/426 (11%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET----- 58
           HA LS SS+HRW++CP +  LE+  P   + +A EGT AH L    L             
Sbjct: 5   HAQLSPSSAHRWMRCPGSLALEATQPDKETTFAIEGTAAHALAEKVLRNRQSYPEHYAGC 64

Query: 59  --------VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTT 108
                      ++   +     VD EM  +V   +  V T +     L E  V     T 
Sbjct: 65  NVSMFLGSYPLRENPNDTSGPQVDDEMVEAVGRYVDTVWTLAQNNELLVEQRVDFSHITG 124

Query: 109 EPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              + GTAD +I   ++  I D KYG GV + AE N QL LYA GAL Q+  ++   E +
Sbjct: 125 VEESFGTADGIIIAGSELQIHDLKYGKGVRIDAEQNEQLQLYALGALEQFSMLYDF-ETV 183

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLAL------SLKSKRAVSLEHYG 222
            L I QPR+     ++EW ++  +L    +   E  T A+        +    + LE++ 
Sbjct: 184 RLFIHQPRLN---HVSEWSLTVQELQSFGERALEAATSAILVLNIAECEGIETLPLENFI 240

Query: 223 VNDDSCRFCRAKVRCPALSRHVLLEATKDP------------------STNTTVELSKAY 264
             +  CRFC+AK  C A     L  A  D                      T  +L++ Y
Sbjct: 241 PGEKQCRFCKAKAICTAQKMQHLQTAASDFEDLTKPVSEIISNASARVPLLTIEQLAEIY 300

Query: 265 SSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTS---VLG 321
           S    I+S++KA  D +   LNAG  + G++LV G++GNR++ D   A+ LL        
Sbjct: 301 SQADFIESWLKAVRDRVHNELNAGHPVPGFKLVTGKQGNRAWSDEEAARALLKDQFRYKT 360

Query: 322 EEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQL 381
           EE F   L +P + E+L   +K S   W +++ LITR DGKP I P   P       + +
Sbjct: 361 EEVFDFKLISPTKAEKLI--KKASPRRWSKVEALITRADGKPTIVPESDPRPALNI-NPV 417

Query: 382 SEFEVL 387
           ++F+ +
Sbjct: 418 NDFDDV 423


>gi|160937657|ref|ZP_02085017.1| hypothetical protein CLOBOL_02547 [Clostridium bolteae ATCC
           BAA-613]
 gi|158439302|gb|EDP17054.1| hypothetical protein CLOBOL_02547 [Clostridium bolteae ATCC
           BAA-613]
          Length = 391

 Score =  333 bits (853), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 105/398 (26%), Positives = 170/398 (42%), Gaps = 32/398 (8%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLE--QGVDAETVSH 61
           HA LSASS+ RW+ CP +  LE + P + S YA+EGT AH+L    L       ++    
Sbjct: 5   HARLSASSAKRWMSCPPSVRLEEQFPDSGSEYAAEGTLAHSLAETILRYNNSEISKKAFS 64

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPF-------LSETEVPLEPFTTEPGATG 114
            +        + + EM   +      V   +              E  L+     P   G
Sbjct: 65  TRFNKIKADPMYNREMQDYIEDYTQRVWEIANEVKAACPDARVLFEQRLDVSEYVPDGFG 124

Query: 115 TADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQ 174
           T D++I       I+D KYG GV V A++N QL LY  GA  ++  ++     + +TIIQ
Sbjct: 125 TGDVVIVADDMVNIIDLKYGKGVGVSAKDNPQLRLYGLGAYLEHSMLYD-IRRIQMTIIQ 183

Query: 175 PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
           PR+          IS ++L   A+E  +     +  K+ +A + E      D CRFC+A+
Sbjct: 184 PRLEN--------ISVEEL--TAEELLDWAEREVRPKAAQAYAGEGEFKVGDHCRFCKAR 233

Query: 235 VRCPALSRHVLLEATK---DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEI 291
           V C   + + L        DP+  T  E+ +       +  +VK            G + 
Sbjct: 234 VTCRVRAEYNLELTKLDFVDPALLTDEEIGEVLRRADELDHWVKDVTGFALAEALKGTKY 293

Query: 292 QGYQLVEGRKGNRSFKDINRAQELLTSVL--GEEAFK-RILKTPKELEQLYKEQKVSDEF 348
           +G++LVEG    R + D +     LT+     +E +K + L    E+ +L  ++K    F
Sbjct: 294 EGWKLVEG-TSRRRYTDQDAIAMRLTTEGWEEDEIYKPQELIGITEMTKLIGKKK----F 348

Query: 349 WEELQELITRGDGKPVIAPRDIPTNKQT-QKSQLSEFE 385
            E L  L+ + +GKP +AP      +         +F+
Sbjct: 349 EELLSGLVIKPEGKPTLAPESDKRPELNRVAEAKQDFD 386


>gi|331654011|ref|ZP_08355012.1| putative protein p51 [Escherichia coli M718]
 gi|331048860|gb|EGI20936.1| putative protein p51 [Escherichia coli M718]
          Length = 433

 Score =  333 bits (853), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 128/426 (30%), Positives = 192/426 (45%), Gaps = 49/426 (11%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET----- 58
           HA LS SS+HRW++CP +  LE+  P   + +A EGT AH L    L             
Sbjct: 5   HAQLSPSSAHRWMRCPGSLALEATQPDKETTFAIEGTAAHALAEKVLRNRQSYPEHYAGC 64

Query: 59  --------VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTT 108
                      ++   +     VD EM  +V   +  V T +     L E  V     T 
Sbjct: 65  NVSMFLGSYPLRENPDDTSGPQVDDEMVEAVGRYVDTVWTLAQNNELLVEQRVDFSHITG 124

Query: 109 EPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              + GTAD +I   ++  I D KYG GV + AE N QL LYA GAL Q+  ++   E +
Sbjct: 125 VEESFGTADGIIIAGSELQIHDLKYGKGVRIDAEQNEQLQLYALGALEQFSMLYDF-ETV 183

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLAL------SLKSKRAVSLEHYG 222
            L I QPR+     ++EW ++  +L    +   E  T A+        +    + LE++ 
Sbjct: 184 RLFIHQPRLN---HVSEWSLTVQELQSFGERALEAATSAILVLNIAECEGIETLPLENFI 240

Query: 223 VNDDSCRFCRAKVRCPALSRHVLLEATKDP------------------STNTTVELSKAY 264
             +  CRFC+AK  C A     L  A  D                      T  +L++ Y
Sbjct: 241 PGEKQCRFCKAKAICTAQKMQHLQTAASDFEDLTKPVSEIISNASARVPLLTIEQLAEIY 300

Query: 265 SSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTS---VLG 321
           S    I+S++KA  D +   LNAG  + G++LV G++GNR++ D   A+ LL        
Sbjct: 301 SQADFIESWLKAVRDRVHNELNAGHPVPGFKLVTGKQGNRAWSDEEAARALLKDQFRYKT 360

Query: 322 EEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQL 381
           EE F   L +P + E+L   +K S   W +++ LITR DGKP I P   P       + +
Sbjct: 361 EEVFDFKLISPTKAEKLI--KKASPRRWSKVEALITRADGKPTIVPESDPRPALNI-NPV 417

Query: 382 SEFEVL 387
           ++F+ +
Sbjct: 418 NDFDDV 423


>gi|194429254|ref|ZP_03061781.1| Bbp38 [Escherichia coli B171]
 gi|194412662|gb|EDX28957.1| Bbp38 [Escherichia coli B171]
 gi|323159203|gb|EFZ45193.1| bbp38 [Escherichia coli E128010]
          Length = 433

 Score =  332 bits (851), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 127/426 (29%), Positives = 192/426 (45%), Gaps = 49/426 (11%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET----- 58
           HA LS SS+HRW++CP +  LE+  P   + +A EGT AH L    L             
Sbjct: 5   HAQLSPSSAHRWMRCPGSLALEATQPDKETTFAIEGTAAHALAEKVLRNRQSHPEHYAGC 64

Query: 59  --------VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTT 108
                      ++   +     VD EM  +V   +  V T +     L E  V     T 
Sbjct: 65  NVSMFLGSYPLRENPDDTSGPQVDDEMVEAVGRYVDTVWTLAQNNELLVEQRVDFSHITG 124

Query: 109 EPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              + GTAD +I    +  I D KYG GV + AE N QL LYA GAL Q+  ++   E +
Sbjct: 125 VEESFGTADGIIIAGNELQIHDLKYGKGVRIDAEQNEQLQLYALGALEQFSMLYDF-ETV 183

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLAL------SLKSKRAVSLEHYG 222
            L I QPR+     ++EW ++  +L    +  +E  T A+        +    + LE++ 
Sbjct: 184 RLFIHQPRLN---HVSEWSLTVQELQSFGERAQEAATSAILVLNIAECEGIETLPLENFI 240

Query: 223 VNDDSCRFCRAKVRCPALSRHVLLEATKDP------------------STNTTVELSKAY 264
             +  CRFC+AK  C A     L  A  D                      T  +L++ Y
Sbjct: 241 PGEKQCRFCKAKAICTAQKMQHLQTAASDFEDLTKPVSEIITNASARVPLLTIEQLAEIY 300

Query: 265 SSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTS---VLG 321
           S    I+S++KA  D +   LNAG  + G++LV G++GNR++ D   A+ LL        
Sbjct: 301 SQADFIESWLKAVRDRVHNELNAGHPVPGFKLVTGKQGNRAWSDEEAARALLKDQFRYKT 360

Query: 322 EEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQL 381
           EE F   L +P + E+L   +K S   W +++ LITR DGKP + P   P       + +
Sbjct: 361 EEVFDFKLISPTKAEKLI--KKASPRRWSKVEALITRADGKPTVIPESDPRPALNI-NPV 417

Query: 382 SEFEVL 387
           ++F+ +
Sbjct: 418 NDFDDV 423


>gi|260845236|ref|YP_003223014.1| hypothetical protein ECO103_3129 [Escherichia coli O103:H2 str.
           12009]
 gi|257760383|dbj|BAI31880.1| hypothetical protein ECO103_3129 [Escherichia coli O103:H2 str.
           12009]
          Length = 433

 Score =  332 bits (851), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 128/426 (30%), Positives = 192/426 (45%), Gaps = 49/426 (11%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET----- 58
           HA LS SS+HRW++CP +  LE+  P   + +A EGT AH L    L             
Sbjct: 5   HAQLSPSSAHRWMRCPRSLALEATQPDKETTFAIEGTAAHALAEKVLRNRQSYPEHYAGC 64

Query: 59  --------VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTT 108
                      ++   +     VD EM  +V   +  V T +     L E  V     T 
Sbjct: 65  NVSMFLGSYPLRENPDDTSGPQVDDEMVEAVGRYVDTVWTLAQNNELLVEQRVDFSHITG 124

Query: 109 EPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              + GTAD +I   ++  I D KYG GV + AE N QL LYA GAL Q+  ++   E +
Sbjct: 125 VEESFGTADGIIIAGSELQIHDLKYGKGVRIDAEQNEQLQLYALGALEQFSMLYDF-ETV 183

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLAL------SLKSKRAVSLEHYG 222
            L I QPR+     ++EW ++  +L    +   E  T A+        +    + LE++ 
Sbjct: 184 RLFIHQPRLN---HVSEWSLTVQELQSFGERALEAATSAILVLNIAECEGIETLPLENFI 240

Query: 223 VNDDSCRFCRAKVRCPALSRHVLLEATKDP------------------STNTTVELSKAY 264
             +  CRFC+AK  C A     L  A  D                      T  +L++ Y
Sbjct: 241 PGEKQCRFCKAKAICTAQKMQHLQTAASDFEDLTKPVSEIISNASARVPLLTIEQLAEIY 300

Query: 265 SSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTS---VLG 321
           S    I+S++KA  D +   LNAG  + G++LV G++GNR++ D   A+ LL        
Sbjct: 301 SQADFIESWLKAVRDRVHNELNAGHPVPGFKLVTGKQGNRAWSDEEAARALLKDQFRYKT 360

Query: 322 EEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQL 381
           EE F   L +P + E+L   +K S   W +++ LITR DGKP I P   P       + +
Sbjct: 361 EEVFDFKLISPTKAEKLI--KKASPRRWSKVEALITRADGKPTIVPESDPRPALNI-NPV 417

Query: 382 SEFEVL 387
           ++F+ +
Sbjct: 418 NDFDDV 423


>gi|297587103|ref|ZP_06945748.1| phage protein [Finegoldia magna ATCC 53516]
 gi|297575084|gb|EFH93803.1| phage protein [Finegoldia magna ATCC 53516]
          Length = 374

 Score =  332 bits (850), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 101/389 (25%), Positives = 173/389 (44%), Gaps = 27/389 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQ--GVDAET 58
           M  HA LSASSS+RW+ CP +  L  K     S YA EGT AH L  + L++  G+D + 
Sbjct: 1   MGAHAILSASSSNRWIHCPPSVRLSEKYEDEVSPYALEGTSAHALAEYKLKKLLGLDTKD 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     ++ +   +    AS V+ V++   +         E  L+       + GTAD 
Sbjct: 61  PTEDLDFYDEEMDELTEGYASYVTEVISRYES----PAVFVEERLDLSDYVKESFGTADC 116

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           ++    +  ++D KYG GV V A  NTQLMLY  GAL  +  I+   E + L I QPR  
Sbjct: 117 VVVGGKELHVIDLKYGQGVLVDARENTQLMLYGLGALILFDGIYD-IENVILHIYQPRRC 175

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               I+ + I   +L E  +  +E         +++A   E      + C FC+AK +C 
Sbjct: 176 N---ISTYEIKKTELYEWGESVRE--------IAEKAYKGEGEFSCGEWCIFCKAKNKCR 224

Query: 239 ALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L  A ++   P   +  E+ +    +  ++ +VK  +    +R   G   +  +
Sbjct: 225 KRAEENLKLAQEEFILPPELSDDEIEEILPRLDELEQWVKDIKAYALERAMKGHRWKDLK 284

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           LVEGR  NR ++D +   + +  +     F+  L     + +L  ++     F E + +L
Sbjct: 285 LVEGR-SNRKYRDEDEVVKKVKELGF-NPFEEKLLGITAMTKLLGKKV----FDENISDL 338

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           + +  GK  +   +    +   ++   EF
Sbjct: 339 LEKPKGKLTLVNINDKREEVVIENVKEEF 367


>gi|191174017|ref|ZP_03035534.1| Bbp38 [Escherichia coli F11]
 gi|190905708|gb|EDV65330.1| Bbp38 [Escherichia coli F11]
          Length = 433

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 126/426 (29%), Positives = 192/426 (45%), Gaps = 49/426 (11%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET----- 58
           HA LS SS+HRW++CP +  LE+  P   + +A EGT AH L    L             
Sbjct: 5   HAQLSPSSAHRWMRCPGSLALEATQPDKETTFAIEGTAAHALAEKVLRNRQSHPEHYAGC 64

Query: 59  --------VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTT 108
                       +   +     VD EM  +V   +  V   +     L E  V     T 
Sbjct: 65  NVAMFLGSYPLAEHPDDTSGPQVDEEMVEAVGRYVDTVWALAQGNELLVEQRVDFSHITG 124

Query: 109 EPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              + GTAD +I   ++  I D KYG GV + AE N QL LYA GAL Q+  ++   E +
Sbjct: 125 VEESFGTADSIIIAGSELQIHDLKYGKGVRIDAEQNEQLQLYALGALEQFSMLYDF-ETV 183

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLAL------SLKSKRAVSLEHYG 222
            L I QPR+     ++EW ++ ++L    +  +E  T A+        +    + LE++ 
Sbjct: 184 RLFIHQPRLN---HVSEWALTVEELQAFGERAQEAATSAILVLNIAECEGIETLPLENFI 240

Query: 223 VNDDSCRFCRAKVRCPALSRHVLLEATKDP------------------STNTTVELSKAY 264
             +  CRFC+AK  C A     L  A  D                      T  +L++ Y
Sbjct: 241 PGEKQCRFCKAKAICTAQKMQHLQTAASDFEDLTKPVSEIITNASARVPLLTIEQLAEIY 300

Query: 265 SSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTS---VLG 321
           S    I+S++KA  D +   LNAG  + G++LV G++GNR++ D   A+ LL        
Sbjct: 301 SQTDFIESWLKAVRDRVHNELNAGHPVPGFKLVTGKQGNRAWSDEEAARALLKDQFRYKT 360

Query: 322 EEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQL 381
           EE F   L +P + E+L   +K S   W +++ LITR DGKP + P   P       + +
Sbjct: 361 EEVFDFKLISPTKAEKLI--KKASPRRWSKVEALITRADGKPTVVPESDPRPALNI-NPV 417

Query: 382 SEFEVL 387
           ++F+ +
Sbjct: 418 NDFDDV 423


>gi|258646419|ref|ZP_05733888.1| phage protein [Dialister invisus DSM 15470]
 gi|260403822|gb|EEW97369.1| phage protein [Dialister invisus DSM 15470]
          Length = 389

 Score =  330 bits (847), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 106/403 (26%), Positives = 174/403 (43%), Gaps = 31/403 (7%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDA---E 57
           M  HA LSAS +H+WL C  +  LE++ P TTS +A EGT AH++    L +        
Sbjct: 1   MTQHALLSASGAHKWLVCTASARLEAEFPDTTSEFAREGTLAHSIAELKLRRYAIEPMSP 60

Query: 58  TVSHQKLTFENDTRIVDTEMASSVSMVLAYVR----TFSGPFLSETEVPLEPFTTEPGAT 113
               +++       +   EM       L  ++     +        E  ++     P   
Sbjct: 61  ATFTRRMNKLKKDPLYQKEMDGYTEEYLDCIKQIMLAYGTKPYIAAEKKVDFSQFVPKGF 120

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GTAD LI       +VDFKYG GVPV A++N QL LYA GAL +YG ++ + + + + I+
Sbjct: 121 GTADCLIMTPDALHVVDFKYGKGVPVDAKDNPQLKLYALGALSEYGLLY-QFKTIHIHIV 179

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR++              L E            +  K+K A          + CRFCRA
Sbjct: 180 QPRLKILG---TDTFLRAALTEWGNSV-------VKPKAKEAFEGPGEFHPGEHCRFCRA 229

Query: 234 KVRCPALSRHVLLEAT-----KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG 288
           + +C A S +    A       +P+  T  +L +       +K + +  +        +G
Sbjct: 230 RAQCKARSEYYAALAETAKENANPALITMADLGEYLKKAGALKKWAEDLQAYALSSCLSG 289

Query: 289 DEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSD 346
             + G++ VEGR G+R F   + A ++LT    +E   + R+  T  + E++  ++    
Sbjct: 290 KTVPGWKAVEGR-GSRVFTSTDEAFKVLTDNGIDESLLYSRVPATLAQTEKIVGKKV--- 345

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNKQT-QKSQLSEFEVLG 388
            F   L + + +  GKP +AP        +   S    F+ +G
Sbjct: 346 -FETLLSKYVIKNPGKPTLAPESDKREAISNVVSAKDIFKPVG 387


>gi|255092528|ref|ZP_05322006.1| hypothetical protein CdifC_07687 [Clostridium difficile CIP 107932]
 gi|260683189|ref|YP_003214474.1| hypothetical protein CD196_1446 [Clostridium difficile CD196]
 gi|260209352|emb|CBA62779.1| putative uncharacterized protein [Clostridium difficile CD196]
          Length = 388

 Score =  330 bits (845), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 107/402 (26%), Positives = 171/402 (42%), Gaps = 35/402 (8%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD--AETVS 60
            HA LSAS +HRWL C  +  LE   P +TSIYA EGT AH L    L    +  +E   
Sbjct: 4   QHARLSASGAHRWLHCTPSIKLEENYPPSTSIYAEEGTVAHELAEVKLMLEYEKISEKAY 63

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPGAT 113
           + ++     +   ++EM   +   +  V       +      +   E  L+     P   
Sbjct: 64  NARIKKIQKSEYYNSEMEDYIQSYVENVVELVNDSKAICDDVIVMLEERLDFSEWVPEGF 123

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D+++ +     ++D KYG G+ V A  N QL LY  GA +Q+  ++   + +  TII
Sbjct: 124 GTGDVVVISDGILQVIDLKYGKGLEVSAIENPQLRLYGLGAYNQFEMLYD-IDLIKTTII 182

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+     I+   I    LL  A   K++           A + E   V+   C FCRA
Sbjct: 183 QPRLDN---ISSEEIEVTKLLTWADNVKKKAQ--------MAFNGEGEFVSGSHCGFCRA 231

Query: 234 KVRCPALSRHVLLEATK----DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAG 288
           K  C   +   L  A K    D       E++        I+ ++K  +    ++    G
Sbjct: 232 KNDCRKRAGDNLKLARKYDFADTFALNKYEIADILGFAKNIQDWLKDVQSYALEQAEKHG 291

Query: 289 DEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFK-RILKTPKELEQLYKEQKVS 345
            +  GY+LVEGR  NR + D     ++L +   +E   +K R LK   ++E+   ++   
Sbjct: 292 VKYPGYKLVEGR-SNRKYVDEQEVAKVLLNSDYDEEKIYKPRTLKGISDMEKAIGKK--- 347

Query: 346 DEFWEELQELITRGDGKPVIAPRDIPT-NKQTQKSQLSEFEV 386
             F + L +LI +  GK  +           +  S   +FE+
Sbjct: 348 -SFAKLLSDLIIKPVGKATLVVESDKRSEINSIDSAKKDFEI 388


>gi|255306555|ref|ZP_05350726.1| hypothetical protein CdifA_08182 [Clostridium difficile ATCC 43255]
          Length = 388

 Score =  329 bits (844), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 106/402 (26%), Positives = 171/402 (42%), Gaps = 35/402 (8%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD--AETVS 60
            HA LSAS +HRWL C  +  LE   P +TSIYA EGT AH L    L    +  ++   
Sbjct: 4   QHARLSASGAHRWLHCTPSIKLEENYPPSTSIYAEEGTVAHELAEVKLMLEYEKISKKAY 63

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPGAT 113
           + ++     +   ++EM   +   +  V       +      +   E  L+     P   
Sbjct: 64  NARIKKIQKSEYYNSEMEDYIQSYVENVVELVNDSKAICDDVIVMLEERLDFSEWVPEGF 123

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D+++ +     ++D KYG G+ V A  N QL LY  GA +Q+  ++   + +  TII
Sbjct: 124 GTGDVVVISDGILQVIDLKYGKGLEVSAIENPQLRLYGLGAYNQFEMLYD-IDLIKTTII 182

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+     I+   I    LL  A   K++           A + E   V+   C FCRA
Sbjct: 183 QPRLDN---ISSEEIEVTKLLTWADNVKKKAQ--------MAFNGEGEFVSGSHCGFCRA 231

Query: 234 KVRCPALSRHVLLEATK----DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAG 288
           K  C   +   L  A K    D       E++        I+ ++K  +    ++    G
Sbjct: 232 KNDCRKRAEDNLKLARKYDFADTFALNKYEIADILGFAKNIQDWLKDVQSYALEQAEKHG 291

Query: 289 DEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFK-RILKTPKELEQLYKEQKVS 345
            +  GY+LVEGR  NR + D     ++L +   +E   +K R LK   ++E+   ++   
Sbjct: 292 VKYPGYKLVEGR-SNRKYIDEQEVAKVLLNSDYDEEKIYKPRTLKGISDMEKAIGKK--- 347

Query: 346 DEFWEELQELITRGDGKPVIAPRDIPT-NKQTQKSQLSEFEV 386
             F + L +LI +  GK  +           +  S   +FE+
Sbjct: 348 -SFAKLLSDLIIKPVGKATLVVESDKRSEINSIDSAKKDFEI 388


>gi|205375252|ref|ZP_03228042.1| hypothetical protein Bcoam_19809 [Bacillus coahuilensis m4-4]
          Length = 384

 Score =  329 bits (844), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 108/397 (27%), Positives = 180/397 (45%), Gaps = 30/397 (7%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQ--GVDAET 58
           M  HA LSAS +HRW+ C ++P LE  + + TS+YA EG+ AH L    + +  G+ +  
Sbjct: 1   MLQHALLSASGAHRWMVCTMSPRLEESMEEETSVYAQEGSLAHELAELKVAKEVGLISRQ 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPG 111
              +KL       +   EM  + ++   +        +  +   +   E  L+     P 
Sbjct: 61  KYTRKLKQIRSDPLYTEEMDKATNLHKDFCIERFNEAKAVTKDAVIMLEQRLDYSPWVPE 120

Query: 112 ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLT 171
             GT+D  I +     I+D KYG G+ V A  NTQ+ LYA GA++Q+G ++   E + +T
Sbjct: 121 GFGTSDATIISQKTLEIIDLKYGKGIAVSAYENTQMKLYALGAINQFGFLYDDLETIHMT 180

Query: 172 IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
           I QPR+ +   I+ + +S +DLLE A          +  K++ A   E   +  D CRFC
Sbjct: 181 ISQPRLDS---ISSFEMSVNDLLEWADTV-------VKPKAELAFRGEGDFIAGDHCRFC 230

Query: 232 RAKVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMF-KRLNA 287
           + K  C A +   L  A  D   P   +  E+ +  ++I  + S+ K  ++    K ++ 
Sbjct: 231 KVKSTCRARAEENLKLACMDFQKPPLLSDEEVVEVLNTIDQLVSWAKDVQEFALTKAISE 290

Query: 288 GDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVS 345
                  +LV GR G+R + D     + LT    +    +K+ L T   LE+   ++   
Sbjct: 291 NKLWPRMKLVXGR-GSRKYADEEAVLQALTDAGYDHDLIYKKTLNTITTLEKELGKKT-- 347

Query: 346 DEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLS 382
             F E L  L+T+  GK  + P      +      + 
Sbjct: 348 --FNELLGPLVTKAPGKIKLVPEQDKRPEIKASPAVD 382


>gi|312897722|ref|ZP_07757138.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
 gi|310621106|gb|EFQ04650.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
          Length = 385

 Score =  328 bits (842), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 114/395 (28%), Positives = 187/395 (47%), Gaps = 29/395 (7%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETV-- 59
             HA LSASS+HRWL C  +P LE + P TTS+YA EGT AH L    L++     T   
Sbjct: 3   TQHAVLSASSAHRWLHCTGSPLLEKEFPDTTSVYAQEGTLAHELCELKLKKYTTVMTKGT 62

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVR----TFSGPFLSETEVPLEPFTTEPGATGT 115
             +       + +   EM  +    L YV+              E  ++     P   GT
Sbjct: 63  YTRAHNKIMKSELWQNEMEGTSEAYLEYVKGIMLACEIAPAVLIEKRVDFSRYVPEGFGT 122

Query: 116 ADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
           AD LI       ++D+K+G GV V A++N Q+MLYA GA+ +   ++ R +++ + I+QP
Sbjct: 123 ADCLILAGDTLHVIDYKHGKGVVVDADHNPQMMLYALGAMDELSLLY-RFKSVHMVIVQP 181

Query: 176 RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV 235
           RV     I+E+ +SAD+L+E  +         +  K++ A+S        D CRFCRAK 
Sbjct: 182 RVNN---ISEFTMSADELIEWGETV-------VKPKAEAAISGNGTFEAGDWCRFCRAKQ 231

Query: 236 RCPALSRHV-----LLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDE 290
           +C             L A  DP   T  EL +       + ++++  ++       AG +
Sbjct: 232 QCKTRYESNDSLYPELSARHDPRLITLEELGEYLKRGRDMAAWLEDMKEYALSESLAGAD 291

Query: 291 IQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSDEF 348
           + G++ VEGR G+R+F D + A ++L     +E   ++R + T  ++E+   ++     F
Sbjct: 292 VPGWKAVEGR-GSRAFTDTDEAVDILIKNGIDESVLYERRVLTLAQMEKAVGKKA----F 346

Query: 349 WEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSE 383
            E +  L+ +  GKP +        K T +   ++
Sbjct: 347 GEIVGNLVVKNPGKPTLVEESDKRPKITNQPTAAD 381


>gi|303239092|ref|ZP_07325622.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
 gi|302593430|gb|EFL63148.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
          Length = 374

 Score =  328 bits (840), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 105/392 (26%), Positives = 181/392 (46%), Gaps = 25/392 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M  HA LSAS+SHRW++C     LE+  P+  S+YA EG+ AH L  + L++ +  ++  
Sbjct: 1   MGEHAKLSASASHRWMECTPCVELEASFPEANSVYADEGSAAHALSEYKLKRLLKIKSGK 60

Query: 61  HQKLTFE-NDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADIL 119
                ++  +      +  +     +A  R  +   +   E  ++     P   GTAD++
Sbjct: 61  KPVSQYDSQELEDYTDQYVTFACECIAEARARTKDAVILIEQRVDFSRFVPEGFGTADLV 120

Query: 120 IFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRT 179
           I       I D KYG GVPV AE+N Q+ LYA GA   + +I+   E + +TI QPR+  
Sbjct: 121 IVADGIMDICDLKYGRGVPVSAEHNPQMQLYALGAYGLFEEIY-EIERVRMTIFQPRLDN 179

Query: 180 GSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA 239
              ++ + ++ D+L+  A+         L  K++ A   E      + CRFCRAK  C A
Sbjct: 180 ---VSTYEMTVDELMSWAEN-------ELKPKAEMASRGEGEFKPGEHCRFCRAKAVCRA 229

Query: 240 LSRHVLLEATK---DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQGYQ 295
            ++  L  A     DP   +  E+ +  +    ++++V    +       AG  +  G++
Sbjct: 230 RAKANLELAKYDFADPELLSDEEMGEILAKAEQLQAWVSDLWEYAQAEAIAGRKKWPGFK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSDEFWEELQ 353
           +V GR  NR + D  +A E+L      E   F + L    ++E+L  ++     F E L+
Sbjct: 290 VVAGR-SNRRYSDEEKAAEVLLVNGYTEKQIFNKKLLGIGDMEKLTGKK----RFEELLK 344

Query: 354 ELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           + I +  GKP +        +       ++F+
Sbjct: 345 DYIEKPAGKPALVSETDKRQEW--NRAAADFD 374


>gi|254975138|ref|ZP_05271610.1| hypothetical protein CdifQC_07480 [Clostridium difficile QCD-66c26]
 gi|255314265|ref|ZP_05355848.1| hypothetical protein CdifQCD-7_07940 [Clostridium difficile
           QCD-76w55]
 gi|255516945|ref|ZP_05384621.1| hypothetical protein CdifQCD-_07514 [Clostridium difficile
           QCD-97b34]
 gi|255650047|ref|ZP_05396949.1| hypothetical protein CdifQCD_07659 [Clostridium difficile
           QCD-37x79]
 gi|260686785|ref|YP_003217918.1| hypothetical protein CDR20291_1421 [Clostridium difficile R20291]
 gi|306519582|ref|ZP_07405929.1| hypothetical protein CdifQ_05387 [Clostridium difficile QCD-32g58]
 gi|260212801|emb|CBE03965.1| putative uncharacterized protein [Clostridium difficile R20291]
          Length = 388

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 106/402 (26%), Positives = 170/402 (42%), Gaps = 35/402 (8%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD--AETVS 60
            HA LSAS +HRWL C  +  LE   P  TSIYA EGT AH L    L    +  ++   
Sbjct: 4   QHARLSASGAHRWLHCTPSIKLEENYPPLTSIYAEEGTVAHELAEVKLMLEYEKISKKAY 63

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPGAT 113
           + ++     +   ++EM   +   +  V       +      +   E  L+     P   
Sbjct: 64  NARIKKIQKSEYYNSEMEDYIQSYVENVVELVNDSKAICDDVIVMLEERLDFSEWVPEGF 123

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D+++ +     ++D KYG G+ V A  N QL LY  GA +Q+  ++   + +  TII
Sbjct: 124 GTGDVVVISDGILQVIDLKYGKGLEVSAIENPQLRLYGLGAYNQFEMLYD-IDLIKTTII 182

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+     I+   I    LL  A   K++           A + E   V+   C FCRA
Sbjct: 183 QPRLDN---ISSEEIEVTKLLTWADNVKKKAQ--------MAFNGEGEFVSGSHCGFCRA 231

Query: 234 KVRCPALSRHVLLEATK----DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAG 288
           K  C   +   L  A K    D       E++        I+ ++K  +    ++    G
Sbjct: 232 KNDCRKRAEDNLKLARKYDFADTFALNKYEIADILGFAKNIQDWLKDVQSYALEQAEKHG 291

Query: 289 DEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFK-RILKTPKELEQLYKEQKVS 345
            +  GY+LVEGR  NR + D     ++L +   +E   +K R LK   ++E+   ++   
Sbjct: 292 VKYPGYKLVEGR-SNRKYVDEQEVAKVLLNSDYDEEKIYKPRTLKGISDMEKAIGKK--- 347

Query: 346 DEFWEELQELITRGDGKPVIAPRDIPT-NKQTQKSQLSEFEV 386
             F + L +LI +  GK  +           +  S   +FE+
Sbjct: 348 -SFAKLLSDLIIKPVGKATLVVESDKRSEINSIDSAKKDFEI 388


>gi|307580174|gb|ADN64143.1| hypothetical protein XFLM_11440 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 425

 Score =  326 bits (836), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 124/409 (30%), Positives = 191/409 (46%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L       +S +A EGT AH + A  L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVALTRTCKDDSSPFADEGTVAHTVAADALRTGSDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                       V  EMA+ V   + YVR  +G  L E  + +   T E  A GTAD++I
Sbjct: 61  GACHEVNGHRWEVTAEMAAYVQEYVDYVRAIAGVRLVEQPLRIASITGEQDAKGTADVVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  IVD KYG GV V AE N QL LYA  AL ++G +    + + L I+QPR+   
Sbjct: 121 LAGDELTIVDLKYGRGVKVFAEGNEQLQLYALAALSEFGGVEAF-QHVRLVIVQPRLGHA 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTL----ALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +   + +  ++  +             +   +  E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPQMEDFRRKVAQGAARCRAAMWHYNNVGELPSEYFGPAETPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + +  LI+S+ K+  D 
Sbjct: 237 CPALATHVLNTVADDFVDLTKPIVPQLSYAQLRTFDNTTLACLFGATELIESWCKSIRDR 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
               L +G  + GY++V+GR+G R + D+  A+ +L  +    ++ +   L +P   E+L
Sbjct: 297 AAAELLSGQPVPGYKVVQGRQGPRRWADMTAAEAMLKQLRIKFKDMYDVSLISPTRAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           ++   + D  W +LQ LI R  G P++ P          +   ++F+ L
Sbjct: 357 HQVGVIGDRQWPKLQPLIHRSTGAPIVVPTSDKRPALALQDA-TDFQDL 404


>gi|170023454|ref|YP_001719959.1| hypothetical protein YPK_1208 [Yersinia pseudotuberculosis YPIII]
 gi|169749988|gb|ACA67506.1| conserved hypothetical protein [Yersinia pseudotuberculosis YPIII]
          Length = 436

 Score =  326 bits (836), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 123/428 (28%), Positives = 185/428 (43%), Gaps = 52/428 (12%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAE----- 57
            HA LS S +HRW++C  +  LE+ I  T S +A EGT AH L    L    D       
Sbjct: 4   QHARLSPSGAHRWMRCSGSLALEAGIKDTGSPFAVEGTAAHALAECVLRNLQDNTLVGQE 63

Query: 58  ------------TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPL 103
                       T      +       V  +MA++V   +  V   S     L E  V  
Sbjct: 64  LVGGQTADSYIGTYPLAHPSKTGAGPQVTPDMATAVQTYVDTVWALSQGNELLIEQRVDF 123

Query: 104 EPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFG 163
                 P   GTAD ++F   +  + D K+G GVPV A  N QL LYA GAL Q+  ++ 
Sbjct: 124 SEIVGVPDQFGTADAIVFAGDELQLHDLKFGMGVPVSAVENEQLQLYALGALDQFAMLYD 183

Query: 164 RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLK------SKRAVS 217
              ++ L I  PR+     ++EWVIS DDL    +  +     ++            ++ 
Sbjct: 184 FT-SVRLFIHMPRLN---FVSEWVISVDDLAAFGERARVAAADSIIAINIAECDGVDSLP 239

Query: 218 LEHYGVNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTT------------------VE 259
            + +   D  CRFC+AK  C A  +H L     D    T                     
Sbjct: 240 ADSFTPGDKQCRFCKAKATCNAGEQHSLNLVANDFVDLTDALEPQLSGAKERITHCDNAH 299

Query: 260 LSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV 319
           L +    + L++ + KA  +     LNAG  + GY+LV G++GNR++     A+  L+++
Sbjct: 300 LGELLGQLDLVEGWCKAVRERANSELNAGHPVPGYKLVIGKQGNRAWSSEETAETTLSAM 359

Query: 320 --LGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQ 377
               EE +   L +P + E+L K++  S   W +L+ LI+R DGKP IAP   P      
Sbjct: 360 RLKKEEMYNFKLISPTQAEKLLKKE--SPRRWTKLEALISRADGKPTIAPEADPRPAH-I 416

Query: 378 KSQLSEFE 385
            +  ++FE
Sbjct: 417 VNPENDFE 424


>gi|307578621|gb|ADN62590.1| hypothetical protein XFLM_02955 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 425

 Score =  326 bits (835), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 124/409 (30%), Positives = 191/409 (46%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L       +S +A EGT AH + A  L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVXLTRTCKDDSSPFADEGTVAHTVAADALRTGSDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                       V  EMA+ V   + YVR  +G  L E  + +   T E  A GTAD++I
Sbjct: 61  GACHEVNGHRWEVTAEMAAYVQEYVDYVRAIAGVRLVEQPLRIASITGEQDAKGTADVVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  IVD KYG GV V AE N QL LYA  AL ++G +    + + L I+QPR+   
Sbjct: 121 LAGDELTIVDLKYGRGVKVFAEGNEQLQLYALAALSEFGGVEAF-QHVRLVIVQPRLGHA 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTL----ALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +   + +  ++  +             +   +  E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPQMEDFRRKVAQGAARCRAAMWHYNNVGELPSEYFGPAETPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + +  LI+S+ K+  D 
Sbjct: 237 CPALATHVLNTVADDFVDLTKPIVPQLSYAQLRTFDNTTLACLFGATELIESWCKSIRDR 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
               L +G  + GY++V+GR+G R + D+  A+ +L  +    ++ +   L +P   E+L
Sbjct: 297 AAAELLSGQPVPGYKVVQGRQGPRRWADMTAAEAMLKQLRIKFKDMYDVSLISPTRAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           ++   + D  W +LQ LI R  G P++ P          +   ++F+ L
Sbjct: 357 HQVGVIGDRQWPKLQPLIHRSTGAPIVVPTSDKRPALALQDA-TDFQDL 404


>gi|273810429|ref|YP_003344900.1| gp10 [Xylella phage Xfas53]
 gi|257097804|gb|ACV41110.1| gp10 [Xylella phage Xfas53]
          Length = 426

 Score =  325 bits (834), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 127/409 (31%), Positives = 194/409 (47%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L        S +A EGT AH + A  L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVPLTRTCKDDASPFADEGTVAHTVAADALRTGSDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                       V  EMA+ V   + YVR  +G  L E  + +   T E GA GTAD++I
Sbjct: 61  GACHEVNGHRWEVTAEMAAYVQEYVDYVRAIAGVRLVEQPLRIASITGEQGAKGTADVVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  IVD KYG GV V AE N QL LYA  AL ++G +    + + L I+QPR+   
Sbjct: 121 LAGDELTIVDLKYGRGVKVFAEGNEQLQLYALAALSEFGWV-ENFQHVRLVIVQPRLGHA 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTL----ALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +   + +  ++  +             +   + LE++   +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPQMEDFRQKVAQGAARCRAAMWRYNNVGELPLEYFSPAETPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + +  LI+S+ K+  D+
Sbjct: 237 CPALATHVLNTVADDFVDLTKPIVPQLSYAQLRTFDNTTLACLFGATELIESWCKSIRDK 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
              +L +G  + GY++V+GR+G R + D+  A+ +L  +    ++ +   L +P   E+L
Sbjct: 297 AAAQLLSGQPVPGYKVVQGRQGPRRWADVTAAEAMLKQLRIKSKDMYDISLISPTTAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           ++   + D  W +LQ LI R  G PV+ P        T +   ++F+ L
Sbjct: 357 HQAGVIGDRQWPKLQPLIHRATGAPVVVPTSDKRPPLTLQDA-TDFQDL 404


>gi|238018838|ref|ZP_04599264.1| hypothetical protein VEIDISOL_00698 [Veillonella dispar ATCC 17748]
 gi|237864604|gb|EEP65894.1| hypothetical protein VEIDISOL_00698 [Veillonella dispar ATCC 17748]
          Length = 380

 Score =  325 bits (833), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 107/392 (27%), Positives = 176/392 (44%), Gaps = 27/392 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            HA L ASSS RWL C  +  LE+  P   S YA+EGT AH+L    L   ++ +  + +
Sbjct: 4   KHALLGASSSARWLVCTPSARLEAMFPDEQSPYAAEGTVAHDLAEAILRHKLEGK-KAPK 62

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
              +  +               +   R  S    +  E  L+     P   GT D++I  
Sbjct: 63  LDDYSTEMIEAVNRYVDICEEKVNEARARSSDAEAMIEARLDFSRWVPEGFGTGDMVIVA 122

Query: 123 STQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSP 182
                ++D KYG GVPV A  NTQ+ LYA GA      ++   + + +TI+QPR+ +   
Sbjct: 123 DGILEVIDLKYGKGVPVSAVENTQMRLYALGAYDVNEFLYD-IKTVRMTIVQPRLDS--- 178

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSR 242
           ++   +S ++LL+  ++            ++RA   E      D C FC+A+  C AL+ 
Sbjct: 179 VSTDEMSLEELLDWGEDI--------KPIAQRAWEGEGECTPCDYCNFCKARHTCRALAD 230

Query: 243 HVLLEATKD----PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQGYQLV 297
             L    K+        T  E+S   +   LI  ++K   D  +++  +G  +  GY+LV
Sbjct: 231 TCLDTFYKNGGKLNQLLTDREVSDILAMKDLITKWIKGVYDFAYEKALSGEKQWPGYKLV 290

Query: 298 EGRKGNRSFKDINRAQELLTSVLG--EEAFK-RILKTPKELEQLYKEQKVSDEFWEELQE 354
           EG    R+  D + A + L       E+ FK R L+    L+++  ++ V     E L+ 
Sbjct: 291 EG-TSRRTITDPDAAAKTLLDNGYKEEDIFKPRELEGITNLQKVLGKKGV----AEYLEA 345

Query: 355 LITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
            I + +GKP + P         T ++ ++EFE
Sbjct: 346 YIEKPEGKPTLVPESDKRPAINTVETMMNEFE 377


>gi|182681745|ref|YP_001829905.1| hypothetical protein XfasM23_1203 [Xylella fastidiosa M23]
 gi|182631855|gb|ACB92631.1| hypothetical protein XfasM23_1203 [Xylella fastidiosa M23]
          Length = 425

 Score =  325 bits (832), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 124/409 (30%), Positives = 191/409 (46%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L       +S +A EGT AH + A  L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVPLTRTCKDDSSPFADEGTVAHTVAADALRTGSDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                       V  EMA+ V   + YVR  +G  L E  + +   T E  A GTAD++I
Sbjct: 61  GACHEVNGHRWEVTAEMAAYVQEYVDYVRAIAGVRLVEQPLRIASITGEQDAKGTADVVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  IVD KYG GV V AE N QL LYA  AL ++G +    + + L I+QPR+   
Sbjct: 121 LAGDELTIVDLKYGRGVKVFAEGNEQLQLYALAALSEFGGVEAF-QHVRLVIVQPRLGHA 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTL----ALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +   + +  ++  +             +   +  E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPQMEDFRRKVAQGAARCRAAMWHYNNVGELPSEYFGPAETPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + +  LI+S+ K+  D 
Sbjct: 237 CPALATHVLNTVADDFVDLTKPIVPQLSYAQLRTFDNTTLACLFGATELIESWCKSIRDR 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
               L +G  + GY++V+GR+G R + D+  A+ +L  +    ++ +   L +P   E+L
Sbjct: 297 AAAELLSGQPVPGYKVVQGRQGPRRWADMTAAEAMLKQLRIKFKDMYDVSLISPTRAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           ++   + D  W +LQ LI R  G P++ P          +   ++F+ L
Sbjct: 357 HQVGVIGDRQWPKLQPLIHRSTGAPIVVPTSDKRPALALQDA-TDFQDL 404


>gi|75906034|gb|ABA29383.1| conserved hypothetical protein [Bacteriophage APSE-2]
          Length = 448

 Score =  325 bits (832), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 130/429 (30%), Positives = 205/429 (47%), Gaps = 49/429 (11%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQ-------- 52
           MA HA L+ SS+HRWLKCP +  LE+ +P  TS +A EG+ AH L    L++        
Sbjct: 17  MAEHAKLAPSSAHRWLKCPGSAALEATLPDKTSPFAEEGSAAHALAESILKRRQNLYSEG 76

Query: 53  -----GVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP--FLSETEVPLEP 105
                G DA+         + ++  VD EM   V   +  V   +       E  V    
Sbjct: 77  CRQTYGFDAKEYIGTYPLLKANSPQVDEEMIEHVQTYIDTVWQLANGKMLQVEERVDFSA 136

Query: 106 FTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRP 165
                 + GTAD +I +S +  I D KYG GV V A+ N QLMLYA GAL Q+  ++   
Sbjct: 137 VIGVDNSFGTADAIIVSSDELQIHDLKYGKGVKVDAQKNEQLMLYALGALQQFDLVYDF- 195

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLK------SKRAVSLE 219
           + + L I QPR+     ++EW +S D+L +  ++ K     A+ +          A+   
Sbjct: 196 KTVRLFIHQPRLN---HLSEWALSVDELKDFGEQAKSGAQKAMKMATLAELSGLDALPDS 252

Query: 220 HYGVNDDSCRFCRAK-VRCPALSRHV------------------LLEATKDPSTNTTVEL 260
            +      C FC+AK   C A ++ V                  L +A K  +  T  ++
Sbjct: 253 AFSPGAKQCLFCKAKGGLCFAQAQFVHNEVKGDFVDLTQPLASQLSDAPKRITLLTPEQM 312

Query: 261 SKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV- 319
           +K Y  + LI+S+ KA  + + + L+ G  + G++LV G++GNR++ D   A+ LL    
Sbjct: 313 AKLYPHVDLIESFCKALRNRVAEALHTGQSVPGFKLVTGKQGNRTWGDEREAETLLKGAK 372

Query: 320 -LGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQK 378
              E+ + + + +P + E+L K+ K     W +L+ LI R DGKPVIAP   P       
Sbjct: 373 LKQEQIYHKKIISPPQAEKLLKKDK--PHRWAKLEALIERADGKPVIAPESDPRPAI-IT 429

Query: 379 SQLSEFEVL 387
           + L++F+ +
Sbjct: 430 TPLNDFDDV 438


>gi|332160961|ref|YP_004297538.1| hypothetical protein YE105_C1339 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325665191|gb|ADZ41835.1| hypothetical protein YE105_C1339 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862117|emb|CBX72281.1| putative protein p51 [Yersinia enterocolitica W22703]
          Length = 436

 Score =  325 bits (832), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 125/428 (29%), Positives = 184/428 (42%), Gaps = 52/428 (12%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAE----- 57
            HA LS S +HRW++C  +  LE+ I  T S +A EGT AH L    L    D       
Sbjct: 4   QHARLSPSGAHRWMRCSGSLALEAGIEDTGSPFAVEGTAAHALAECVLRNLQDNTLAGQE 63

Query: 58  ------------TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPL 103
                       T      +  +    V  +MA++V   +  V   S     L E  V  
Sbjct: 64  LVGGQTAASYIGTYPLAHPSKPDAGPQVTPDMAAAVQTYVDTVWALSQGNELLIEQRVDF 123

Query: 104 EPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFG 163
                 P   GTAD +IF   +  + D K+G GVPV A  N QL LYA GAL Q+  ++ 
Sbjct: 124 SEIVGVPDQFGTADAIIFAGDELQLHDLKFGMGVPVNAVENEQLQLYALGALDQFAMLYD 183

Query: 164 RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKE------FKERGTLALSLKSKRAVS 217
              ++ L I  PR+     ++EWVIS DDL    +                      ++ 
Sbjct: 184 FT-SVRLFIHMPRLN---FVSEWVISVDDLAAFGERARIAAADSIIAINIAECDGVDSLP 239

Query: 218 LEHYGVNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTT------------------VE 259
            + +   D  CRFC+AK  C AL +H L     D    T                     
Sbjct: 240 ADSFTPGDKQCRFCKAKATCKALEQHSLNLVANDFVDLTDNLEPQLASAKERITHCDNAH 299

Query: 260 LSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV 319
           L +    + L++ + KA  +     LNAG  + GY+LV G++GNR++     A+  L+++
Sbjct: 300 LGELLGQLDLVEGWCKAVRERANSELNAGHPVPGYKLVIGKQGNRAWNSEETAEATLSAM 359

Query: 320 --LGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQ 377
               EE +   L +P + E+L K++  S   W +L+ LI+R DGKP IAP   P      
Sbjct: 360 RLKKEEMYNFKLISPTQAEKLLKKE--SPRRWTKLEALISRADGKPTIAPEADPRPAH-I 416

Query: 378 KSQLSEFE 385
            +  ++FE
Sbjct: 417 VNPENDFE 424


>gi|325478681|gb|EGC81792.1| hypothetical protein HMPREF9290_0162 [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 370

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 99/389 (25%), Positives = 172/389 (44%), Gaps = 27/389 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQ--GVDAET 58
           M  HA LSASSS+RW+ CP +  L  K     S YA EGT AH L  + L++  G+D + 
Sbjct: 1   MGAHAILSASSSNRWIHCPPSVRLSQKYEDEVSPYALEGTSAHALAEYKLKKLLGLDIKE 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     ++ +   +    AS V+ V++   +         E  L+       + GTAD 
Sbjct: 61  PTEDLDFYDEEMDELTEGYASYVTEVISRYES----PAVFVEERLDLSDYVKESFGTADC 116

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           ++    +  ++D KYG GV V A+ N+QLMLY  GAL  +  I+   E + L I QPR  
Sbjct: 117 VVVGGKELHVIDLKYGQGVLVDAKENSQLMLYGLGALILFDGIYD-IENVILHIYQPRRC 175

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               I+ + I   +L +  +  +E         +++A   E   +  + C FC+A  RC 
Sbjct: 176 N---ISTYEIKKTELYKWGESVRE--------IAEKAYKGEGEFLCGEWCIFCKANNRCR 224

Query: 239 ALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L  A ++   P   +  E+ +    +  ++ +VK  +    +R   G   +  +
Sbjct: 225 KRAEENLKLAQEEFILPPELSDDEIEEILPKLDQLEQWVKDIKAYALERAMRGHRWKDLK 284

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           LVEGR  NR ++D +   + +  +     F+  L     + +L  ++     F E + +L
Sbjct: 285 LVEGR-SNRRYRDEDEVVKKVRELGF-NPFEEKLLGITAMTKLLGKKV----FDENITDL 338

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           + +  GK  +        +    +   EF
Sbjct: 339 LEKPKGKLTLVSVRDKREEVKIDNVKEEF 367


>gi|28199023|ref|NP_779337.1| hypothetical protein PD1131 [Xylella fastidiosa Temecula1]
 gi|28199599|ref|NP_779913.1| hypothetical protein PD1724 [Xylella fastidiosa Temecula1]
 gi|182682340|ref|YP_001830500.1| hypothetical protein XfasM23_1823 [Xylella fastidiosa M23]
 gi|28057121|gb|AAO28986.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|28057714|gb|AAO29562.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|182632450|gb|ACB93226.1| hypothetical protein XfasM23_1823 [Xylella fastidiosa M23]
          Length = 425

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 124/409 (30%), Positives = 190/409 (46%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L        S +A EGT AH + A  L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVALTRTCKDDASPFADEGTVAHTVAADALRTGSDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                       V  EMA+ V   + YVR  +G  L E  + +   T E  A GTAD++I
Sbjct: 61  GACHEVNGHRWEVTAEMAAYVQEYVDYVRAIAGVRLVEQPLRIASITGEQDAKGTADVVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  IVD KYG GV V AE N QL LYA  AL ++G +    + + L I+QPR+   
Sbjct: 121 LAGDELTIVDLKYGRGVKVFAEGNEQLQLYALAALSEFGGVEAF-QHVRLVIVQPRLGHA 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTL----ALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +   + +  ++  +             +   +  E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPQMEDFRRKVAQGAARCRAAMWHYNNVGELPSEYFGPAETPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + +  LI+S+ K+  D 
Sbjct: 237 CPALATHVLNTVADDFVDLTKPIVPQLSYAQLRTFDNTTLACLFGATELIESWCKSIRDR 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
               L +G  + GY++V+GR+G R + D+  A+ +L  +    ++ +   L +P   E+L
Sbjct: 297 AAAELLSGQPVPGYKVVQGRQGPRRWADMTAAEAMLKQLRIKFKDMYDVSLISPTRAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           ++   + D  W +LQ LI R  G P++ P          +   ++F+ L
Sbjct: 357 HQVGVIGDRQWPKLQPLIHRSTGAPIVVPTSDKRPALALQDA-TDFQDL 404


>gi|212499745|ref|YP_002308553.1| hypothetical protein APSE241 [Bacteriophage APSE-2]
 gi|238898736|ref|YP_002924418.1| APSE-2 prophage; hypothetical [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|211731714|gb|ACJ10202.1| conserved hypothetical protein [Bacteriophage APSE-2]
 gi|229466496|gb|ACQ68270.1| APSE-2 prophage; conserved hypothetical [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 439

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 130/429 (30%), Positives = 205/429 (47%), Gaps = 49/429 (11%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQ-------- 52
           MA HA L+ SS+HRWLKCP +  LE+ +P  TS +A EG+ AH L    L++        
Sbjct: 8   MAEHAKLAPSSAHRWLKCPGSAALEATLPDKTSPFAEEGSAAHALAESILKRRQNLYSEG 67

Query: 53  -----GVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP--FLSETEVPLEP 105
                G DA+         + ++  VD EM   V   +  V   +       E  V    
Sbjct: 68  CRQTYGFDAKEYIGTYPLLKANSPQVDEEMIEHVQTYIDTVWQLANGKMLQVEERVDFSA 127

Query: 106 FTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRP 165
                 + GTAD +I +S +  I D KYG GV V A+ N QLMLYA GAL Q+  ++   
Sbjct: 128 VIGVDNSFGTADAIIVSSDELQIHDLKYGKGVKVDAQKNEQLMLYALGALQQFDLVYDF- 186

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLK------SKRAVSLE 219
           + + L I QPR+     ++EW +S D+L +  ++ K     A+ +          A+   
Sbjct: 187 KTVRLFIHQPRLN---HLSEWALSVDELKDFGEQAKSGAQKAMKMATLAELSGLDALPDS 243

Query: 220 HYGVNDDSCRFCRAK-VRCPALSRHV------------------LLEATKDPSTNTTVEL 260
            +      C FC+AK   C A ++ V                  L +A K  +  T  ++
Sbjct: 244 AFSPGAKQCLFCKAKGGLCFAQAQFVHNEVKGDFVDLTQPLASQLSDAPKRITLLTPEQM 303

Query: 261 SKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV- 319
           +K Y  + LI+S+ KA  + + + L+ G  + G++LV G++GNR++ D   A+ LL    
Sbjct: 304 AKLYPHVDLIESFCKALRNRVAEALHTGQSVPGFKLVTGKQGNRTWGDEREAETLLKGAK 363

Query: 320 -LGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQK 378
              E+ + + + +P + E+L K+ K     W +L+ LI R DGKPVIAP   P       
Sbjct: 364 LKQEQIYHKKIISPPQAEKLLKKDK--PHRWAKLEALIERADGKPVIAPESDPRPAI-IT 420

Query: 379 SQLSEFEVL 387
           + L++F+ +
Sbjct: 421 TPLNDFDDV 429


>gi|308174989|ref|YP_003921694.1| protein p51 [Bacillus amyloliquefaciens DSM 7]
 gi|307607853|emb|CBI44224.1| putative protein p51 [Bacillus amyloliquefaciens DSM 7]
          Length = 392

 Score =  324 bits (830), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 119/400 (29%), Positives = 188/400 (47%), Gaps = 33/400 (8%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLE--QGVDAETVS 60
            HA LSAS S RWL C  +  LE +  +TTS +A EGT AH +    L+   G  ++   
Sbjct: 9   AHAKLSASGSKRWLTCTPSARLEDQFEETTSEFAEEGTLAHEVSEVLLQYHTGAISKAAR 68

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPGAT 113
            ++L       +    M   VS     V           G  +   E  L+     P   
Sbjct: 69  TRRLNKLKKHELYSDSMIEYVSTYSDLVIEKFNALEAEKGDAMILLEQRLDFSEWVPEGF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D LI       ++D KYG GVPV AE NTQ+MLYA GAL+Q+G ++   E + +TI+
Sbjct: 129 GTGDALIIADEVMEVIDLKYGKGVPVDAEKNTQMMLYALGALNQFGALYD-IECVRMTIV 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+ +   ++ + +S  +LL  A +F       +  +++ A   E      D CRFCRA
Sbjct: 188 QPRLDS---VSTYELSVSELLSWANDF-------VKPRAEMAWQGEGEFEAGDHCRFCRA 237

Query: 234 KVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGD 289
           K  C A ++  L  A  D   P   +  +L K       +K +VK  ++    +  + G+
Sbjct: 238 KANCSARAKKNLELARFDFQKPELLSKEDLGKILYEAEELKRWVKDIQEYTLAQAEHHGE 297

Query: 290 EIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE---AFKRILKTPKELEQLYKEQKVSD 346
           +I G++LVEGR  NR + D++  +  L +   E      K  +     LE+   ++    
Sbjct: 298 KIPGWKLVEGR-SNRKYADVDAVKNTLLAEGYEPEQVLSKPEVLGVSALEKSIGKKA--- 353

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
            F E L++L+ +  GKP + P      +  + +S +++FE
Sbjct: 354 -FNELLKDLVIKPVGKPTLVPESDKRPELNSTESAIADFE 392


>gi|71899881|ref|ZP_00682029.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71730321|gb|EAO32404.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 426

 Score =  324 bits (830), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 125/409 (30%), Positives = 190/409 (46%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L       +S +A EGT AH + A  L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVPLTRTCKDDSSPFADEGTVAHTVAADALRTGCDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                       V  EMA+ V   + YVR  +G  L E  + +   T E GA GTAD++I
Sbjct: 61  GACHEVNGHRWEVTAEMAAYVQEYVDYVRAIAGVRLVEQPLRIASITGEQGAKGTADVVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  IVD KYG GV V AE N QL LYA  AL ++  +    + + L I+QPR+   
Sbjct: 121 LAGDELTIVDLKYGRGVKVFAEGNEQLQLYALAALQEFAGVEAF-QHVRLVIVQPRLGHA 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSK----RAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +   + +  ++  +      +          +  E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPQMEDFRRKVAQGAARCRAAIGHYDNVGELPSEYFGPAETPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + +  LI+S+ K+  D 
Sbjct: 237 CPALATHVLNTVADDFVDLTKPIVPQLSYAQLRTFDNTTLACLFGATELIESWCKSIRDR 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
               L +G  + GY++V+GR G R + D+  A+ +L  +    ++ +   L +P   E+L
Sbjct: 297 AAAELLSGQPVPGYKVVQGRHGPRRWADMTAAETMLKQLRIKFKDMYDVSLISPTRAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           ++   + D  W +LQ LI R  G PV+ P          +   ++F+ L
Sbjct: 357 HQAGVIGDRQWPKLQPLIHRAAGAPVVVPTSDKRPALALQDA-TDFQDL 404


>gi|328913311|gb|AEB64907.1| putative protein p51 [Bacillus amyloliquefaciens LL3]
          Length = 392

 Score =  323 bits (828), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 118/400 (29%), Positives = 187/400 (46%), Gaps = 33/400 (8%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLE--QGVDAETVS 60
            HA LSAS S RWL C  +  LE +  +TTS +A EGT AH +    L+   G  ++   
Sbjct: 9   AHAKLSASGSKRWLTCTPSARLEDQFEETTSEFAEEGTLAHEVSEALLQYHTGAISKAAR 68

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPGAT 113
            ++L       +    M   VS     V           G  +   E  L+     P   
Sbjct: 69  TRRLNKLKKHELYSDSMIEYVSTYSDLVIEKFNALEAEKGDAMILLEQRLDFSEWVPEGF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D LI       ++D KYG GVPV+AE NTQ+MLYA GAL+Q+G ++   E + +TI+
Sbjct: 129 GTGDALIIADEVMEVIDLKYGKGVPVEAEQNTQMMLYALGALNQFGALYD-IEFVRMTIV 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+     ++ + +S  +L+  A EF       +  +++ A   E      + CRFCRA
Sbjct: 188 QPRLD---SVSTYELSVPELMAWANEF-------VKPRAQMAWKGEGDFEAGEHCRFCRA 237

Query: 234 KVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGD 289
           K  C A +   L  A  D   P   +  +L K       +K +VK  ++    +  + G+
Sbjct: 238 KANCSARAEKNLELARFDFQKPELLSKEDLGKILYEAEELKRWVKDIQEYTLAQAEHHGE 297

Query: 290 EIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE---AFKRILKTPKELEQLYKEQKVSD 346
           +I G++LVEGR  NR + D++  +  L +   E      K  +     LE+   ++    
Sbjct: 298 KIPGWKLVEGR-SNRKYADVDAVKNTLLAEGYEPEQVLSKPEVLGVSALEKSIGKKA--- 353

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
            F E L++L+ +  GKP + P      +  + +S +++FE
Sbjct: 354 -FNELLKDLVIKPVGKPTLVPESDKRPELNSTESAIADFE 392


>gi|269120026|ref|YP_003308203.1| hypothetical protein Sterm_1409 [Sebaldella termitidis ATCC 33386]
 gi|268613904|gb|ACZ08272.1| conserved hypothetical protein [Sebaldella termitidis ATCC 33386]
          Length = 389

 Score =  322 bits (826), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 116/400 (29%), Positives = 189/400 (47%), Gaps = 30/400 (7%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQ-----GVD 55
           M+ HA LSAS + RW+ C  +  LE  +  TTS YA EGT AH L    L +     G+ 
Sbjct: 1   MS-HAILSASGASRWINCNPSARLEETMENTTSGYAEEGTLAHALAELKLRKYFIETGMA 59

Query: 56  AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRT----FSGPFLSETEVPLEPFTTEPG 111
             T + +        R+   E+ S     + +VR     F      E E  +      P 
Sbjct: 60  KRTYTSELNKL-KKHRLWQNEIDSYTDEYVDHVRAIAMSFDVAPFIEIEKKVSFEEYVPE 118

Query: 112 ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLT 171
           A GTAD +I +  +  I+D KYG GVPV AENN+QLMLYA GA  +Y  +F   E + + 
Sbjct: 119 AFGTADTIIISGDRLYIIDLKYGKGVPVYAENNSQLMLYALGAYLEY-SLFYGIENIEMH 177

Query: 172 IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
           I+QPR+     I+ + I  +DLLE A+         +   ++RA + E      + C+FC
Sbjct: 178 IVQPRLEN---ISMFSIKVNDLLEWAETV-------IKPNAQRAFAGEGEFNPGEHCKFC 227

Query: 232 RAKVRCPALSR--HVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGD 289
           +AK  C A +     L    +     T  E ++A    + +  ++   + E+F  +  G+
Sbjct: 228 KAKASCRARAANYFTLEALKEKGPLLTNEEKAEALQRGAELDKWLGELKVEIFSAIEKGE 287

Query: 290 EIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSDE 347
           E++G+++V+GR   R F D + A   L      E   ++R + T  ++E +  ++    +
Sbjct: 288 EVKGWKIVQGRSAGRKFTDTDAAVGKLKEHGIAEELLYERKMLTVPQMETVIGKK----D 343

Query: 348 FWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           F E + +++    GKP +AP        +++     F V+
Sbjct: 344 FKEWVGDMVETIPGKPTLAPESDKREAISKRKSKDVFSVI 383


>gi|71898930|ref|ZP_00681097.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71731342|gb|EAO33406.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 426

 Score =  322 bits (826), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 127/409 (31%), Positives = 191/409 (46%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L       +S +A EGT AH + A  L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVALTRTCKDDSSPFADEGTVAHTVAADALRTGCDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                       V  EMA+ V   + YVRT +G  L E  + +   T E GA GTAD++I
Sbjct: 61  GACHEVNGHRWEVTAEMAAYVQEYVDYVRTIAGVRLVEQPLRIASITREQGAKGTADVVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  IVD KYG GV V AE N QL LYA  AL ++  +    + + L I+QPR+   
Sbjct: 121 LAGDELTIVDLKYGRGVKVFAEGNEQLQLYALAALQEFAGVEAF-QHVRLVIVQPRLGHA 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSK----RAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +   + +  ++  +      +          +  E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPQMEDFRRKVAQGAARCRAAIGHYTNVGELPSEYFGPAETPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + +  LI+S+ K+  D 
Sbjct: 237 CPALATHVLNTVADDFVDLTKPIVPQLSYAALRTFDNTTLACLFGATELIESWCKSIRDR 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
               L +G  + GY++V+GR G R + D+  A+ +L  +    ++ +   L +P   E+L
Sbjct: 297 AAAELLSGQPVPGYKVVQGRHGPRRWADMTAAEAMLKQLRIKFKDMYDVSLISPTRAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           Y+   + D  W +LQ LI R  G PV+ P          +   ++F+ L
Sbjct: 357 YQAGVIGDRQWPKLQPLIHRAAGTPVVVPTSDKRPPLALQDA-TDFQDL 404


>gi|297585293|ref|YP_003701073.1| hypothetical protein Bsel_3026 [Bacillus selenitireducens MLS10]
 gi|297143750|gb|ADI00508.1| conserved hypothetical protein [Bacillus selenitireducens MLS10]
          Length = 388

 Score =  321 bits (824), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 106/399 (26%), Positives = 172/399 (43%), Gaps = 34/399 (8%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD---AETV 59
            HA LSAS + RW+ CP +  L  +I  TTS YA EGTF H L    L   ++    E  
Sbjct: 7   AHAKLSASGASRWMNCPPSVKLSEQIEDTTSFYAEEGTFMHELSELYLGHYLETMNEEQY 66

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPGA 112
             +K     ++      +  +V   +  V       R      L   E  ++     P  
Sbjct: 67  LKEKKE-RRESPFYTQAIDDAVQAYVDTVIERINEARALQSDALVRIEERVDFSPWVPEG 125

Query: 113 TGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTI 172
            GT D+LI       I+D K G GV V AE N Q+ LYA GAL+ YG ++   + + +TI
Sbjct: 126 FGTGDVLIVTDGLLEIIDLKGGEGVKVYAEGNPQMRLYALGALNGYGFLYH-IDTVQMTI 184

Query: 173 IQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCR 232
           +QPR+     ++   ++AD LLE A+         +  K++ A +     +    C+FC+
Sbjct: 185 VQPRLD---HLSTDEMTADALLEWAET-------EVKPKAELAFNGLGEFLPGAHCQFCK 234

Query: 233 AKVRCPALSRHVLLEA---TKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAG 288
               C A +      A    K+P   T  E+S+    +  + ++ K  ++   K  +   
Sbjct: 235 VSATCRARAEERQKLACLDFKEPPLLTDEEVSQVLREVDELVNWAKQVQEYALKTAMKEN 294

Query: 289 DEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSD 346
            +  G +LV+GR G+R + D       L     EE   FK+ LK    +E++  ++    
Sbjct: 295 KKWPGMKLVQGR-GSRVYTDEKAIISTLKEAGMEEHQLFKQTLKPITNMEKMLGKKT--- 350

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
            F + +  LIT+  GK  +   +         S   +F+
Sbjct: 351 -FQDLVGHLITKTPGKLKLVETEDSRPAAKP-SAAEDFQ 387


>gi|304439196|ref|ZP_07399114.1| phage protein [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372328|gb|EFM25916.1| phage protein [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 370

 Score =  321 bits (824), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 99/389 (25%), Positives = 167/389 (42%), Gaps = 27/389 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLE--QGVDAET 58
           MA HA LSASSS RWL C  +  L  K     S YA EGT AH+L    ++   G+D + 
Sbjct: 1   MADHAILSASSSSRWLNCQKSVRLCEKYEDEVSPYALEGTCAHSLAEFKIKSLLGLDTQN 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
            +     +  +   +    AS V  +++   +         E  L+       + GTAD 
Sbjct: 61  PTEDLDYYNEEMEELTEGYASYVMEIVSKYHS----PAVFVEERLDLSDYVKESFGTADC 116

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           ++       ++D KYG GV V A+ N+QLMLY  GAL  +  I+   E + L I QPR  
Sbjct: 117 VVVGGKDLHVIDLKYGQGVLVDAKENSQLMLYGLGALTLFDGIYD-IEKVILHIYQPRRC 175

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               I+ + I   +L +  +  +E         +++A   E      + C FC+AK +C 
Sbjct: 176 N---ISTYEIKKIELYKWGESVRE--------IAEKAYRGEGEFSCGEWCIFCKAKNKCR 224

Query: 239 ALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
             +   L  A  +   P   +  E+ +    +  ++ +VK  +    +R   G + +  +
Sbjct: 225 KRAEENLKLAQDEFTLPPELSDEEIEEILPKLDELEQWVKDIKTYALERAMKGHKWKDLK 284

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           LVEGR  NR ++D +     +  +     F+  L     + +L  ++     F E + +L
Sbjct: 285 LVEGR-SNRKYRDEDEVINKVKELGF-NPFEEKLLGITAMTKLLGKKV----FDENIVDL 338

Query: 356 ITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           + +  GK  +   D    +    +   EF
Sbjct: 339 LEKPKGKLTLVSIDDKREEVKIDNVKEEF 367


>gi|45580782|ref|NP_996648.1| hypothetical protein BIP-1p37 [Bordetella phage BIP-1]
          Length = 418

 Score =  321 bits (822), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 127/407 (31%), Positives = 185/407 (45%), Gaps = 24/407 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  LE++ P  +S +A EGT AH L A  L  G DA    
Sbjct: 1   MSTHAQLSPSSAHRWLHCPGSVALEAECPDDSSDFADEGTAAHELAAMSLTNGQDASAFL 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            + +        V  EMA  V   + YVR   G  + E  + +E  T E GA GT+D ++
Sbjct: 61  GRIIEVNGKGWEVTAEMAEHVQKYIDYVRALGGELMVEQRLSVEAVTGEAGAKGTSDAVV 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               + I+ D KYG GV V AE N QL +YA  AL ++  +      + L I+QPR+   
Sbjct: 121 LLPDELIVADLKYGRGVKVDAERNEQLAIYARAALDEFEFLGDFKR-VRLVIVQPRLDHI 179

Query: 181 SPINEWVISADD---LLEKAKEFKERGTLALSLKSKRAVS--LEHYGVNDDSCRFCRAKV 235
           S  +  + S  +   L       K     AL    K A     +     +  CRFC+AK 
Sbjct: 180 SEWDMPIASQGEGASLDSFVANSKPAAERALQFIGKPAAEVKPDDLAPGEKQCRFCKAKA 239

Query: 236 RCPALSRHVLLEATKDP----------------STNTTVELSKAYSSISLIKSYVKACED 279
            CPAL  HVL     D                  T     L     ++ L++S+ KA   
Sbjct: 240 TCPALRDHVLSTVADDFVDVSKPVAPQIEHAAERTVDNAILGNLLGAVDLVESWCKAIRA 299

Query: 280 EMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQ 337
           +    L AG  + G++LVEGR+G R + +    +  L ++    E+ +   L +P   E+
Sbjct: 300 KAEAELLAGHPVPGFKLVEGRRGARRWTNDAEVEAALKAMRLKVEQMYDLSLISPTTAEK 359

Query: 338 LYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           L+K   +    W +LQ  IT+ DGKP +AP          ++   +F
Sbjct: 360 LHKAGDIGPRQWPKLQGFITQSDGKPSVAPESDKRPALVIQAAADDF 406


>gi|41179398|ref|NP_958707.1| Bbp38 [Bordetella phage BPP-1]
 gi|40950137|gb|AAR97703.1| Bbp38 [Bordetella phage BPP-1]
          Length = 418

 Score =  320 bits (821), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 127/407 (31%), Positives = 185/407 (45%), Gaps = 24/407 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  LE++ P  +S +A EGT AH L A  L  G DA    
Sbjct: 1   MSTHAQLSPSSAHRWLHCPGSVALEAECPDDSSDFADEGTAAHELAAMSLTNGQDASAFL 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            + +        V  EMA  V   + YVR   G  + E  + +E  T E GA GT+D ++
Sbjct: 61  GRIIEVNGKGWEVTAEMAEHVQKYIDYVRALGGELMVEQRLSVEAVTGEAGAKGTSDAVV 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               + I+ D KYG GV V AE N QL +YA  AL ++  +      + L I+QPR+   
Sbjct: 121 LLPDELIVADLKYGRGVKVDAERNEQLAIYARAALDEFEFLGDFKR-VRLVIVQPRLDHI 179

Query: 181 SPINEWVISADD---LLEKAKEFKERGTLALSLKSKRAVS--LEHYGVNDDSCRFCRAKV 235
           S  +  + S  +   L       K     AL    K A     +     +  CRFC+AK 
Sbjct: 180 SEWDMPIASQGEGASLDSFVANSKPAAERALQFIGKPAAEVKPDDLAPGEKQCRFCKAKA 239

Query: 236 RCPALSRHVLLEATKDP----------------STNTTVELSKAYSSISLIKSYVKACED 279
            CPAL  HVL     D                  T     L     ++ L++S+ KA   
Sbjct: 240 TCPALRDHVLSTVADDFVDVSKPVAPRIEHAAERTVDNAILGNLLGAVDLVESWCKAIRA 299

Query: 280 EMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQ 337
           +    L AG  + G++LVEGR+G R + +    +  L ++    E+ +   L +P   E+
Sbjct: 300 KAEAELLAGHPVPGFKLVEGRRGARRWTNDAEVEAALKAMRLKVEQMYDLSLISPTTAEK 359

Query: 338 LYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           L+K   +    W +LQ  IT+ DGKP +AP          ++   +F
Sbjct: 360 LHKAGDIGPRQWPKLQGFITQSDGKPSVAPESDKRPALVIQAAADDF 406


>gi|45569531|ref|NP_996600.1| hypothetical protein BMP-1p37 [Bordetella phage BMP-1]
          Length = 418

 Score =  320 bits (821), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 127/407 (31%), Positives = 185/407 (45%), Gaps = 24/407 (5%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  LE++ P  +S +A EGT AH L A  L  G DA    
Sbjct: 1   MSTHAQLSPSSAHRWLHCPGSVALEAECPDDSSDFADEGTAAHELAAMSLTNGQDASAFL 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            + +        V  EMA  V   + YVR   G  + E  + +E  T E GA GT+D ++
Sbjct: 61  GRIIDVNGKGWEVTAEMAEHVQKYIDYVRALGGELMVEQRLSVEAVTGEAGAKGTSDAVV 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               + I+ D KYG GV V AE N QL +YA  AL ++  +      + L I+QPR+   
Sbjct: 121 LLPDELIVADLKYGRGVKVDAERNEQLAIYARAALDEFEFLGDFKR-VRLVIVQPRLDHI 179

Query: 181 SPINEWVISADD---LLEKAKEFKERGTLALSLKSKRAVS--LEHYGVNDDSCRFCRAKV 235
           S  +  + S  +   L       K     AL    K A     +     +  CRFC+AK 
Sbjct: 180 SEWDMPIASQGEGASLDSFVANSKPAAERALQFIGKPAAEVKPDDLAPGEKQCRFCKAKA 239

Query: 236 RCPALSRHVLLEATKDP----------------STNTTVELSKAYSSISLIKSYVKACED 279
            CPAL  HVL     D                  T     L     ++ L++S+ KA   
Sbjct: 240 TCPALRDHVLSTVADDFVDVSKPVAPQIEHAAERTVDNAILGNLLGAVDLVESWCKAIRA 299

Query: 280 EMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQ 337
           +    L AG  + G++LVEGR+G R + +    +  L ++    E+ +   L +P   E+
Sbjct: 300 KAEAELLAGHPVPGFKLVEGRRGARRWTNDAEVEAALKAMRLKVEQMYDLSLISPTTAEK 359

Query: 338 LYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           L+K   +    W +LQ  IT+ DGKP +AP          ++   +F
Sbjct: 360 LHKAGDIGPRQWPKLQGFITQSDGKPSVAPESDKRPALVIQAAADDF 406


>gi|212712320|ref|ZP_03320448.1| hypothetical protein PROVALCAL_03408 [Providencia alcalifaciens DSM
           30120]
 gi|212685066|gb|EEB44594.1| hypothetical protein PROVALCAL_03408 [Providencia alcalifaciens DSM
           30120]
          Length = 428

 Score =  320 bits (819), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 121/421 (28%), Positives = 192/421 (45%), Gaps = 44/421 (10%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQ--------GVD 55
           HA LS SS+HRW+ C  +  LES +P   S +A EGT AH L    L          G +
Sbjct: 5   HARLSPSSAHRWMVCSGSLALESTVPDKGSPFAVEGTAAHALGECVLRNRQEGSGNLGQN 64

Query: 56  AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTTEPGAT 113
                      + DT  V+ EM  +V   +  V + +     L E +V          + 
Sbjct: 65  TSDYLGTYPLNQADTPQVNEEMVEAVGQYVETVWSLAEGKELLIEQKVDFSDVIGVENSF 124

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GTAD +I +  +  I D KYG GV V AENN QL LYA GAL Q+  ++   + + L I 
Sbjct: 125 GTADAIILDPDELQIHDLKYGKGVKVDAENNEQLQLYALGALDQFSMLYDF-KTVRLFIH 183

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLAL------SLKSKRAVSLEHYGVNDDS 227
           QPR+     ++EW ++ D+L+   +  KE  T A+        +    +    +   +  
Sbjct: 184 QPRLN---HVSEWALTVDELIAFGERAKEAATEAVVTCSIAECEGVNTLPPTSFNPGEKQ 240

Query: 228 CRFCRAK-VRCPALSRHVLLEATKDPSTNT------------------TVELSKAYSSIS 268
           CRFC+AK   C A ++H L     D    T                    +L++ Y  + 
Sbjct: 241 CRFCKAKGGLCAAEAQHALELVKGDFVDLTAPLEGQLSEAPQRITVLKPSQLAEIYKGLD 300

Query: 269 LIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTS--VLGEEAFK 326
            ++++ K     +   LN+G  I G +LV G+ GNR++ +   A+  L +  +  EE + 
Sbjct: 301 FVENFCKTLRIRVSDELNSGHTIPGLKLVTGKLGNRTWGNETEAEATLKAFRLKREEMYN 360

Query: 327 RILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEV 386
             L +P + E+L   +K +   W +L+ LITR +GKPV+A    P       +  ++F+ 
Sbjct: 361 MKLISPTQAEKLI--KKDNPRRWTKLESLITRAEGKPVVAFESDPRPALVI-NPENDFDD 417

Query: 387 L 387
           +
Sbjct: 418 V 418


>gi|15839112|ref|NP_299800.1| hypothetical protein XF2522 [Xylella fastidiosa 9a5c]
 gi|9107728|gb|AAF85320.1|AE004059_10 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 425

 Score =  320 bits (819), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 132/409 (32%), Positives = 194/409 (47%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L        S +A EGT AH + A+ L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVPLTRTCQDDASPFADEGTVAHTVAANALRTGSDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            ++      T  V  EMA+SV   + YVR  +G  L E  + +   T E GA GTAD++I
Sbjct: 61  GERHEINGRTWEVTAEMAASVQEYVDYVRAIAGVRLVEQPLHIASITGEQGAKGTADVVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  IVD KYG GV V AE N QL LYA  AL ++G +    + + L I+QPR+   
Sbjct: 121 LAGDALTIVDLKYGKGVKVFAEGNEQLQLYALAALSEFGWVEDF-QQVRLVIVQPRLGHS 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSK----RAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +  ++ +  +  K   T  +           +S E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPEMEDFKQRVKRSATRCMEAIGHYTNVGELSSEYFGPAETPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + + +LI+S+ K+  D 
Sbjct: 237 CPALATHVLTTVADDFVDLTQPVAPQLSHAALRTFDNTTLASLFGATALIESWCKSIRDR 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
               L +G  + GY+LV+GR+G R + D   A++ L  +           L +P   E+L
Sbjct: 297 AAAELLSGQPVPGYKLVQGRQGPRRWVDETAAEDALIQMRIGVAHLHDVSLISPTSAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           ++   + +  W +LQ LI R  G PV+ P          +   ++FE L
Sbjct: 357 HQAGIIGESQWTQLQPLIHRATGAPVVVPTSDQRPPLALQDA-TDFEDL 404


>gi|71276264|ref|ZP_00652542.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71900319|ref|ZP_00682454.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71162872|gb|EAO12596.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71729894|gb|EAO31990.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 425

 Score =  319 bits (818), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 126/409 (30%), Positives = 189/409 (46%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L        S +A EGT AH + A  L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVPLTRTCKDDASPFADEGTVAHTVAADALRTGCDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            +          V  EMA+ V   + YVR  +G  L E  + +   T E GA GTAD++I
Sbjct: 61  GECHEVNGHRWEVTAEMAAYVQEYVDYVRAIAGVRLVEQPLRIASITREQGAKGTADVVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  IVD KYG GV V AE N QL LYA  AL ++  +    + + L I+QPR+   
Sbjct: 121 LAGDELTIVDLKYGRGVKVFAEGNEQLQLYALAALQEFAGLEAF-QHVRLVIVQPRLGHA 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTL----ALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +   + +  ++  +             +   +  E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPQMEDFRRKVAQGAARCRAAMWHYNNVGELPSEYFGPAEKPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + +  LI+S+ K+  D 
Sbjct: 237 CPALATHVLNTVADDFVDLTKPIVPQLSYAALRTFDNTTLACLFGATELIESWCKSIRDR 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
               L +G  + GY++V+GR G R + D   A++ L  +    ++ +   L +P   E+L
Sbjct: 297 AAAELLSGQPVPGYKVVQGRHGPRRWVDETAAEDALKQLRIKFKDMYDVSLISPTRAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           Y+   + D  W +LQ LI R  G PV+ P          +   ++F+ L
Sbjct: 357 YQAGVIGDRQWPKLQPLIHRAAGTPVVVPTSDKRPPLALQDA-TDFQDL 404


>gi|298346389|ref|YP_003719076.1| phage-associated protein [Mobiluncus curtisii ATCC 43063]
 gi|298236450|gb|ADI67582.1| phage-associated protein [Mobiluncus curtisii ATCC 43063]
          Length = 354

 Score =  319 bits (818), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 89/365 (24%), Positives = 148/365 (40%), Gaps = 19/365 (5%)

Query: 23  TLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVS 82
            L        S  A +GT AH L  H L + +  ++        +++      +    V 
Sbjct: 1   MLAKGYEDAPSEAALQGTAAHALAEHKLRRALKQQSKRPISKFEDDEMDEYTDDYVEFVL 60

Query: 83  MVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAE 142
              A  +  S   L   E  L+     P   GT D LI       ++D KYG GV V+AE
Sbjct: 61  EQYAKAQETSADALIYIEQRLDFSHLVPDGFGTGDCLIIADGTLQVIDLKYGLGVLVEAE 120

Query: 143 NNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKE 202
            N QL LYA GAL  +  ++   E +T+TI QPR      ++ W IS   L E A+    
Sbjct: 121 ANPQLQLYALGALRLFDALYD-IEQVTVTIFQPRRDN---VSTWTISVTKLNEWAE---- 172

Query: 203 RGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEATKD---PSTNTTVE 259
                L   ++ A +          C+FC     C A +   +  A  +   P+  +  E
Sbjct: 173 ---QTLKPAAELAANGGGEFCAGAWCQFCPIAATCRARAEANMKLAKHEFAPPAELSADE 229

Query: 260 LSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV 319
           ++   + I  +  +    +D    +   G+   G++LV GR   R + D     E   + 
Sbjct: 230 VANVLTRIPELTKWASDVQDYALGKALEGEHYAGFKLVAGR-SIRKYADEAAVAEAAKAA 288

Query: 320 LGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKS 379
             ++ +K+ L T   +E+L   +    +F E L +L+ + +GKP + P      + +  S
Sbjct: 289 GYKDIYKQQLLTITAMEKLMGRK----QFAEVLGDLVVKPEGKPTLVPLSDKRPELSMSS 344

Query: 380 QLSEF 384
              +F
Sbjct: 345 AADDF 349


>gi|9633598|ref|NP_051012.1| hypothetical protein APSE-1_51 [Acyrthosiphon pisum bacteriophage
           APSE-1]
 gi|9910950|sp|Q9T1P7|VP51_BPAPS RecName: Full=Putative protein p51
 gi|6118046|gb|AAF03994.1|AF157835_51 P51 [Endosymbiont phage APSE-1]
          Length = 439

 Score =  318 bits (815), Expect = 9e-85,   Method: Composition-based stats.
 Identities = 131/429 (30%), Positives = 205/429 (47%), Gaps = 49/429 (11%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQ-------- 52
           MA HA L+ SS+HRWLKCP +  LE+ +P  TS +A EG+ AH L    L+         
Sbjct: 8   MAEHAKLAPSSAHRWLKCPGSTALEATLPDKTSPFAEEGSAAHALAESILKMRQNPFSDG 67

Query: 53  -----GVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP--FLSETEVPLEP 105
                G D +         + ++  VD EM   V   +  V   +       E  V    
Sbjct: 68  RRRTYGFDVKEYIGTYPLLKANSPQVDEEMIEHVQTYIDTVWQLANGKMLQVEERVDFSA 127

Query: 106 FTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRP 165
                 + GTAD +I +S +  I D KYG GV V A+NN QLMLYA GALHQ+  ++   
Sbjct: 128 VIGVDNSFGTADAIIVSSDELQIHDLKYGKGVKVDAQNNEQLMLYALGALHQFDLVYDF- 186

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLK------SKRAVSLE 219
           + + L I QPR+     ++EW +S +DL +  ++ K     A+ +          A+   
Sbjct: 187 KTVRLFIHQPRLN---HLSEWAVSVEDLKDFGEQAKSGAQKAMKMATLAERSGLDALPDS 243

Query: 220 HYGVNDDSCRFCRAK-VRCPALSRHV------------------LLEATKDPSTNTTVEL 260
            +      C FC+AK   C A ++ V                  L +A K  +  T  ++
Sbjct: 244 AFSPGVKQCLFCKAKGGLCFAQAQFVHNEVKGDFVDLTQPLAPQLSDAPKRITLLTPEKM 303

Query: 261 SKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV- 319
           +K Y  + LI+S+ KA  + + + L+ G  + G++LV G++GNR++ D   A+ LL    
Sbjct: 304 AKLYPHVDLIESFCKALRNRVAEALHTGQSVPGFKLVTGKQGNRTWGDEREAETLLKGAK 363

Query: 320 -LGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQK 378
              E+ + + + +P + E+L K+ K     W +L+ LI R DGKPVIAP   P       
Sbjct: 364 LKQEQIYHKKIISPPQAEKLLKKDK--PHRWAKLEALIERADGKPVIAPESDPRPAI-IT 420

Query: 379 SQLSEFEVL 387
           + L++F+ +
Sbjct: 421 TPLNDFDDV 429


>gi|15837288|ref|NP_297976.1| hypothetical protein XF0686 [Xylella fastidiosa 9a5c]
 gi|9105568|gb|AAF83496.1|AE003912_8 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 425

 Score =  318 bits (815), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 132/409 (32%), Positives = 194/409 (47%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L        S +A EGT AH + A+ L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVPLTRTCKDDASPFADEGTVAHTVAANALRTGSDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            ++      T  V  EMA+SV   + YVR  +G  L E  + +   T E GA GTAD++I
Sbjct: 61  GERHEINGRTWEVTAEMAASVQEYVDYVRAIAGVRLVEQPLHIASITGEQGAKGTADVVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  IVD KYG GV V AE N QL LYA  AL ++G +    + + L I+QPR+   
Sbjct: 121 LAGDALTIVDLKYGKGVKVFAEGNEQLQLYALAALSEFGWVEDF-QQVRLVIVQPRLGHS 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSK----RAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +  ++ +  +  K   T  +           +S E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPEMEDFKQRVKRSATRCMEAIGHYTNVGELSSEYFGPAETPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + +  LI+S+ KA   +
Sbjct: 237 CPALATHVLTTVADDFVDLTQPVAPQLSHAALRTFDNTTLASLFGATELIESWCKAVRAK 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
               L +G+ + GY+LV+GR+G R + D   A++ L  +           L +P   E+L
Sbjct: 297 AAAELRSGNAVPGYKLVQGRQGPRRWVDETAAEDALIQMRIGVAHLHDVSLISPTSAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           ++   + +  W +LQ LI R  G PV+ P          +   ++FE L
Sbjct: 357 HQAGIIGESQWTQLQPLIHRATGAPVVVPTSDQRPPLALQDA-TDFEDL 404


>gi|71901329|ref|ZP_00683425.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71728913|gb|EAO31048.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 426

 Score =  318 bits (814), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 125/409 (30%), Positives = 189/409 (46%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L        S +A EGT AH + A  L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVPLTRTCKDDASPFADEGTVAHTVAADALRTGCDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                       V  EMA+ V   + YVR  +G  L E  + +   T E GA GTAD+++
Sbjct: 61  GACHEVNGHRWEVTAEMAAYVQEYVDYVRAIAGVRLVEQPLRIASITREQGAKGTADVVV 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  IVD KYG GV V AE N QL LYA  AL ++  +    + + L I+QPR+   
Sbjct: 121 LAGDELTIVDLKYGRGVKVFAEGNEQLQLYALAALQEFAGVEAF-QHVRLVIVQPRLGHA 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTL----ALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +   + +  ++  +             +   +  E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPQMEDFRQKVAQGAARCRAAMWHYDNVGELPSEYFGPAETPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + +  LI+S+ K+  D 
Sbjct: 237 CPALATHVLNTVADDFVDLTKPIVPQLSYAALRTFDNTTLACLFGATELIESWCKSIRDR 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
               L +G  + GY++V+GR G R + D+  A+ +L  +    ++ +   L +P   E+L
Sbjct: 297 AAAELLSGQPVPGYKVVQGRHGPRRWADMTAAEAMLKQLRIKFKDMYDVSLISPTRAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           Y+   + D  W +LQ LI R  G PV+ P          +   ++F+ L
Sbjct: 357 YQAGVIGDRQWPKLQPLIHRAAGTPVVVPTSDKRPALPLQDA-TDFQDL 404


>gi|170730327|ref|YP_001775760.1| hypothetical protein Xfasm12_1179 [Xylella fastidiosa M12]
 gi|167965120|gb|ACA12130.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 425

 Score =  318 bits (814), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 125/409 (30%), Positives = 189/409 (46%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L        S +A EGT AH + A  L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVPLTRTCKDDASPFADEGTVAHTVAADALRTGSDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                       V  EMA+ V   + YVR  +G  L E  + +   T E GA GTAD++I
Sbjct: 61  GACHEVNGHRWEVTAEMAAYVQEYVDYVRAIAGVRLVEQPLRIASITGEQGAKGTADMVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  IVD KYG GV V AE N QL LYA  AL ++  +    + + L I+QPR+   
Sbjct: 121 LAGDALTIVDLKYGRGVKVFAEGNEQLQLYALAALQEFAGVEAF-QHVRLVIVQPRLGHA 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTL----ALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +   + +  ++  +             +   +  E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVGTLPQMEDFRQKVAQGAARCRAAMWHYNNVGELPSEYFGPAEKPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + +  LI+S+ KA   +
Sbjct: 237 CPALATHVLNTVADDFVDLTKPIVPQLSHAALRTFDNTTLACLFGATELIESWCKAVRAK 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
               L +G  + GY++V+GR+G R + D+  A+ +L  +    ++ +   L +P   E+L
Sbjct: 297 AAAELLSGQPVPGYKVVQGRQGARRWADMTAAEAMLKQLRIKFKDMYDVSLISPTTAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           ++   + D  W +LQ LI R  G PV+ P          +   ++F+ L
Sbjct: 357 HQAGVIGDRQWPKLQPLIHRAAGTPVVVPTSDKRPPLALQDA-TDFQDL 404


>gi|71901488|ref|ZP_00683575.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71728744|gb|EAO30888.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 426

 Score =  316 bits (809), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 122/409 (29%), Positives = 187/409 (45%), Gaps = 27/409 (6%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M+ HA LS SS+HRWL CP +  L       +S +A EGT AH + A  L  G DA    
Sbjct: 1   MSQHAMLSPSSAHRWLHCPASVPLTRTCKDDSSPFADEGTVAHTVAADALRTGSDASAYV 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                       V  EMA+ V   +  VR  +G  L E  + +   T E GA GTAD++I
Sbjct: 61  GACHEVNGHRWEVTAEMAAYVQEYVDDVRAIAGVRLVEQPLRIASITGEQGAKGTADVVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               + +IVD KYG GV V AE N QL LYA  AL ++  +    + + L I+QPR+   
Sbjct: 121 LAGDELVIVDLKYGKGVKVLAEGNEQLQLYALAALQEFAGVEAF-QHVRLVIVQPRLGHA 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTL----ALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
              +EWV +   + +  ++  +             +   +  E++G  +  CRFC+AK  
Sbjct: 180 ---DEWVRTLPQMEDFRRKVAQGAARCRAAMWHYTNVGELPSEYFGPAETPCRFCKAKAS 236

Query: 237 CPALSRHVLLEATKDPSTNT----------------TVELSKAYSSISLIKSYVKACEDE 280
           CPAL+ HVL     D    T                   L+  + +  LI+S+ K+  D 
Sbjct: 237 CPALATHVLNTVADDFVDLTKPIVPQLSYAALRTFDNTTLACLFGATELIESWCKSIRDR 296

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQL 338
               L +G  + GY++V+GR+G R + D   A++ L  +           L +P   E+L
Sbjct: 297 AAAELLSGQPVPGYKVVQGRQGPRRWVDETAAEDALIQMRIGLSHLHDVSLISPASAEKL 356

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           ++   +  + W +LQ LI R  G P++ P          +   ++F+ L
Sbjct: 357 HQAGVLDLQQWVQLQPLIHRSTGAPIVVPTSDKRPALPLQDA-TDFQDL 404


>gi|227530263|ref|ZP_03960312.1| phage-associated protein [Lactobacillus vaginalis ATCC 49540]
 gi|227349817|gb|EEJ40108.1| phage-associated protein [Lactobacillus vaginalis ATCC 49540]
          Length = 379

 Score =  313 bits (803), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 97/393 (24%), Positives = 164/393 (41%), Gaps = 34/393 (8%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTS-------IYASEGTFAHNLLAHCLEQGVDA 56
           HA LSASS++RWL  P  P LE   P TTS          + G        + + + +  
Sbjct: 7   HALLSASSANRWLSAPPLPRLEQYFPHTTSNAAAEGTAAHALG-------EYKIHRLLGD 59

Query: 57  ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTA 116
                      ++   +  + AS V       + ++       E  L+     P   GT 
Sbjct: 60  RFKRPTSDYQSDEMEDLTDDYASYVLGQYHQAKKYASDATINVEQKLDFSKYVPEGFGTG 119

Query: 117 DILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR 176
           D +I +     I+DFKYG GV V+A+NN Q+ LYA GAL  +G+++   + +  TI QPR
Sbjct: 120 DCVIVSDHLLHIIDFKYGKGVRVEAKNNPQMKLYAVGALEMFGNLYN-IDEVETTIFQPR 178

Query: 177 VRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
           +     I+ W I+A  L+             L  K++ A + +        C+F      
Sbjct: 179 MAN---ISTWTINAQKLMHW-------ANTELKEKAELAFAGKGTVRYGPWCQFSACNAV 228

Query: 237 CPAL--SRHVLLEAT-KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEIQ 292
             A     H L     + P+  T  E+ +    I  +  +    +D      +N G +  
Sbjct: 229 LRARFDYHHKLTRFQLRSPNLLTDAEVIEVLKHIDDLNRWAHEVKDYAANLAINHGKQWP 288

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEEL 352
           G+++VEGR   R +KD N   ++  +    + ++R L    +LE+   ++K ++ F +E 
Sbjct: 289 GFKIVEGR-STRRYKDENAVAKIAEANGIHDIYQRKLLPITKLEKQLGKKKFTELFSQE- 346

Query: 353 QELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
              I +  GKP + P         + +   EF+
Sbjct: 347 ---IVKPAGKPTLVPNSDRRQSIGKSNPQDEFK 376


>gi|257432435|ref|ZP_05608798.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257283314|gb|EEV13446.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
          Length = 388

 Score =  311 bits (798), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 155/397 (39%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDNDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA   +  ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELFSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEQYALDQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRVITDTKATLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|227544277|ref|ZP_03974326.1| phage-associated protein [Lactobacillus reuteri CF48-3A]
 gi|300909466|ref|ZP_07126927.1| phage protein [Lactobacillus reuteri SD2112]
 gi|227185737|gb|EEI65808.1| phage-associated protein [Lactobacillus reuteri CF48-3A]
 gi|300893331|gb|EFK86690.1| phage protein [Lactobacillus reuteri SD2112]
          Length = 379

 Score =  311 bits (798), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 97/394 (24%), Positives = 163/394 (41%), Gaps = 34/394 (8%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTS-------IYASEGTFAHNLLAHCLEQGVD 55
           HHA LSASS++RWL  P  P LE   P +TS          + G        + + + + 
Sbjct: 6   HHALLSASSANRWLSAPPLPRLEQYFPHSTSSAAAEGTAAHALG-------EYKIHRLLG 58

Query: 56  AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGT 115
            +          ++   +  + AS V       + ++       E  L+     P   GT
Sbjct: 59  DKFKRPTSDYQSDEMENLTDDYASYVLEQYHKAKEYAPDATIRVEQKLDFSKYVPEGFGT 118

Query: 116 ADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
            D +I +     I+DFKYG GV V+A+NN Q+ LYA GAL  +G ++   E +  TI QP
Sbjct: 119 GDCVIVSDHLLHIIDFKYGKGVRVEAQNNPQMKLYAVGALEMFGSLYNVDE-VETTIFQP 177

Query: 176 RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV 235
           R+     I+ W I+A +L+             L  K++ A + +        C+F     
Sbjct: 178 RMAN---ISTWTINAKELMHW-------ANSELKEKAELAFAGKGTVHYGPWCQFSACNA 227

Query: 236 RCPAL--SRHVLLEAT-KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEI 291
              A     H L     + P+  T  E+++    I  +  +    +D      +N G + 
Sbjct: 228 VLRARFDYHHKLTRFQLRSPNLLTDSEVTEVLEHIDDLNRWAHEIKDYAADLAINHGKQW 287

Query: 292 QGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEE 351
            GY++VEGR   R +KD     ++  +      +++ L    +LE+   ++K    F E 
Sbjct: 288 PGYKIVEGR-SVRHYKDEAAVAKIAEANGYHNIYQKKLLPITKLEKQLGKKK----FAEL 342

Query: 352 LQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
             + I +  GKP + P         + +   EF+
Sbjct: 343 FSQEIVKPAGKPTLVPNSDRRQSIGKSNPQDEFK 376


>gi|284024532|ref|ZP_06378930.1| hypothetical protein Saura13_08075 [Staphylococcus aureus subsp.
           aureus 132]
          Length = 388

 Score =  311 bits (797), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 154/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDNDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEQYALNQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKAMLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|258445213|ref|ZP_05693408.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|257855974|gb|EEV78894.1| conserved hypothetical protein [Staphylococcus aureus A6300]
          Length = 388

 Score =  311 bits (796), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 94/397 (23%), Positives = 153/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A +          CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGGGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
              C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 NHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEQYALNQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D N   E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTNATLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 IAEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|282919247|ref|ZP_06326982.1| hypothetical protein SASG_00553 [Staphylococcus aureus subsp.
           aureus C427]
 gi|282317057|gb|EFB47431.1| hypothetical protein SASG_00553 [Staphylococcus aureus subsp.
           aureus C427]
          Length = 388

 Score =  310 bits (795), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 94/397 (23%), Positives = 153/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
              C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 NHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEQYALNQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKAMLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|297585233|ref|YP_003701013.1| hypothetical protein Bsel_2962 [Bacillus selenitireducens MLS10]
 gi|297143690|gb|ADI00448.1| conserved hypothetical protein [Bacillus selenitireducens MLS10]
          Length = 432

 Score =  310 bits (795), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 101/403 (25%), Positives = 172/403 (42%), Gaps = 33/403 (8%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDA--ETVS 60
            HA LS S +  W+ CP +  L  +I  TTS YA  GTF H L    LE+ + +  E   
Sbjct: 7   AHAKLSTSGASWWMNCPPSVKLSEQIEDTTSFYAEVGTFMHELSELYLERFLGSITEEQY 66

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPGAT 113
            ++     ++      +  +V   +  V       R      L   E  ++     P   
Sbjct: 67  MKEKKERRESPFYTQAIDDAVQAYVDTVIERINEARALQSDALVRIEERVDFSPWVPEGF 126

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D+LI       I+D K G GV V AE N Q+ LYA GAL+ YG ++   + + +TI+
Sbjct: 127 GTGDVLIVTDGLLEIIDLKGGEGVKVYAEGNPQMRLYALGALNGYGFLYH-IDTVQMTIV 185

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+     ++   ++A+ LL  A+         +  K++ A +     +    C+FC+ 
Sbjct: 186 QPRLD---HLSTDEMTAEALLNWAET-------EVKPKAELAFNGLGEFLPGAHCQFCKV 235

Query: 234 KVRCPALSRHVLLEA---TKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGD 289
              C A +      A    K+P   T  E+S+    +  + ++ K  ++   K  +    
Sbjct: 236 SATCRARAEERQKLACLDFKEPPLLTDEEVSQVLREVDELVNWAKQVQEYALKTAMKENK 295

Query: 290 EIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSDE 347
           +  G +LV+GR G+R + D       L     EE   FK+ LK    +E++  ++     
Sbjct: 296 QWPGMKLVQGR-GSRVYTDEKAIISTLKEAGMEEHQLFKQTLKPITNMEKMLGKKT---- 350

Query: 348 FWEELQELITRGDGKPVIAPRDIPTNK--QTQKSQLSEFEVLG 388
           F + +  LIT+  GK  +   +        + ++   +  V G
Sbjct: 351 FQDLVGHLITKTPGKLKLVETEDGRPAAKTSARTDYVKRRVAG 393


>gi|258455587|ref|ZP_05703544.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|257862275|gb|EEV85046.1| conserved hypothetical protein [Staphylococcus aureus A5937]
          Length = 388

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 92/397 (23%), Positives = 150/397 (37%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + G   +   ++ A +          CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGADFVKPLARLAYNGGGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
              C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 NHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEQYALNQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKAMLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A            S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-SSAEDDFDEL 388


>gi|66395460|ref|YP_239829.1| ORF010 [Staphylococcus phage 2638A]
 gi|62635887|gb|AAX90998.1| ORF010 [Staphylococcus phage 2638A]
          Length = 388

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 96/397 (24%), Positives = 157/397 (39%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   TS +A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGISDKTSTFAEEGTFAHELSELYFSHMYEGLTEFEF 68

Query: 62  --------QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT 113
                   +   +  + R         V  ++   +      ++  E  L+  T  P + 
Sbjct: 69  NKAYANYQRNEYYSEELREYVEHYVDMVEELVNDAKARDKDVITMFETRLDLGTYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++++      I+D KYG GV V A NN QL LY  GA      +      + +TII
Sbjct: 129 GTGDVIVYAGGVLEIIDLKYGKGVEVSAINNPQLRLYGLGAYELLSVLED-IHTIKMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L   AK     G   +  K+K A + +      + CRFC+ 
Sbjct: 188 QPRLDN--------YSTEELE--AKSLINWGLEYVKPKAKLAYNGDGEFKAGEHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGDEIQ 292
           K  C A ++++L    K     +  E+++    +   K +    E    +++        
Sbjct: 238 KHSCRARAQYMLDIPNKPAHLLSDNEIAELLYKVPDFKKWADELESYALEQMTEHDKNYD 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D    ++ L       E   +  L +   LE+   ++     F E
Sbjct: 298 GWKLVEGR-SKRVMTDTEAVKDKLIENGFKLENITETKLLSITNLEKKIGKKA----FNE 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
            + E I +  GK  +A           +S   +F+ +
Sbjct: 353 IVGEFIFKPQGKLTLAKESDKRPAIK-QSAEEDFDQI 388


>gi|262049892|ref|ZP_06022754.1| hypothetical protein SAD30_0348 [Staphylococcus aureus D30]
 gi|259162041|gb|EEW46621.1| hypothetical protein SAD30_0348 [Staphylococcus aureus D30]
          Length = 388

 Score =  310 bits (794), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 96/397 (24%), Positives = 155/397 (39%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEKYALDQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D N   E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTNATLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 IAEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|227544662|ref|ZP_03974711.1| phage protein [Lactobacillus reuteri CF48-3A]
 gi|300909421|ref|ZP_07126882.1| phage protein [Lactobacillus reuteri SD2112]
 gi|227185387|gb|EEI65458.1| phage protein [Lactobacillus reuteri CF48-3A]
 gi|300893286|gb|EFK86645.1| phage protein [Lactobacillus reuteri SD2112]
          Length = 378

 Score =  310 bits (793), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 97/395 (24%), Positives = 163/395 (41%), Gaps = 34/395 (8%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSI-------YASEGTFAHNLLAHCLEQGV 54
            HHA LSASS++RWL  P  P LE   P +TS          + G        + + + +
Sbjct: 5   THHALLSASSANRWLSAPPLPRLEQYFPHSTSEAAAEGTAAHALG-------EYKIHRLL 57

Query: 55  DAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATG 114
             +          ++   +  + AS V       + ++       E  L+     P   G
Sbjct: 58  GDQFKRPTSDYQSDEMESLTDDYASYVIEQYTQAKQYAADANISVEQKLDFSKYVPQGFG 117

Query: 115 TADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQ 174
           T D +I +     I+DFKYG GV V+A+NN Q+ LYA GAL  +G ++   + +  TI Q
Sbjct: 118 TGDCVIVSDHLLHIIDFKYGKGVRVEAKNNPQMKLYAIGALEMFGSLYN-IDEVEATIFQ 176

Query: 175 PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
           PR+     I+ W I+A +L+             L  K++ A + +        C+F    
Sbjct: 177 PRMAN---ISTWTINAKELMHW-------ANTELKEKAELAFAGQGTVRYGPWCQFSACN 226

Query: 235 VRCPAL--SRHVLLEAT-KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDE 290
               A     H L     + PS  T  E+++    I  +  +    +D      +N G  
Sbjct: 227 AVLRARYNYHHKLTRFQLRSPSLLTDSEVAEVLEHIDDLNRWAHEVKDYAADLAINHGKR 286

Query: 291 IQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWE 350
             GY++VEGR   R +KD     ++  +      +++ L    +LE+   ++K    F E
Sbjct: 287 WPGYKIVEGR-SIRRYKDEKAVAKIAETNGIHNIYQQKLLPITKLEKQLGKKK----FAE 341

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
              + I +  GKP++ P         + +   EF+
Sbjct: 342 LFSQEIVKPAGKPILVPNSDRRQSIGKSNPKDEFK 376


>gi|283469576|emb|CAQ48787.1| conserved phage-associated protein [Staphylococcus aureus subsp.
           aureus ST398]
          Length = 388

 Score =  310 bits (793), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 155/397 (39%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      I+     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLIYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEHYALDQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D    ++ L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKAVRDRLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 IAEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|148267471|ref|YP_001246414.1| hypothetical protein SaurJH9_1037 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150393524|ref|YP_001316199.1| hypothetical protein SaurJH1_1056 [Staphylococcus aureus subsp.
           aureus JH1]
 gi|147740540|gb|ABQ48838.1| hypothetical protein SaurJH9_1037 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149945976|gb|ABR51912.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           JH1]
          Length = 388

 Score =  310 bits (793), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 155/397 (39%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDNDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLN-AGDEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEHYALDQAKGNDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +  +LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKATLEKLVEAGYKPEDITETKLLSITKLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|282926445|ref|ZP_06334077.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|282591774|gb|EFB96845.1| conserved hypothetical protein [Staphylococcus aureus A10102]
          Length = 388

 Score =  310 bits (793), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 94/397 (23%), Positives = 154/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDNDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        +  T  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWVTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEHYALDQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +  +LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKATLEKLVEAGYKPEDITETKLLSITKLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|253317128|ref|ZP_04840341.1| hypothetical protein SauraC_13554 [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|258428685|ref|ZP_05688219.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|282905880|ref|ZP_06313735.1| gp15 [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282911109|ref|ZP_06318911.1| gp15 [Staphylococcus aureus subsp. aureus WBG10049]
 gi|297207803|ref|ZP_06924237.1| phage protein [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|257849740|gb|EEV73704.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|282324804|gb|EFB55114.1| gp15 [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282331172|gb|EFB60686.1| gp15 [Staphylococcus aureus subsp. aureus Btn1260]
 gi|296887519|gb|EFH26418.1| phage protein [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|312438061|gb|ADQ77132.1| phage protein [Staphylococcus aureus subsp. aureus TCH60]
          Length = 388

 Score =  310 bits (793), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 155/397 (39%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLN-AGDEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEHYALDQAKGNDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +  +LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKATLEKLVEAGYKPEDITETKLLSITKLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|266623809|ref|ZP_06116744.1| phage protein [Clostridium hathewayi DSM 13479]
 gi|288864381|gb|EFC96679.1| phage protein [Clostridium hathewayi DSM 13479]
          Length = 399

 Score =  310 bits (793), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 107/412 (25%), Positives = 171/412 (41%), Gaps = 41/412 (9%)

Query: 1   MAH----HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD- 55
           M H    HA LSAS +HRWL C  +  LE   P TTS  A+EGT AH L    +      
Sbjct: 1   MGHAERDHALLSASGAHRWLYCTPSARLEEGFPDTTSEAAAEGTLAHELAELKVRNYFHG 60

Query: 56  ---AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS----GPFLSETEVPLEPFTT 108
               +      +       +   EM       L Y++  +          TE  ++    
Sbjct: 61  VEFGKKKLTAAINKLKKKELWQEEMMGYTDEYLDYIKGVALAMKNQPYVATEKRVDFSAY 120

Query: 109 EPGATGTADILIFNSTQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
            P   GTAD ++       I+DFKYG      V+AE N QL LYA GA   Y  ++   E
Sbjct: 121 VPDGFGTADCILICGNVLHIIDFKYGKNPNGRVEAEGNPQLALYALGAYEMYKILYP-IE 179

Query: 167 ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
            + ++I+QPR+  G  I+EW    ++LL   +  K R  LA+            Y  + +
Sbjct: 180 IIRMSIVQPRLSDG--ISEWECPLEELLSWGQYVKGRAELAIK-------GEGDYFPSPE 230

Query: 227 SCRFCRAKVRCPALSRHVLLEATKD-----PSTNTTVELSKAYSSISLIKSYVKACEDEM 281
           +C++CRA+ +C A +   +  A  +     P   +  E          +  +++A +D  
Sbjct: 231 TCKYCRARGQCRARADENVKLAFSEDLGKLPPLISNAEAGDYLRKGVDVAKWLEALKDYA 290

Query: 282 FKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE---AFKRILKTPKELEQL 338
            K   AG E+ G++ V GR G R + D+++A E L      E    ++R   +  ++E  
Sbjct: 291 LKECLAGKEVPGWKAVSGR-GGRDWTDMDKAFETLVKSGVAEEAVLWERKPLSLAQVETT 349

Query: 339 YKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNK----QTQKSQLSEFEV 386
             ++    +F + + E +    GKP +              T      E +V
Sbjct: 350 VGKK----DFADAVGEYVVWKPGKPALVEASDKRPAITNKLTAAEAFKEEKV 397


>gi|329730598|gb|EGG66983.1| hypothetical protein SA21193_1535 [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 388

 Score =  309 bits (792), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 154/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDNDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEHYALDQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRVITDTKATLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|116630094|ref|YP_815266.1| hypothetical protein LGAS_1471 [Lactobacillus gasseri ATCC 33323]
 gi|238854129|ref|ZP_04644476.1| conserved phage-associated protein [Lactobacillus gasseri 202-4]
 gi|116095676|gb|ABJ60828.1| hypothetical protein LGAS_1471 [Lactobacillus gasseri ATCC 33323]
 gi|238833205|gb|EEQ25495.1| conserved phage-associated protein [Lactobacillus gasseri 202-4]
          Length = 379

 Score =  309 bits (792), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 95/394 (24%), Positives = 163/394 (41%), Gaps = 34/394 (8%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTS-------IYASEGTFAHNLLAHCLEQGVD 55
           HHA LSASS++RWL  P  P LE   P +TS          + G        + + + + 
Sbjct: 6   HHALLSASSANRWLSAPPLPRLEQYFPHSTSNAAAEGTAAHALG-------EYKIHRLLG 58

Query: 56  AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGT 115
            +          ++   +  + AS V       + ++       E  L+     P   GT
Sbjct: 59  DKFKRPSSDYQSDEMESLTDDYASYVMEQYEQAKEYAPDATIRVEQKLDFSQYVPEGFGT 118

Query: 116 ADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
            D +I +     I+DFKYG GV V+A+NN Q+ LYA GAL  +G+++   E + + I QP
Sbjct: 119 GDCVIASDHLLHIIDFKYGKGVRVEAKNNPQMKLYAIGALEMFGNLYNVDE-IKIIIFQP 177

Query: 176 RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV 235
           R+     I+ W I A  L+             L  K++ A + +        C+F     
Sbjct: 178 RMAN---ISTWRIDAKQLMHW-------ANTELKQKAELAFAGKGTIRYGPWCQFSACNA 227

Query: 236 RCPAL--SRHVLLEAT-KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEI 291
              A     H L       P+  T  E+++    I  +  +    +D      +N G + 
Sbjct: 228 VLRARYDYHHKLTRFQLCSPNLLTDKEVTEVLEHIDDLNRWAHEVKDYAADLAINHGKQW 287

Query: 292 QGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEE 351
            GY++VEGR   R +K+     ++  +      +++ L    +LE+   ++K ++ F +E
Sbjct: 288 PGYKIVEGR-SVRHYKNEAAVAKIAEANGYHNIYQKKLLPITKLEKQLGKKKFTELFSQE 346

Query: 352 LQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
               I +  GKP + P         + +   EF+
Sbjct: 347 ----IVKPAGKPTLVPNSDRRQGIGKSNPKDEFK 376


>gi|21283156|ref|NP_646244.1| hypothetical protein MW1427 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|87160012|ref|YP_494122.1| hypothetical protein SAUSA300_1425 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|161509704|ref|YP_001575363.1| hypothetical protein USA300HOU_1475 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|294848503|ref|ZP_06789249.1| hypothetical protein SKAG_00567 [Staphylococcus aureus A9754]
 gi|300911888|ref|ZP_07129331.1| hypothetical protein HMPREF0773_11540 [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|21204596|dbj|BAB95292.1| hypothetical protein [Staphylococcus aureus subsp. aureus MW2]
 gi|87125986|gb|ABD20500.1| conserved hypothetical phage protein [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|160368513|gb|ABX29484.1| hypothetical bacteriophage protein [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|294824529|gb|EFG40952.1| hypothetical protein SKAG_00567 [Staphylococcus aureus A9754]
 gi|300886134|gb|EFK81336.1| hypothetical protein HMPREF0773_11540 [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|302333143|gb|ADL23336.1| putative phage protein [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|315197710|gb|EFU28044.1| hypothetical bacteriophage protein [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320140646|gb|EFW32500.1| hypothetical protein HMPREF9528_01270 [Staphylococcus aureus subsp.
           aureus MRSA131]
 gi|320142782|gb|EFW34585.1| hypothetical protein HMPREF9529_01882 [Staphylococcus aureus subsp.
           aureus MRSA177]
          Length = 388

 Score =  309 bits (792), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 91/397 (22%), Positives = 151/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   ++++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSTVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDNDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTIRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + G   +   ++ A +          CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGADFVKPLARLAYNGGGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
              C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 NHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEQYALNQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKAMLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|327461122|gb|EGF07455.1| phage protein [Streptococcus sanguinis SK1057]
          Length = 380

 Score =  309 bits (792), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 101/386 (26%), Positives = 158/386 (40%), Gaps = 23/386 (5%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            HA LSASSSHRWL  P    LE      T+  A EGT AH L  + L+  +  E    +
Sbjct: 11  QHALLSASSSHRWLTVPPLARLEEFFEHKTNPAAEEGTLAHALAEYKLKSALRIEAEEPE 70

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
                 +      +  + +      ++  +   +   E  ++     P   GTAD +I  
Sbjct: 71  GELT-LEMEQATEDYVAFIIDEFEQLKQGTSDPIVLIEQKVDFSRYVPEGFGTADCVIVV 129

Query: 123 STQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSP 182
            +   +VDFKYG GV V+AENN Q+ LYA GAL  Y  ++   E + +TI QPR      
Sbjct: 130 DSTLHVVDFKYGKGVLVEAENNPQMKLYALGALEFYDALYD-IEEVKMTIFQPRKGN--- 185

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSR 242
           I+  ++  +DLLE A+         L  K++ A   E        C+F        A   
Sbjct: 186 ISTAILQREDLLEWAET-------ELKPKAELAFKGEGEVTYGPWCQFSPCNAVLRARMD 238

Query: 243 HVLLEAT---KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEIQGYQLVE 298
           +           P   T  E+ +    +  +  +    +D   K  +N+     G++LVE
Sbjct: 239 YHKELEQFQLASPHLLTDGEIEEILLHVDDLVKWATEVKDYATKVAINSHKSWNGFKLVE 298

Query: 299 GRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITR 358
           GR   R F + +   +L  +      +K+ L +  ELE+   ++    EF   L  L+ +
Sbjct: 299 GR-SIRQFTNEDEVAKLAEAEGFTNIYKQSLVSLTELEKRMGKK----EFNRVLGHLVRK 353

Query: 359 GDGKPVIAPRDIPTNKQTQKSQLSEF 384
             GK  + P              +EF
Sbjct: 354 PQGKLTLVPESDKRK--EYIPAAAEF 377


>gi|49485812|ref|YP_043033.1| hypothetical protein SAS0907 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|49244255|emb|CAG42682.1| hypothetical phage protein [Staphylococcus aureus subsp. aureus
           MSSA476]
          Length = 388

 Score =  309 bits (792), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 154/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEQYALDQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKATLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIKKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|282928295|ref|ZP_06335899.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282591966|gb|EFB96999.1| conserved hypothetical protein [Staphylococcus aureus A9765]
          Length = 388

 Score =  309 bits (792), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 91/397 (22%), Positives = 151/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   ++++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSTVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDNDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTIRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + G   +   ++ A +          CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGADFVKPLARLAYNGGGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
              C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 NHSCRTRAEYMQNVPQKPPYLLSDEEIAELLYKLPDIKKWADEVEQYALNQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKAMLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|209363569|ref|YP_002267987.1| hypothetical protein phi2958PVL_gp17 [Staphylococcus phage
           phi2958PVL]
 gi|257428255|ref|ZP_05604653.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|258419944|ref|ZP_05682903.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|258448863|ref|ZP_05696973.1| conserved hypothetical protein [Staphylococcus aureus A6224]
 gi|295407653|ref|ZP_06817442.1| hypothetical protein SMAG_02823 [Staphylococcus aureus A8819]
 gi|297246754|ref|ZP_06930569.1| hypothetical protein SLAG_02805 [Staphylococcus aureus A8796]
 gi|208973070|dbj|BAG74386.1| hypothetical protein [Staphylococcus phage phi2958PVL]
 gi|257275096|gb|EEV06583.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257844069|gb|EEV68459.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|257857900|gb|EEV80791.1| conserved hypothetical protein [Staphylococcus aureus A6224]
 gi|294967467|gb|EFG43507.1| hypothetical protein SMAG_02823 [Staphylococcus aureus A8819]
 gi|297176380|gb|EFH35653.1| hypothetical protein SLAG_02805 [Staphylococcus aureus A8796]
          Length = 388

 Score =  309 bits (791), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 154/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEHYALDQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKAMLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|293400010|ref|ZP_06644156.1| phage protein [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306410|gb|EFE47653.1| phage protein [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 392

 Score =  309 bits (791), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 102/389 (26%), Positives = 168/389 (43%), Gaps = 26/389 (6%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQT-TSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           HAFLS SS+ +WL C  +  LE   P+   S  A EGT AH++    L + ++     ++
Sbjct: 15  HAFLSPSSAKQWLSCTPSVKLEQNFPEKRESEAAKEGTLAHSIAEQKLNKWIN--RKRNK 72

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
            +  + D           V  V   V+      + + E  L+         GTAD +I  
Sbjct: 73  IVCEDKDMDTYTDGYRDYVIEVYNRVKKDCTDPVFKIEQKLDLKEWIKEDGGTADAIIIG 132

Query: 123 STQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSP 182
                I+D KYG GV V A+NN Q+ LYA GA+ +Y  ++     + + I QPRV  G  
Sbjct: 133 DGSLHIIDLKYGKGVAVSAKNNPQIRLYALGAIREYQLLYD-LTKVHMHIYQPRVSDG-- 189

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND-DSCRFCRAKVRCPALS 241
           I+E V+  DDL+   +E        +   +++A           ++CR+CRAK  C A +
Sbjct: 190 ISEEVMQVDDLINWGEEV-------VKPAAEQAFEGVGEYRPSEETCRWCRAKGACKARA 242

Query: 242 RHVLLE---ATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVE 298
            +          DP      E+SK  + +  +  +    ++     +  G +I G+++VE
Sbjct: 243 EYNEHLRRYGFMDPDLLNNEEISKILAGVDELIRWATDVKEYALDAMLKGAQIPGFKVVE 302

Query: 299 GRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           GR   R   D       +     EE   +++ L +  +LE+L  ++    +F       I
Sbjct: 303 GR-SLRKVTDEKLLVNNMKDAGYEEALLYEKKLHSITKLEKLAGKK----DFAIISAGCI 357

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
            +  G P IAP           S +S+F+
Sbjct: 358 EKPKGSPAIAPMSDKRP--EYNSGVSDFQ 384


>gi|156603968|ref|YP_001429914.1| hypothetical protein SPTP3102_gp19 [Staphylococcus phage tp310-2]
 gi|154818054|gb|ABS87481.1| hypothetical protein [Staphylococcus phage tp310-2]
          Length = 388

 Score =  308 bits (790), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 155/397 (39%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEHYALDQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +  +LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKATLEKLVEAGYKPEDITETKLLSITKLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|256847834|ref|ZP_05553279.1| conserved hypothetical protein [Lactobacillus coleohominis
           101-4-CHN]
 gi|256715523|gb|EEU30499.1| conserved hypothetical protein [Lactobacillus coleohominis
           101-4-CHN]
          Length = 379

 Score =  308 bits (790), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 97/395 (24%), Positives = 165/395 (41%), Gaps = 34/395 (8%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTS-------IYASEGTFAHNLLAHCLEQGV 54
            HHA LSASS+HRWL  P  P LE   P +TS          + G        + + + +
Sbjct: 5   THHALLSASSAHRWLSAPPLPRLEQYFPHSTSSAAAEGTAAHALG-------EYKIHRLL 57

Query: 55  DAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATG 114
             +          ++   +  + AS V       + F+       E  L+     P   G
Sbjct: 58  GDKFKRPVSDYQSDEMESLTDDYASYVIEQYNQAKEFAPDATIRVEQKLDFSKYVPEGFG 117

Query: 115 TADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQ 174
           T D +I +     I+DFKYG GV V+A+NN Q+ LY+ GAL  +G ++   E +  TI Q
Sbjct: 118 TGDCVIVSDHLLHIIDFKYGKGVRVEAQNNPQMKLYSVGALEMFGSLYNVDE-VETTIFQ 176

Query: 175 PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
           PR+     I+ W I+A +L+             L  K++ A + +        C+F    
Sbjct: 177 PRMAN---ISTWTINAKELMHW-------ANSELKEKAELAFAGKGTVHYGPWCQFSACN 226

Query: 235 VRCPAL--SRHVLLEAT-KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDE 290
               A     H L     + P+  T  ++++    I  +  +    +D      +N G +
Sbjct: 227 AVLRARFDYHHKLTRFQLRSPNLLTDSQVTEVLEHIDDLNRWAHEIKDYAADLAINHGKQ 286

Query: 291 IQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWE 350
             GY++VEGR   R +KD     ++       + +++ L    +LE+   ++K ++ F +
Sbjct: 287 WPGYKIVEGR-SVRHYKDEAAVAKIAEEHGYHDIYQKKLLPITKLEKQVGKKKFTELFSQ 345

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           E    I +  GKP + P         + +   EF+
Sbjct: 346 E----IVKPAGKPTLVPDSDSRQSIGKSNPKDEFK 376


>gi|325687768|gb|EGD29789.1| phage protein [Streptococcus sanguinis SK72]
          Length = 380

 Score =  308 bits (790), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 102/388 (26%), Positives = 160/388 (41%), Gaps = 27/388 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAETVS 60
            HA LSASSSHRWL  P    LE      T+  A EGT AH L  + L+  +  +AE   
Sbjct: 11  QHALLSASSSHRWLTVPPLARLEEFFEHKTNPAAEEGTLAHALAEYKLKSALWIEAEEPE 70

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            +      +      +  + +      ++  +   +   E  ++     P   GTAD +I
Sbjct: 71  GELTL---EMEQATEDYVAFIIDEFEQLKQGTSDPIVLIEQKVDFSRYVPEGFGTADCVI 127

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
              +   +VDFKYG GV V+AENN Q+ LYA GAL  Y  ++   E + +TI QPR    
Sbjct: 128 VVDSTLHVVDFKYGKGVLVEAENNPQMKLYALGALEFYDALYD-IEEVKMTIFQPRKGN- 185

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             I+  ++  +DLLE A+         L  K++ A   E        C+F        A 
Sbjct: 186 --ISTAILQREDLLEWAET-------ELKPKAELAFKGEGEVTYGPWCQFSPCNAVLRAR 236

Query: 241 SRHVLLEAT---KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEIQGYQL 296
             +           P   T  E+ +    +  +  +    +D   K  +N+     G++L
Sbjct: 237 MDYHKELEQFQLASPHLLTDGEIEEILLHVDDLVKWATEVKDYATKVAINSHKSWNGFKL 296

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           VEGR   R F + +   +L  +      +K+ L +  ELE+   ++    EF   L  L+
Sbjct: 297 VEGR-SIRQFTNEDEVAKLAEAEGFTNIYKQSLVSLTELEKRMGKK----EFNRVLGHLV 351

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
            +  GK  + P              +EF
Sbjct: 352 RKPQGKLTLVPESDKRK--EYIPAAAEF 377


>gi|323440321|gb|EGA98035.1| hypothetical protein SAO11_1058 [Staphylococcus aureus O11]
          Length = 388

 Score =  308 bits (790), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 155/397 (39%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   ++++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSTVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDNDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      I+     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLIYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E      + CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLVQWGTDFVKPLARLAYNGEGEFKAGNHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E    ++         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEQYALEQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKATLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
                I +  GK  +A           +S   +F+ L
Sbjct: 353 ITDGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|283470755|emb|CAQ49966.1| conserved phage-associated protein [Staphylococcus aureus subsp.
           aureus ST398]
          Length = 388

 Score =  308 bits (790), Expect = 8e-82,   Method: Composition-based stats.
 Identities = 94/397 (23%), Positives = 155/397 (39%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      I+     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLIYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E    ++         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEKYALEQAKENDKTYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LV GR   R   D    ++ L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVTGR-SRRVITDTKAVRDRLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 IAEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|49483721|ref|YP_040945.1| hypothetical protein SAR1543 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|295428043|ref|ZP_06820675.1| hypothetical protein SIAG_00571 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|297590988|ref|ZP_06949626.1| phage protein [Staphylococcus aureus subsp. aureus MN8]
 gi|49241850|emb|CAG40542.1| hypothetical phage protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|295128401|gb|EFG58035.1| hypothetical protein SIAG_00571 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|297575874|gb|EFH94590.1| phage protein [Staphylococcus aureus subsp. aureus MN8]
          Length = 388

 Score =  308 bits (790), Expect = 8e-82,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 154/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQDVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEHYALDQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKAMLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|315128372|gb|EFT84383.1| hypothetical protein CGSSa03_07341 [Staphylococcus aureus subsp.
           aureus CGS03]
          Length = 388

 Score =  308 bits (789), Expect = 8e-82,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 153/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTIRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEQYALDQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRVITDTKATLEKLVEEGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A            S   +F+ L
Sbjct: 353 IAEGFIEKPQGKLTLATESDKRPAIK-SSAEDDFDKL 388


>gi|29028627|ref|NP_803316.1| phi APSE P51-like protein [Staphylococcus phage phi 12]
 gi|66395668|ref|YP_240048.1| ORF012 [Staphylococcus phage 47]
 gi|88195278|ref|YP_500081.1| phi APSE P51-like protein [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|18920551|gb|AAL82291.1| phi APSE P51-like protein [Staphylococcus phage phi 12]
 gi|62636092|gb|AAX91203.1| ORF012 [Staphylococcus phage 47]
 gi|87202836|gb|ABD30646.1| phi APSE P51-like protein [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|329724425|gb|EGG60935.1| hypothetical protein SA21189_1602 [Staphylococcus aureus subsp.
           aureus 21189]
          Length = 388

 Score =  308 bits (789), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 93/397 (23%), Positives = 155/397 (39%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLVYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E    ++         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEKYALEQAKENDKTYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LV GR   R   D    ++ L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVTGR-SRRVITDTKAVRDRLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 IAEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|66395600|ref|YP_239979.1| ORF012 [Staphylococcus phage 3A]
 gi|62635946|gb|AAX91057.1| ORF012 [Staphylococcus phage 3A]
          Length = 388

 Score =  308 bits (788), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 96/397 (24%), Positives = 155/397 (39%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEKYALDQAKENDKNYS 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D N   E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTNATLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 IAEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|304406769|ref|ZP_07388424.1| conserved hypothetical protein [Paenibacillus curdlanolyticus YK9]
 gi|304344302|gb|EFM10141.1| conserved hypothetical protein [Paenibacillus curdlanolyticus YK9]
          Length = 395

 Score =  308 bits (788), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 103/396 (26%), Positives = 177/396 (44%), Gaps = 33/396 (8%)

Query: 1   MAH-------HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQG 53
           M+        HA LSAS +HRWL C  +  LE+ +P TTS  AS GT AH L    L + 
Sbjct: 1   MSQIVHAERAHALLSASGAHRWLHCTPSARLEATLPDTTSEAASRGTLAHELAELKLRRA 60

Query: 54  VDAETVS----HQKLTFENDTRIVDTEMASSVSMVLAYVR----TFSGPFLSETEVPLEP 105
           +  E ++       +       + + +M ++    + +++    +F  P     E  ++ 
Sbjct: 61  LGLEQMTGQKYAAAVRKFKANELYEPDMDANTDAYVDFIQGIVHSFQTPPYIAVERRVDI 120

Query: 106 FTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRP 165
               P A GT+D +I    Q  I+D+K G GVPV A+ N Q+MLYA GAL  Y  ++   
Sbjct: 121 SAYVPEAFGTSDCIIIGGKQLYIIDYKNGQGVPVPAQENPQMMLYALGALQAYSLLYA-I 179

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
           E + + I+QP+V      +EW ++A +LL   +             + RA + E      
Sbjct: 180 ETVHVAIVQPKVWDEP--SEWSLTAAELLAWGESI--------KPIAARAFAGEGEYAPG 229

Query: 226 DSCRFCRAKVRCPALSRHVLL---EATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMF 282
           + C FCRA+  C A    +L    +A+  P      E++        +  +  + ++   
Sbjct: 230 EHCGFCRARSTCRARVEGLLSIEDKASLKPPMIGWDEVADILRRGDGLVKWYSSLKEAAL 289

Query: 283 KRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGE--EAFKRILKTPKELEQLYK 340
             +  G ++ G++ VEGR G+R F DI+ A   +     +    ++R   T    E+L+ 
Sbjct: 290 AEVLKGGDVPGWKAVEGR-GSRQFADIDAAFIHMERYGIDGALLYERKPITAAAAEKLFD 348

Query: 341 EQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQT 376
            +K+  +  E+    + +  G P +AP +       
Sbjct: 349 SKKMYKQVLEDTGH-VVKQSGAPTLAPAEDLRPSIN 383


>gi|325690423|gb|EGD32426.1| phage protein [Streptococcus sanguinis SK115]
          Length = 380

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 100/388 (25%), Positives = 159/388 (40%), Gaps = 27/388 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV--DAETVS 60
            HA LSASSSHRWL  P    LE    Q TS  A EGT AH L  + L   +   AE   
Sbjct: 11  QHALLSASSSHRWLTVPPLARLEEFFEQRTSSAAEEGTLAHALAEYKLRMALGVKAEEPE 70

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            +      +      +  + +   L  ++  +   +   E  ++     P   GTAD ++
Sbjct: 71  GELTL---EMEQCTEDYVAFILDELELLKQGTNEPIILIEQMVDFSHYVPEGFGTADCVL 127

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  ++DFKYG GV V+AENN Q+ LYA GAL  Y  ++   E + +TI QPR    
Sbjct: 128 VAEGLLHVMDFKYGKGVLVEAENNPQMKLYALGALELYDALYD-IEEVKMTIFQPRKGN- 185

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             I+  ++  +DLL+ A++        L  K++ A   E        C+F        A 
Sbjct: 186 --ISTAILQREDLLDWAEK-------ELKPKAELAFKGEGEVTYGPWCQFSTCNAVLRAR 236

Query: 241 SRHVLLEAT---KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEIQGYQL 296
             +           P   T  E+ +  + +  +  +    +D   K  + +     G++L
Sbjct: 237 MDYHKQLEKFQLSSPHLLTDGEIEEILAHVDDLVKWATEIKDYATKVAVESHKSWAGFKL 296

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           VEGR   R F +     +   +    + +K+ L +  ELE+   ++    EF   L  L+
Sbjct: 297 VEGR-SIRQFTNEEAVIQAAEAEGFTDLYKQSLVSLTELEKRMGKK----EFNRVLGHLV 351

Query: 357 TRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
            +  GK  + P              +EF
Sbjct: 352 HKPQGKLTLVPESDKRK--EYIPAAAEF 377


>gi|215401123|ref|YP_002332378.1| hypothetical protein SauSIPLA35_gp15 [Staphylococcus phage
           phiSauS-IPLA35]
 gi|215260474|gb|ACJ64604.1| gp15 [Staphylococcus phage phiSauS-IPLA35]
          Length = 388

 Score =  307 bits (787), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 154/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   ++++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSTVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDNDVIALFETKLDLGKYIPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEKYALDQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRMITDTKATLEKLVEAGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I R  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIERPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|315574073|gb|EFU86264.1| conserved hypothetical protein [Enterococcus faecalis TX0309B]
 gi|315582018|gb|EFU94209.1| conserved hypothetical protein [Enterococcus faecalis TX0309A]
          Length = 391

 Score =  306 bits (784), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 112/400 (28%), Positives = 175/400 (43%), Gaps = 31/400 (7%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQG---VDAET 58
             HA L ASS+HRWL CP    LE K+    S YA EGT AH L    L +    + A  
Sbjct: 4   GSHALLGASSAHRWLICPPLARLEEKVKDRGSSYAEEGTTAHELAELYLAKRFKLLTARA 63

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFTTEPGATGT 115
           V+ +   FE D    D  M   V+     V            E E  ++     P   GT
Sbjct: 64  VNSRLKFFEQDHPYCDESMKEYVTAYCDLVEERVNQYENATIELEQKVDFSKWVPEGFGT 123

Query: 116 ADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
           +D+++ +     I+D KYG GVPV A  N QLMLYA GA+ +Y  I    E + +TIIQP
Sbjct: 124 SDVVVLSDKTIEIIDLKYGKGVPVDAYLNPQLMLYALGAVDKYDIIIYEFETVRMTIIQP 183

Query: 176 RVRTGSPINEWVISADDLLEKAKE-FKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
           R+     I+ + I  ++LL  A      R   A     +       + + DD  +F + +
Sbjct: 184 RLDN---ISTFEIEKEELLYWADNYVAPRAVQAWEGTGE-------WTITDDVVKFSKVR 233

Query: 235 VRCPALSRHVLLE----ATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNA-GD 289
            +    +            K+    T  E+++       IK +++  E    ++    G+
Sbjct: 234 AQLRPRAERNFQLIDKHELKEAPLLTNEEIAEILERAPEIKKWLEHVETYALQKARDEGE 293

Query: 290 EIQGYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFK-RILKTPKELEQLYKEQKVSD 346
           E  G+++V GR  NR   D      +L +     E+  K + LK   +LE++  ++K   
Sbjct: 294 EFPGWKVVAGR-SNRKISDNEGLLMVLEAEGFEDEDILKPQELKAIGQLEKVVGKKK--- 349

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
            F E   + I + +GKPV+ P         + ++ L++FE
Sbjct: 350 -FAELAADFIIKPEGKPVLVPESDKRPALNSVENALNDFE 388


>gi|323443492|gb|EGB01108.1| hypothetical protein SAO46_0717 [Staphylococcus aureus O46]
          Length = 388

 Score =  306 bits (783), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 95/397 (23%), Positives = 153/397 (38%), Gaps = 29/397 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   ++++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSTVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+     P + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDDDVIALFETKLDLGKYVPESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   +K A   E        CRFC+ 
Sbjct: 188 QPRIDN--------FSTEELP--ISRLLQWGTDFVKPLAKLAYKGEGKFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAG-DEIQ 292
           K  C   + ++     K P   +  E+++    +  IK +    E     +         
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVEKYALDQAKENDKNYP 297

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++LVEGR   R   D     E L       E+  +  L +   LE+L  ++     F +
Sbjct: 298 GWKLVEGR-SRRVITDTKATLEKLVEEGYKPEDITETKLLSITNLEKLIGKKA----FSK 352

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
             +  I +  GK  +A           +S   +F+ L
Sbjct: 353 ITEGFIEKPQGKLTLATESDKRPAIK-QSAEDDFDKL 388


>gi|320530600|ref|ZP_08031652.1| hypothetical protein HMPREF9555_01757 [Selenomonas artemidis F0399]
 gi|320137127|gb|EFW29057.1| hypothetical protein HMPREF9555_01757 [Selenomonas artemidis F0399]
          Length = 385

 Score =  305 bits (782), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 107/395 (27%), Positives = 176/395 (44%), Gaps = 28/395 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDA--ETVS 60
            HA LSAS S RWL CP +  LE   P      A+EGT AH L    L++ +    +  +
Sbjct: 2   AHAVLSASGSKRWLSCPPSARLERNFPDRAGEAAAEGTLAHELAEIELKRWLGRLTDAQA 61

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPF--LSETEVPLEPFTTEPGATGTADI 118
           +++     ++ +   +MA  VS  +            ++  E  L          GT D+
Sbjct: 62  NRRRGAIENSDLYTPDMADHVSDYVGICVEKINARHGIALVEERLNFSRWVRDGFGTGDM 121

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           +I       IVD KYG GV V+A+ NTQ+ LY  GA+ QYG ++     + ++I QPR+ 
Sbjct: 122 VIIGDGVLEIVDLKYGKGVGVEAQGNTQMQLYGLGAIDQYGFLYDFDR-VRMSIFQPRLG 180

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               ++   ++  DLL   +             +  A + +      + CRFC+A V+C 
Sbjct: 181 G---LSSQEMTVADLLAWGESI--------KPTAALAYAGKGDFKAGEHCRFCKAAVQCK 229

Query: 239 ALSRHVLLEAT---KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQ 295
           AL+ H L  A    KD    T  E++   S +  +  Y +  +         G    GY+
Sbjct: 230 ALADHQLELAKLEFKDAGLLTDDEVAFVLSRVDGLVRYAEKVKTFALDEALKGHRWPGYK 289

Query: 296 LVEGRKGNRSFKDINRAQELLTSVLGEE--AFKR-ILKTPKELEQLYKEQKVSDEFWEEL 352
           +VEGR  +R   D  +A  LL      +   +K   ++T   LE+L  ++K    F   L
Sbjct: 290 VVEGR-SDRKIGDEAKAVTLLRKAGYSDDVIYKPLEIQTITNLEKLVTKKK----FAALL 344

Query: 353 QELITRGDGKPVIAPRDIPTNKQT-QKSQLSEFEV 386
            ++IT+  GKP +AP D    + +    + ++ ++
Sbjct: 345 ADVITKPPGKPALAPVDDKRPEYSPAAMEFNDLDM 379


>gi|257088827|ref|ZP_05583188.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|281416449|ref|YP_003347369.1| hypothetical protein [Enterococcus phage phiFL4A]
 gi|256997639|gb|EEU84159.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|270209625|gb|ACZ64164.1| conserved hypothetical protein [Enterococcus phage phiFL4A]
 gi|315160603|gb|EFU04620.1| conserved hypothetical protein [Enterococcus faecalis TX0645]
 gi|315579449|gb|EFU91640.1| conserved hypothetical protein [Enterococcus faecalis TX0630]
          Length = 390

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 111/400 (27%), Positives = 175/400 (43%), Gaps = 32/400 (8%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQG---VDAET 58
             HA L ASS+HRWL CP    LE K+    S YA EGT AH L    L +    + A  
Sbjct: 4   GSHALLGASSAHRWLICPPLARLEEKVKDRGSSYAEEGTTAHELAELYLAKRFKLLTARA 63

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFTTEPGATGT 115
           V+ +   FE D    D  M   V+     V            E E  ++     P   GT
Sbjct: 64  VNSRLKFFEQDHPYCDESMKEYVTAYCDLVEERVNQYENATVELEQKVDFSKWVPEGFGT 123

Query: 116 ADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
           +D+++ +     I+D KYG GVPV A  N QLMLYA GA+ +Y  I+   E + +TIIQP
Sbjct: 124 SDVVVLSDKTIEIIDLKYGKGVPVDAYLNPQLMLYALGAVDKYDIIY-EFETVRMTIIQP 182

Query: 176 RVRTGSPINEWVISADDLLEKAKE-FKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
           R+     I+ + I  ++LL  A      R   A     +       + + DD  +F + +
Sbjct: 183 RLDN---ISTFEIEKEELLYWADNYVAPRAVQAWEGTGE-------WTITDDVVKFSKVR 232

Query: 235 VRCPALSRHVLLE----ATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNA-GD 289
            +    +            K+    T  E+++       IK +++  E    ++    G+
Sbjct: 233 AQLRPRAERNFQLIDKHELKEAPLLTNEEIAEILERAPEIKKWLEHVETYALQKARDEGE 292

Query: 290 EIQGYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFK-RILKTPKELEQLYKEQKVSD 346
           E  G+++V GR  NR   D      +L +     E+  K + LK   +LE++  ++K   
Sbjct: 293 EFPGWKVVAGR-SNRKISDNEGLLMVLEAEGFEDEDILKPQELKAIGQLEKVVGKKK--- 348

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
            F E   + I + +GKPV+ P         + ++  ++FE
Sbjct: 349 -FAELAADFIIKPEGKPVLVPESDKRPALNSVENAFNDFE 387


>gi|29374958|ref|NP_814111.1| hypothetical protein EF0319 [Enterococcus faecalis V583]
 gi|29342416|gb|AAO80182.1| conserved hypothetical protein [Enterococcus faecalis V583]
          Length = 390

 Score =  304 bits (778), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 112/400 (28%), Positives = 177/400 (44%), Gaps = 32/400 (8%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQG---VDAET 58
            +HA L ASS+HRWL CP    LE K+    S YA EGT AH L    L +    + A  
Sbjct: 4   GNHALLGASSAHRWLICPPLARLEEKVKDRGSSYAEEGTTAHELAELYLAKRFKLLTARA 63

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFTTEPGATGT 115
           V+ +   FE D    D  M   V+     V            E E  ++     P   GT
Sbjct: 64  VNSRLKFFEQDHPYCDESMKEYVTAYCDLVEERVNQYENATVELEQKVDFSKWVPEGFGT 123

Query: 116 ADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
           +D+++ +     I+D KYG GVPV A  N QLMLYA GA+ +Y  I+   E + +TIIQP
Sbjct: 124 SDVVVLSDKTIEIIDLKYGKGVPVDAYLNPQLMLYALGAVDKYDIIY-EFETVRMTIIQP 182

Query: 176 RVRTGSPINEWVISADDLLEKAKE-FKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
           R+     I+ + I  ++LL  A      R   A     +       + + DD  +F + +
Sbjct: 183 RLDN---ISTFEIEKEELLYWADNYVAPRAVQAWEGTGE-------WTITDDVVKFSKVR 232

Query: 235 VRCPALSRHVLLE----ATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNA-GD 289
            +    +            K+    T  E+++       IK +++  E    ++    G+
Sbjct: 233 AQLRPRAERNFQLIDKHELKEAPLLTNEEIAEILERAPEIKKWLEHVETYALQKARDEGE 292

Query: 290 EIQGYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFK-RILKTPKELEQLYKEQKVSD 346
           E  G+++V GR  NR   D      +L +     E+  K + LK   +LE++  ++K   
Sbjct: 293 EFPGWKVVAGR-SNRKISDNEGLLMVLEAEGFEDEDILKPQELKAIGQLEKVVGKKK--- 348

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
            F E   + I + +GKPV+ P         + ++ L++FE
Sbjct: 349 -FAELAADFIIKPEGKPVLVPESDKRPALNSVENALNDFE 387


>gi|237738626|ref|ZP_04569107.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
 gi|229424109|gb|EEO39156.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
          Length = 388

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 101/398 (25%), Positives = 173/398 (43%), Gaps = 30/398 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            HA L  SS+ RW+ CP +  L  +     S YA EG+ AH +    + + +D    S +
Sbjct: 2   AHALLGPSSASRWMACPPSVRLCEQFEDVESEYAKEGSLAHEIAELKVRKLIDPGLTSRK 61

Query: 63  ---KLTFENDTRIVDTEMASSVSMVLAYVRT----FSGPFLSETEVPLEPFTTEPGATGT 115
               +    +  +   EM       + +++     +        E  ++     PG  GT
Sbjct: 62  FTSAMKKLKEKELYQEEMQGYTDEYVEFIQEQMYSYPTTPHIAVEQKVDFSQYVPGGFGT 121

Query: 116 ADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
           AD ++ ++    ++DFKYG GVPV  ENN QL+LYA GA   Y  IF   E + ++I+QP
Sbjct: 122 ADCILISNDTLHVIDFKYGKGVPVSVENNAQLLLYALGAYLAYEMIFP-IEHIKMSIVQP 180

Query: 176 RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV 235
           R+     I+ W  S D LL  AK+ +E+           A++ E      + C+FC+AK 
Sbjct: 181 RLTG---IDTWECSLDYLLTFAKKAQEKAV--------MALNGEGDFECGEHCKFCKAKS 229

Query: 236 RCPALSRHVLLEATKDPST---NTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQ 292
            C   +   L  A  +       +  E+ +       +  + +   +        G+ + 
Sbjct: 230 ICKERANVNLELAKYEFKAADQLSLEEIGEILKKAQDLAEWAEDLNEYALAESLKGNNVP 289

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSDEFWE 350
           G++ V GR G+RSFK+ + A ++L      E   ++R   T  ++E++  ++    +F  
Sbjct: 290 GWKAVNGR-GSRSFKNTDEAIKVLKENGIAEELLYERKYLTLAQIEKVIGKK----DFNN 344

Query: 351 ELQELITRGDGKPVIAPRDIPTNKQTQK-SQLSEFEVL 387
            + +LI    GKP +          T K     EF  +
Sbjct: 345 LVGDLIVMNVGKPTLVEASDKREAITNKIKAEDEFSAV 382


>gi|295096876|emb|CBK85966.1| Protein of unknown function (DUF2800) [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 417

 Score =  303 bits (776), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 117/414 (28%), Positives = 180/414 (43%), Gaps = 49/414 (11%)

Query: 16  LKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET-------------VSHQ 62
           ++CP +  LE+  P  +S +A EGT AH L    L                         
Sbjct: 1   MRCPGSLALEATQPDKSSSFAEEGTAAHALAEKVLRNRQSYPEHYVGCNVAMFLGSYPLA 60

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTTEPGATGTADILI 120
           +   +     VD EM  +V   +  V   S     L E  V          + GTAD +I
Sbjct: 61  EHPDDTSGPQVDEEMVEAVGRYVDTVWALSQGNELLVEQRVDFSHIVGVEESFGTADGVI 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
               +  I D KYG GV V AE N QL LYA GAL Q+  ++   E + L I QPR+   
Sbjct: 121 IAGNELQIHDLKYGKGVRVDAEQNEQLQLYALGALEQFSMLYDF-ETVRLFIHQPRLN-- 177

Query: 181 SPINEWVISADDLLEKAKEFKERGTLAL------SLKSKRAVSLEHYGVNDDSCRFCRAK 234
             ++EW ++ ++L    +  +      +        +    + LE++   +  CRFC+A 
Sbjct: 178 -HVSEWALTVEELQAFGERAQGAAASVIVMFNIADCEGVETLPLENFTPGEKQCRFCKAS 236

Query: 235 VRCPALSR------------------HVLLEATKDPSTNTTVELSKAYSSISLIKSYVKA 276
             C A  +                    L EA K     T  +L++ YS    I+S++KA
Sbjct: 237 AICTARQQLHFDTIAGDFVDLTQPTGEQLAEAVKCVPLLTAEQLAEVYSQADFIESWLKA 296

Query: 277 CEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTS---VLGEEAFKRILKTPK 333
             D +   LNAG  + G++LV G++GNR++ D   A+ LL        EE F   L +P 
Sbjct: 297 VRDRVNSELNAGHPVPGFKLVTGKQGNRAWSDEEAARALLKDQFRYKTEEVFDLKLISPT 356

Query: 334 ELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           + E+L   +K S   W +++ LITR DGKP +AP   P       + +++F+ +
Sbjct: 357 KAEKLI--KKASPRRWTKVEALITRADGKPTVAPESDPRPALNL-NPVNDFDDV 407


>gi|324014354|gb|EGB83573.1| hypothetical protein HMPREF9533_01586 [Escherichia coli MS 60-1]
          Length = 417

 Score =  303 bits (775), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 117/414 (28%), Positives = 182/414 (43%), Gaps = 49/414 (11%)

Query: 16  LKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET-------------VSHQ 62
           ++CP +  LE+  P   + +A EGT AH L    L                         
Sbjct: 1   MRCPGSLALEATQPDKETTFAIEGTAAHALAEKVLRNRQSHPEHYAGCNVAMFLGSYPLA 60

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTTEPGATGTADILI 120
           +   +     VD EM  +V   +  V   +     L E  V     T    + GTAD +I
Sbjct: 61  EHPDDTSGPQVDEEMVEAVGRYVDTVWALAQGNELLVEQRVDFSHITGVEESFGTADSII 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
              ++  I D KYG GV + AE N QL LYA GAL Q+  ++   E + L I QPR+   
Sbjct: 121 IAGSELQIHDLKYGKGVRIDAEQNEQLQLYALGALEQFSMLYDF-ETVRLFIHQPRLN-- 177

Query: 181 SPINEWVISADDLLEKAKEFKERGTLAL------SLKSKRAVSLEHYGVNDDSCRFCRAK 234
             ++EW ++ ++L    +  +E  T A+        +    + LE++   +  CRFC+AK
Sbjct: 178 -HVSEWALTVEELQAFGERAQEAATSAILVLNIAECEGIETLPLENFIPGEKQCRFCKAK 236

Query: 235 VRCPALSRHVLLEATKDP------------------STNTTVELSKAYSSISLIKSYVKA 276
             C A     L  A  D                      T  +L++ YS    I+S++KA
Sbjct: 237 AICTAQKMQHLQTAASDFEDLTKPVSEIITNASARVPLLTIEQLAEIYSQTDFIESWLKA 296

Query: 277 CEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTS---VLGEEAFKRILKTPK 333
             D +   LNAG  + G++LV G++GNR++ D   A+ LL        EE F   L +P 
Sbjct: 297 VRDRVHNELNAGHPVPGFKLVTGKQGNRAWSDEEAARALLKDQFRYKTEEVFDFKLISPT 356

Query: 334 ELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           + E+L   +K S   W +++ LITR DGKP + P   P       + +++F+ +
Sbjct: 357 KAEKLI--KKASPRRWSKVEALITRADGKPTVVPESDPRPALNI-NPVNDFDDV 407


>gi|262043418|ref|ZP_06016543.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039244|gb|EEW40390.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 393

 Score =  302 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 109/400 (27%), Positives = 186/400 (46%), Gaps = 45/400 (11%)

Query: 16  LKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDT 75
           ++CP +  LES  P  +S +A EG  AH L    L            +L+   DT   D 
Sbjct: 1   MRCPGSLALESTQPDKSSAFAEEGARAHALAEQILN----------ARLSGSEDTMFADV 50

Query: 76  EMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKY 133
           EM   V   +  V T +     + E  V          + GTAD ++    +  I D KY
Sbjct: 51  EMYEYVLRYVDAVWTLAEGNELMVEQRVDFSHIVGVENSFGTADAVVIVGNELQIHDLKY 110

Query: 134 GAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDL 193
           G GV V AENN QL LYA GAL Q+  ++   +++ L I QPR+     ++EW +S ++L
Sbjct: 111 GRGVQVDAENNEQLQLYALGALEQFNLLYDF-DSVRLFIHQPRLN---HVSEWALSVEEL 166

Query: 194 LEKAKEFKERGTLAL------SLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLE 247
               +  +E     +        +    + LE++   +  CRFC+A   C A  +  +  
Sbjct: 167 EAFGQRAQEAAANVIVMFNIAECEGVNTLPLENFTPGEKQCRFCKASAICTAREQFHMQT 226

Query: 248 ATKDP------------------STNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGD 289
              +                      T  +L++ Y     ++S++KA  D +   LNAG 
Sbjct: 227 VAGEFDNLTAPISELVTSAIARVPMLTNEQLAEIYGQADFLESWLKAIRDRVNSELNAGH 286

Query: 290 EIQGYQLVEGRKGNRSFKDINRAQELLT--SVLGEEAFKRILKTPKELEQLYKEQKVSDE 347
            + G++LV G++GNR++++   A+E+L    +  ++ + + + +P + E+L K++  S  
Sbjct: 287 PVPGFKLVTGKQGNRAWRNEVEAEEMLKSFRLKQDQMYSQKVISPTQAEKLLKKE--SPR 344

Query: 348 FWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
            W +++ LITR DGKP IAP   P       + +++F+ +
Sbjct: 345 RWTKVEALITRSDGKPTIAPESDPRPALNV-NPVNDFDDV 383


>gi|227520149|ref|ZP_03950198.1| hypothetical phage associated protein SpyM3_1445 [Enterococcus
           faecalis TX0104]
 gi|227072394|gb|EEI10357.1| hypothetical phage associated protein SpyM3_1445 [Enterococcus
           faecalis TX0104]
          Length = 390

 Score =  302 bits (774), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 112/400 (28%), Positives = 176/400 (44%), Gaps = 32/400 (8%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQG---VDAET 58
             HA L ASS+HRWL CP    LE K+    S YA EGT AH L    L +    + A  
Sbjct: 4   GSHALLGASSAHRWLICPPLARLEEKVKDRGSSYAEEGTTAHELAELYLAKRFKLLTARA 63

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFTTEPGATGT 115
           V+ +   FE D    D  M   V+     V            E E  ++     P   GT
Sbjct: 64  VNSRLKFFEQDHPYCDESMKEYVTAYCDLVEERVNQYENATVELEQKVDFSKWVPEGFGT 123

Query: 116 ADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
           +D+++ +     I+D KYG GVPV A  N QLMLYA GA+ +Y  I+   E + +TIIQP
Sbjct: 124 SDVVVLSDKTIEIIDLKYGKGVPVDAYLNPQLMLYALGAVDKYDIIY-EFETVRMTIIQP 182

Query: 176 RVRTGSPINEWVISADDLLEKAKE-FKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
           R+     I+ + I  ++LL  A      R   A     +       + + DD  +F + +
Sbjct: 183 RLDN---ISTFEIEKEELLYWADNYVAPRAVQAWEGTGE-------WTITDDVVKFSKVR 232

Query: 235 VRCPALSRHVLLE----ATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNA-GD 289
            +    +            K+    T  E+++       IK +++  E    ++    G+
Sbjct: 233 AQLRPRAERNFQLIDKHELKEAPLLTNEEIAEILERAPEIKKWLEHVETYALQKARDEGE 292

Query: 290 EIQGYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFK-RILKTPKELEQLYKEQKVSD 346
           E  G+++V GR  NR   D      +L +     E+  K + LK   +LE++  ++K   
Sbjct: 293 EFPGWKVVAGR-SNRKISDNEGLLMVLEAEGFEDEDILKPQELKAIGQLEKVVGKKK--- 348

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
            F E   + I + +GKPV+ P         + ++ L++FE
Sbjct: 349 -FAELAADFIIKPEGKPVLVPESDKRPALNSVENALNDFE 387


>gi|313621750|gb|EFR92490.1| putative protein p51 [Listeria innocua FSL J1-023]
          Length = 393

 Score =  301 bits (772), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 110/393 (27%), Positives = 172/393 (43%), Gaps = 33/393 (8%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCLEQGVD--AETV 59
           HA LSAS S RWL C  +  LE+K P+     I+A EGT AH+     L++     A+  
Sbjct: 5   HAKLSASGSSRWLNCTPSIALEAKFPEQKNGGIFAQEGTLAHSFAELLLQKFNGDVAKAE 64

Query: 60  SHQKLTFENDTRIVDTEMASSVSMV-------LAYVRTFSGPFLSETEVPLEPFTTEPGA 112
             +KL       + D  M   V +                   +   E  L+      G 
Sbjct: 65  YARKLNRLKKNSLYDASMIDHVEVYTTIVIEKFQEAHAADKNAVLSIEQQLDYSEYARGG 124

Query: 113 TGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTI 172
            GT D +I  +    I+D KYG GVPV A+ N+QLMLY  GA + +   +     + +TI
Sbjct: 125 FGTGDAVIVGNGVVEIIDLKYGKGVPVSAKENSQLMLYGLGAYNAFELDYD-LHTVRMTI 183

Query: 173 IQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCR 232
           +QPR+     + E+ +   DLL+ A+         +   +  A + +        C+FCR
Sbjct: 184 VQPRLDD---VTEFEMEVSDLLDWAENV-------VKPAALLADAGKGELNPGPWCKFCR 233

Query: 233 AKVRCPALSRHVLLEA---TKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGD 289
           A+  C A +   L       KDP     +E++K    ++ +KS+V+  +    K   +G 
Sbjct: 234 ARGICKARAEANLALTSYDFKDPRLLQPIEIAKVLGQVAELKSWVEDVKSFALKEAESGG 293

Query: 290 -EIQGYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSD 346
            E  G++LVEGR  NR + D    Q +L       EE   + L +  ++E+L  +++VS 
Sbjct: 294 IEFPGWKLVEGR-SNRRYVDAEMVQAMLELEGYSEEELLSKKLISLTDMEKLVGKKQVS- 351

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNKQTQKS 379
                L +LI +  GKP +            KS
Sbjct: 352 ---AILGDLIEKPAGKPTLVVETDKRQAIKLKS 381


>gi|313895680|ref|ZP_07829236.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975806|gb|EFR41265.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 376

 Score =  300 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 112/394 (28%), Positives = 178/394 (45%), Gaps = 30/394 (7%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M  HA LS S++HRW++CP +  LE + P + S  A+EGT AH L  H L + +   +  
Sbjct: 2   MGAHALLSPSAAHRWVRCPPSACLEREFPSSPSEAAAEGTAAHALCEHKLRKFLKLRSKR 61

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFTTEPGATGTAD 117
                    +   D EM       +++V+   G     +   E  ++     P A GTAD
Sbjct: 62  -------PHSDFEDDEMERCSDAYVSFVQEQMGEIPSPMVLVEQRIDLTRYVPEAFGTAD 114

Query: 118 ILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRV 177
            ++       ++DFKYG GV V+AE+N Q+MLYA GAL     I+   + ++++I QPR 
Sbjct: 115 CILVGGDMLHVIDFKYGMGVLVEAEHNPQMMLYALGALELLDGIYD-IQKISVSIFQPRR 173

Query: 178 RTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
                +  W +  ++LL  A++        L  K++ A + E        C FCRA VRC
Sbjct: 174 EN---VCTWSLPKEELLRWARD-------DLVEKARLAYAGEGEYCAGKWCTFCRAAVRC 223

Query: 238 PALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGDEIQG 293
            A +   L  A ++   P   T  E+      I  +  +  A          N G E  G
Sbjct: 224 RARAEEKLRLAKEEFKYPPLITDEEIEDVLGEIPELIKWANAILAYATDAALNHGKEWTG 283

Query: 294 YQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQ 353
           +++VEGR   R +KD +       S    + F R L +  ++E+L  ++     F + L 
Sbjct: 284 FKIVEGR-SVRRYKDEDAVAREAESAGYTDIFDRKLISLTQMEKLMGKKA----FTDILG 338

Query: 354 ELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
            LI +  GKP + P     +     +  SEF+ +
Sbjct: 339 GLIEKPPGKPTLVPISDKRSAIHTGNVQSEFKTI 372


>gi|217965859|ref|YP_002351537.1| conserved phage-associated protein [Listeria monocytogenes HCC23]
 gi|217335129|gb|ACK40923.1| conserved phage-associated protein [Listeria monocytogenes HCC23]
 gi|307569597|emb|CAR82776.1| phage protein, putative [Listeria monocytogenes L99]
          Length = 393

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 110/393 (27%), Positives = 172/393 (43%), Gaps = 33/393 (8%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCLEQGVDAETVS- 60
           HA LSAS S RWL C  +  LE+K P+     ++A EGT AH+     L++  D  T + 
Sbjct: 5   HAKLSASGSSRWLNCTPSIALEAKFPEQKNGGVFAQEGTLAHSFAELLLQKFNDEVTKAG 64

Query: 61  -HQKLTFENDTRIVDTEMASSVSMV-------LAYVRTFSGPFLSETEVPLEPFTTEPGA 112
             +KL       + D  M   V +                   +   E  L+      G 
Sbjct: 65  YARKLNRLKKNSLYDASMIDHVEVYTTIVIEKFQEAHAADKNAVLSIEQQLDYSDYARGG 124

Query: 113 TGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTI 172
            GT D +I  +    I+D KYG GVPV AE N+QLMLY  GA + +   +     + +TI
Sbjct: 125 FGTGDAVIVGNGVVEIIDLKYGKGVPVSAEENSQLMLYGLGAYNAFELDYD-LHTVRMTI 183

Query: 173 IQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCR 232
           +QPR+     + E+ +   DLL+ A+         +   +  A + +        C+FCR
Sbjct: 184 VQPRLDD---VTEFEMEVSDLLDWAENV-------VKPAALLADAGKGELNPGPWCKFCR 233

Query: 233 AKVRCPALSRHVLLEA---TKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNA-G 288
           A+  C A +   L       KDP      E++K    ++ +KS+V+  +    K   + G
Sbjct: 234 ARSICKARAEANLALTSYDFKDPRLLQPDEIAKVLGQVAELKSWVEDVKSFALKEAESRG 293

Query: 289 DEIQGYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKELEQLYKEQKVSD 346
            E  G++LVEGR  NR + D    Q ++       EE   + L +  ++E+L  +++VS 
Sbjct: 294 IEFPGWKLVEGR-SNRRYADAEMVQAMMELEGYSEEELLSKKLISLTDMEKLIGKKQVS- 351

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNKQTQKS 379
                L +LI +  GKP +            KS
Sbjct: 352 ---AILGDLIEKPAGKPALVVETDRRQALKLKS 381


>gi|218133413|ref|ZP_03462217.1| hypothetical protein BACPEC_01278 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990788|gb|EEC56794.1| hypothetical protein BACPEC_01278 [Bacteroides pectinophilus ATCC
           43243]
          Length = 336

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 89/348 (25%), Positives = 152/348 (43%), Gaps = 16/348 (4%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVS 60
           M  HA  S SS  R L+CP +  LE + P   S +A+EG+  H +  + + + +   T  
Sbjct: 1   MGGHARFSPSSGKRRLECPPSLLLEEQFPDEESPFAAEGSAGHAMAEYLINKYLKKRTKR 60

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
                + ++      +        +   R          E+ +          GTAD+++
Sbjct: 61  PVSDYYSDELLEAVDDYVEYNIGQIEQARKDCDDPFIGVELKVSLAHRIRDCFGTADMVV 120

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
            +S +  I+D K G GV V AE N QLM+Y  G L   G ++   + + LTI+QPR+   
Sbjct: 121 VDSHKIHIIDLKLGKGVVVDAEQNVQLMIYGLGVLDMLGFLY-EIDTVELTIVQPRIE-- 177

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
              + W ISA++LL   K+  E         + +A++ E      D CRFC+A+  C A 
Sbjct: 178 -HFSTWEISAEELLVWGKDVLE-------PGAAKALAGEGEFKAGDHCRFCKARFTCRAR 229

Query: 241 SRHVLLEATK---DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGDEIQGYQL 296
           +   L  A     +P+  +  E+++  S    +K + +               E  GY+L
Sbjct: 230 AEEYLKLAQMEFAEPALMSDEEIAEVLSKADALKKWAEEVYTYAQNEAVVNHKEWPGYKL 289

Query: 297 VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKV 344
           V GR  NR + D +   E        + +K+ L    E+E+L  ++++
Sbjct: 290 VLGR-SNRKYTDEDEVAEAAQKAGYTDIYKKSLIGITEMERLMGKKEI 336


>gi|322382463|ref|ZP_08056358.1| hypothetical protein PL1_2402 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153576|gb|EFX45965.1| hypothetical protein PL1_2402 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 395

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 99/402 (24%), Positives = 174/402 (43%), Gaps = 36/402 (8%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV-----DAE 57
            HA LSASSS +W+ CP +  L   IP   + YA EGT AH L    L + +        
Sbjct: 8   AHALLSASSSAQWIACPPSARLTEDIPDKRNKYADEGTVAHELAELKLRRKITVCNAKQR 67

Query: 58  TVSHQKLTFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEP 110
               QK+           EM + +S  +  V       +  S   +   E  ++     P
Sbjct: 68  REIDQKMEEIKAKEYYCAEMENYISEYVDRVGGIFLEHKARSNEVIVSLEESIDYSKWVP 127

Query: 111 GATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTL 170
              GT D+++ +     ++D KYG  VPV A  N Q+ LYA GA   Y  ++   + + +
Sbjct: 128 EGFGTGDVVLISDGVVEVIDLKYGK-VPVSAIGNPQIRLYALGAWEAYNWLY-EIDKVRM 185

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRF 230
           TI+QPR+ +   I    ++  +LL  A++        +   +K A + E      D CR+
Sbjct: 186 TIVQPRLDS---ITTEELTVKELLAWAEDV-------IKPAAKLAYAGEGEFKPGDHCRW 235

Query: 231 CRAKVRCPALSRHVL---LEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNA 287
           C+ K  C A +   +    +  +DP+  +  E+         +K++ K  ED   ++  +
Sbjct: 236 CKVKGNCRARAEENMKAVQQEFQDPALLSDEEIGSTLFVAQQLKAWAKDVEDYAKEKALS 295

Query: 288 GDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGE-EAF--KRILKTPKELEQLYKEQKV 344
           G+ I  ++LVEG+  NR   D  +A   L +   + + +   R L     LE+   ++  
Sbjct: 296 GENIPQWKLVEGK-SNRFITDKGKAISKLEAAKIDPDKYLKPRELLGIGALEKQLDKK-- 352

Query: 345 SDEFWEELQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
             +    + +LI +  GKP + P   P  +  + + + +  +
Sbjct: 353 --QLNNLIGDLIVKPQGKPTLVPETDPRPEFNSLEQEFANMD 392


>gi|157311148|ref|YP_001469193.1| hypothetical protein P9_gp13 [Streptococcus phage P9]
 gi|119104297|gb|ABL61042.1| hypothetical protein [Streptococcus phage P9]
          Length = 385

 Score =  295 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 105/396 (26%), Positives = 178/396 (44%), Gaps = 28/396 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLE---QGVDAETV 59
           +HA LSASS+HRWL CP+ P LE+  P   ++Y  EGT AH L    L      +     
Sbjct: 5   NHALLSASSAHRWLYCPMLPRLEADYPSRDTVYTQEGTSAHELSEIKLMYKSGKITKRKF 64

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFTTEPGATGTA 116
           +    TF+ ++   + EM     +    V            E E  ++     PG  GT+
Sbjct: 65  NTLTKTFKENSDFYNEEMEEMTELYTDIVMEHLNAYENAEIELEKRVDFSDWVPGGFGTS 124

Query: 117 DILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR 176
           D++I       I+D KYG G+PV A  N Q+ LYA GA   Y  ++     + +TIIQPR
Sbjct: 125 DVVILADGVIEIIDLKYGKGMPVSANQNPQMGLYALGAYASYDMVYDFDR-IKMTIIQPR 183

Query: 177 VRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV- 235
           + + S ++ +    ++LL  A          L + ++    +  + +++   ++      
Sbjct: 184 LDSVSSVDIY---VEELLYWADNI------VLPMAAQADAGIGDWNLSEKVLQWSPVAAK 234

Query: 236 -RCPALSRHVLLEATK--DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQ 292
               A     L++     +P   +   +++     S IK +V++ E    K   +G E+ 
Sbjct: 235 LVPRAQENWELIDKYDYQEPVYLSDEAVAEILDKASAIKKWVESVEAYALKEALSGKEVP 294

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLGEE-AFK-RILKTPKELEQLYKEQKVSDEFWE 350
           GY++VEGR  NR   D ++A ++L     ++  FK + L     LE+L  +      F +
Sbjct: 295 GYKIVEGR-SNRVITDKDKAIDILQDNGFDDEIFKPKELLAMGALEKLIGKTT----FAD 349

Query: 351 ELQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
            L E+I +  GKPV+ P         + +  + +FE
Sbjct: 350 LLAEVIDKPQGKPVLVPEKDKRPAINSLEQAIKDFE 385


>gi|21910981|ref|NP_665249.1| hypothetical protein SpyM3_1445 [Streptococcus pyogenes MGAS315]
 gi|28876475|ref|NP_795673.1| hypothetical protein SpyM3_1445 [Streptococcus pyogenes phage
           315.6]
 gi|28895332|ref|NP_801682.1| hypothetical protein SPs0420 [Streptococcus pyogenes SSI-1]
 gi|50913378|ref|YP_059350.1| unknown phage protein [Streptococcus pyogenes MGAS10394]
 gi|21905189|gb|AAM80052.1| conserved hypothetical protein - phage-associated [Streptococcus
           pyogenes MGAS315]
 gi|28810578|dbj|BAC63515.1| hypothetical protein (phage associated) [Streptococcus pyogenes
           SSI-1]
 gi|50902452|gb|AAT86167.1| unknown phage protein [Streptococcus pyogenes MGAS10394]
          Length = 385

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 104/396 (26%), Positives = 177/396 (44%), Gaps = 28/396 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLE---QGVDAETV 59
           +HA LSASS+HRWL CP+ P LE+  P   ++Y  EGT AH L    L      +     
Sbjct: 5   NHALLSASSAHRWLYCPMLPRLEADYPSRDTVYTQEGTSAHELSEIKLMYKSGKITKRKF 64

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSG---PFLSETEVPLEPFTTEPGATGTA 116
           +     F+ ++   + EM     +    V            E E  ++     PG  GT+
Sbjct: 65  NTLTKAFKENSDFYNEEMEEMTELYTDIVMEHLNTYENAEIELEKRVDFSDWVPGGFGTS 124

Query: 117 DILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR 176
           D++I       I+D KYG G+PV A  N Q+ LYA GA   Y  ++     + +TIIQPR
Sbjct: 125 DVVILADGVIEIIDLKYGKGMPVSANQNPQMGLYALGAYASYDMVYDFDR-IKMTIIQPR 183

Query: 177 VRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV- 235
           + + S ++ +    ++LL  A          L + ++    +  + +++   ++      
Sbjct: 184 LDSVSSVDIY---VEELLYWADNV------VLPMAAQADAGIGDWNLSEKVLQWSPVAAK 234

Query: 236 -RCPALSRHVLLEATK--DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQ 292
               A     L++     +P   +   +++     S IK +V++ E    K   +G E+ 
Sbjct: 235 LVPRAQENWELIDKYDYQEPVYLSDEAVAEILDKASAIKKWVESVEAYALKEALSGKEVP 294

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLGEE-AFK-RILKTPKELEQLYKEQKVSDEFWE 350
           GY++VEGR  NR   D ++A ++L     ++  FK + L     LE+L  +      F +
Sbjct: 295 GYKIVEGR-SNRVITDKDKAIDILQDNGFDDEIFKPKELLAMGALEKLIGKTT----FAD 349

Query: 351 ELQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
            L E+I +  GKPV+ P         + +  + +FE
Sbjct: 350 LLAEVIDKPQGKPVLVPEKDKRPAINSLEQAIKDFE 385


>gi|227872578|ref|ZP_03990914.1| phage protein [Oribacterium sinus F0268]
 gi|227841579|gb|EEJ51873.1| phage protein [Oribacterium sinus F0268]
          Length = 384

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 104/390 (26%), Positives = 171/390 (43%), Gaps = 26/390 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            HA LSASS+HRW++C  +  LE ++     + A EGT AH L    L   +  +     
Sbjct: 8   AHALLSASSAHRWMRCTPSARLEDEVEVEEGVAAKEGTVAHELCECKLRGLLGEDVEEAT 67

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRT--FSGPFLSETEVPLEPFTTEPGATGTADILI 120
           K     ++     EM         Y              E  L+     P   GTAD +I
Sbjct: 68  KKV--KESEFYSPEMERFTQDYADYCYQSMIEENGDIRIEEALDLSAYVPEGFGTADCVI 125

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  ++DFKYG GV V    N QLMLYA GA + Y  +    + + LTI+QPR+   
Sbjct: 126 VGEELLHVIDFKYGRGVKVSPVENPQLMLYALGAFNLYSFMQDF-KTVRLTIVQPRIDEE 184

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
              + W +S +DLL   +E K++  +A   + +       +   +D+CRFC+ K  C A 
Sbjct: 185 P--SSWELSIEDLLAFGEEVKKKAEVAFKGEGE-------FCPEEDTCRFCKVKAVCRAR 235

Query: 241 SRHVLL---EATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLV 297
           +   L       +DP   +  EL    +  S   +++   E+    +L  G+EI+G+++V
Sbjct: 236 AEKNLALMFLEEQDPRLLSNEELGDILTKCSGFPTWLSDVEECAKDKLLLGEEIKGWKIV 295

Query: 298 EGRKGNRSFKDINRAQELLTSV---LGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQE 354
           EGR   R + D   A + +        EE F+ +  T  ++E+L  ++     F    ++
Sbjct: 296 EGR-STRVWTDEKEAFKYIVDSEEAKEEELFETVPLTLTKVEKLLGKK----RFKPIAEK 350

Query: 355 LITRGDGKPVIAPRDIPTNK-QTQKSQLSE 383
            +T+  GKP +           + ++  +E
Sbjct: 351 YVTKSKGKPTLTLESDERPAYNSVETMFNE 380


>gi|306826826|ref|ZP_07460127.1| phage protein [Streptococcus pyogenes ATCC 10782]
 gi|304430989|gb|EFM33997.1| phage protein [Streptococcus pyogenes ATCC 10782]
          Length = 385

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 104/396 (26%), Positives = 177/396 (44%), Gaps = 28/396 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLE---QGVDAETV 59
           +HA LSASS+HRWL CP+ P LE+  P   ++Y  EGT AH L    L      +     
Sbjct: 5   NHALLSASSAHRWLYCPMLPRLEADYPSRDTVYTQEGTSAHELSEIKLMYKSGKITKRKF 64

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFTTEPGATGTA 116
           +     F+ ++   + EM     +    V            E E  ++     PG  GT+
Sbjct: 65  NTLTKAFKENSDFYNEEMEEMTELYTDIVMEHLNAYENAEIELEKRVDFSDWVPGGFGTS 124

Query: 117 DILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR 176
           D++I       I+D KYG G+PV A  N Q+ LYA GA   Y  ++     + +TIIQPR
Sbjct: 125 DVVILADGVIEIIDLKYGKGMPVSANQNPQMGLYALGAYASYDMVYDFDR-IKMTIIQPR 183

Query: 177 VRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV- 235
           + + S ++ +    ++LL  A          L + ++    +  + +++   ++      
Sbjct: 184 LDSVSSVDIY---VEELLYWADNI------VLPMAAQADAGIGDWNLSEKVLQWSPVAAK 234

Query: 236 -RCPALSRHVLLEATK--DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQ 292
               A     L++     +P   +   +++     S IK +V++ E    K   +G E+ 
Sbjct: 235 LVPRAQENWELIDKYDYQEPVYLSDEAVAEILDKASAIKKWVESVEAYALKEALSGKEVP 294

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLGEE-AFK-RILKTPKELEQLYKEQKVSDEFWE 350
           GY++VEGR  NR   D ++A ++L     ++  FK + L     LE+L  +      F +
Sbjct: 295 GYKIVEGR-SNRVITDKDKAIDILQDNGFDDEIFKPKELLAMGALEKLIGKTT----FAD 349

Query: 351 ELQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
            L E+I +  GKPV+ P         + +  + +FE
Sbjct: 350 LLAEVIDKPQGKPVLVPEKDKRPAINSLEQAIKDFE 385


>gi|225405825|ref|ZP_03761014.1| hypothetical protein CLOSTASPAR_05046 [Clostridium asparagiforme
           DSM 15981]
 gi|225042639|gb|EEG52885.1| hypothetical protein CLOSTASPAR_05046 [Clostridium asparagiforme
           DSM 15981]
          Length = 394

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 108/407 (26%), Positives = 169/407 (41%), Gaps = 37/407 (9%)

Query: 1   MAH----HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV-- 54
           M H    HA LSAS + RW+ C  +  LE + P TTS  A EGT AH L    L      
Sbjct: 1   MGHSERAHALLSASGASRWMACTPSARLEEQFPDTTSESAREGTLAHELAELKLRNYFFS 60

Query: 55  --DAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS----GPFLSETEVPLEPFTT 108
               +      +       + + EM       L YV+  +           E  ++    
Sbjct: 61  VDFGKRKLTTAVNKLKKAELWNDEMMGYTDEYLDYVKAVALKFKSQPYVAIEKQVDLRAY 120

Query: 109 EPGATGTADILIFNSTQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
            P   GTAD ++       ++DFKYG      V AE N Q+MLYA GA   Y  ++   E
Sbjct: 121 VPEGFGTADCILVGGGVLHVIDFKYGKSPNGRVSAERNPQMMLYALGAYEAYKILYNVSE 180

Query: 167 ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
            + L+I+QPR+  G  I+EW  S D LL   +  KER  LA+  + + A         + 
Sbjct: 181 -VRLSIVQPRLPDG--ISEWSCSLDVLLGFGETVKERAELAIKGEGEFA-------PGEK 230

Query: 227 SCRFCRAKVRCPALSRHVLLEAT-----KDPSTNTTVELSKAYSSISLIKSYVKACEDEM 281
           +C+FCRAK  C A +   +  A      K P   +  E+       + +  ++   +   
Sbjct: 231 TCQFCRAKGMCRARADENVKLAFSPDIGKKPPLLSNEEMGDYLIRGADVAKWLADLQKCA 290

Query: 282 FKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLY 339
                AG+++ G++ VEGR G+R + D++ A   L +        ++R   TP  LE+  
Sbjct: 291 LAECLAGNDVPGWKAVEGR-GSRDWTDLDEAFAALEAAGISTAILWERKPVTPAGLEKAL 349

Query: 340 KEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQT-QKSQLSEFE 385
            +++ +            +  GKP +          T + S    F+
Sbjct: 350 GKKEYTAHAA----NYEVKKPGKPALVKESDKREAITNKVSAAEAFK 392


>gi|139473890|ref|YP_001128606.1| hypothetical protein SpyM51057 [Streptococcus pyogenes str.
           Manfredo]
 gi|225871343|ref|YP_002747290.1| phage protein [Streptococcus equi subsp. equi 4047]
 gi|134272137|emb|CAM30382.1| hypothetical phage protein [Streptococcus pyogenes str. Manfredo]
 gi|225700747|emb|CAW95391.1| hypothetical phage protein [Streptococcus equi subsp. equi 4047]
          Length = 385

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 103/396 (26%), Positives = 176/396 (44%), Gaps = 28/396 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLE---QGVDAETV 59
           +HA LSASS+HRWL CP+ P LE+  P   ++Y  EGT AH L    L      +     
Sbjct: 5   NHALLSASSAHRWLYCPMLPRLEADYPSRDTVYTQEGTSAHELSEIKLMYKSGKITKRKF 64

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFTTEPGATGTA 116
           +     F+ ++   + EM     +    V            E E  ++     PG  GT+
Sbjct: 65  NTLTKAFKENSDFYNEEMEEMTELYTDIVMEHLNAYENAEIELEKRVDFSDWVPGGFGTS 124

Query: 117 DILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR 176
           D++I       I+D KYG G+PV A  N Q+ LYA GA   Y  ++     + +TIIQPR
Sbjct: 125 DVVILADGVIEIIDLKYGKGMPVSANQNPQMGLYALGAYASYDMVYDFDR-IKMTIIQPR 183

Query: 177 VRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV- 235
           + + S ++ +    ++LL  A          L + ++    +  + +++   ++      
Sbjct: 184 LDSVSSVDIY---VEELLYWADNV------VLPMAAQADAGIGDWNLSEKVLQWSPVAAK 234

Query: 236 -RCPALSRHVLLEATK--DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQ 292
               A     L++     +P   +   +++     S IK +V++ E    K   +G E+ 
Sbjct: 235 LVPRAQENWELIDKYDYQEPVYLSDEAVAEILDKASAIKKWVESVEAYALKEALSGKEVP 294

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLGEE-AFK-RILKTPKELEQLYKEQKVSDEFWE 350
           GY++VEGR  NR   D ++A ++L     ++  FK + L     LE+L  +      F +
Sbjct: 295 GYKIVEGR-SNRVITDKDKAIDILQDNGFDDEIFKPKELLAMGTLEKLIGKTT----FAD 349

Query: 351 ELQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
            L E+I +  GKPV+           + +  + +FE
Sbjct: 350 LLAEVIDKPQGKPVLVKNSDKRPALNSLEQAIKDFE 385


>gi|209559296|ref|YP_002285768.1| Hypothetical phage associated protein SpyM3_1445 [Streptococcus
           phage NZ131.2]
 gi|209540497|gb|ACI61073.1| Hypothetical phage associated protein SpyM3_1445 [Streptococcus
           phage NZ131.2]
          Length = 385

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 103/396 (26%), Positives = 176/396 (44%), Gaps = 28/396 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLE---QGVDAETV 59
           +HA LSASS+HRWL CP+ P LE+  P   ++Y  EGT AH L    L      +     
Sbjct: 5   NHALLSASSAHRWLYCPMLPRLEADYPSRDTVYTQEGTSAHELSEIKLMYKSGKITKRKF 64

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFTTEPGATGTA 116
           +     F+ ++   + EM     +    V            E E  ++     PG  GT+
Sbjct: 65  NTLTKAFKENSDFYNEEMEEMTELYTDIVMEHLNAYENAEIELEKRVDFSDWVPGGFGTS 124

Query: 117 DILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR 176
           D++I       I+D KYG G+PV A  N Q+ LYA GA   Y  ++     + +TIIQPR
Sbjct: 125 DVVILADGVIEIIDLKYGKGMPVSANQNPQMGLYALGAYASYDMVYDFDR-IKMTIIQPR 183

Query: 177 VRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV- 235
           + + S ++ +    ++LL  A          L + ++    +  + +++   ++      
Sbjct: 184 LDSVSSVDIY---VEELLYWADNV------VLPMAAQADAGIGDWNLSEKVLQWSPVAAK 234

Query: 236 -RCPALSRHVLLEATK--DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQ 292
               A     L++     +P   +   +++     S IK +V++ E    K   +G E+ 
Sbjct: 235 LVPRAQENRELIDKYDYQEPVYLSDEAVAEILDKASAIKKWVESVEAYALKEALSGKEVP 294

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLGEE-AFK-RILKTPKELEQLYKEQKVSDEFWE 350
           GY++VEGR  NR   D ++A ++L     ++  FK + L     LE+L  +      F +
Sbjct: 295 GYKIVEGR-SNRVITDKDKAIDILQDNGFDDEIFKPKELLAMGTLEKLIGKTT----FAD 349

Query: 351 ELQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
            L E+I +  GKPV+           + +  + +FE
Sbjct: 350 LLAEVIDKPQGKPVLVKNSDKRPALNSLEQAIKDFE 385


>gi|71911266|ref|YP_282816.1| phage protein [Streptococcus pyogenes MGAS5005]
 gi|94989085|ref|YP_597186.1| phage protein [Streptococcus pyogenes MGAS9429]
 gi|94992976|ref|YP_601075.1| phage protein [Streptococcus pyogenes MGAS2096]
 gi|71854048|gb|AAZ52071.1| phage protein [Streptococcus pyogenes MGAS5005]
 gi|94542593|gb|ABF32642.1| phage protein [Streptococcus pyogenes MGAS9429]
 gi|94546484|gb|ABF36531.1| phage protein [Streptococcus pyogenes MGAS2096]
          Length = 384

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 99/395 (25%), Positives = 174/395 (44%), Gaps = 27/395 (6%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLE---QGVDAETV 59
           +HA LSASS+HRWL CP+ P LE+  P   ++Y  EGT AH L    L      +     
Sbjct: 5   NHALLSASSAHRWLYCPMLPRLEADYPSRDTVYTQEGTSAHELSEIKLMYKSGKITKRKF 64

Query: 60  SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSG---PFLSETEVPLEPFTTEPGATGTA 116
           +     F+ ++   + EM     +    V            E E  ++     PG  GT+
Sbjct: 65  NTLTKAFKENSDFYNEEMEEMTELYTDIVMEHLNAYEDAEIELEKRIDFSDWVPGGFGTS 124

Query: 117 DILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR 176
           D++I       I+D KYG G+PV A  N Q+ LYA GA   Y  ++     + +TIIQPR
Sbjct: 125 DVVILADGVIEIIDLKYGKGMPVSANQNPQMGLYALGAYASYDMVYDFDR-IKMTIIQPR 183

Query: 177 VRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV- 235
           + + S ++ +    ++LL  A          L + ++    +  + +++   ++      
Sbjct: 184 LDSVSSVDIY---VEELLYWADNV------VLPMAAQADAGIGDWNLSEKVLQWSPVAAK 234

Query: 236 -RCPALSRHVLLEATK--DPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQ 292
               A     L++     +P   +   +++     S IK +V++ E    K   +G E+ 
Sbjct: 235 LVPRAQENWELIDKYDYQEPVYLSDEAVAEILDKASAIKKWVESVEAYALKEALSGKEVP 294

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFK-RILKTPKELEQLYKEQKVSDEFWEE 351
           GY++VEGR  NR   +   A  +L     E+ +K + L +   LE++  ++     F + 
Sbjct: 295 GYKIVEGR-SNRVLTNKEAAATILEKNGFEDIYKPKELLSMGALEKMVGKK----RFEDM 349

Query: 352 LQELITRGDGKPVIAPRDIPTNK-QTQKSQLSEFE 385
           +  ++ +  GKPV+           + +  + EFE
Sbjct: 350 MAFILDKPQGKPVLVKNSDKRPALNSLEQAIKEFE 384


>gi|42779456|ref|NP_976703.1| hypothetical protein BCE_0375 [Bacillus cereus ATCC 10987]
 gi|42735372|gb|AAS39311.1| conserved hypothetical protein [Bacillus cereus ATCC 10987]
          Length = 362

 Score =  282 bits (722), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 93/352 (26%), Positives = 144/352 (40%), Gaps = 34/352 (9%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTS---------IYASEGTFAHNLLAHCLE 51
           M+ HA LSAS SHRWL C  +  LE +     S                    L  H L+
Sbjct: 1   MSDHAVLSASGSHRWLNCLPSARLELEFENNESNAAAEGTAAH---------ALCEHKLK 51

Query: 52  QGVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPG 111
           + +   +         ++           V       +      L   E  L+     P 
Sbjct: 52  KALHMRSKRPVSTYNNDEMEEHSDAYVEFVMEQFELAKQSCTDPLILIEQRLDFSCYVPQ 111

Query: 112 ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLT 171
             GT D +I    +  I+DFKYG GV V A +N Q+ LYA GAL  Y  ++   E +++T
Sbjct: 112 GFGTGDCIIIGDKKLHIIDFKYGMGVLVDAVDNPQMKLYALGALEIYDSLYD-IEEVSMT 170

Query: 172 IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
           I QPR      ++ W I   +L + A+         L  K+K+A   E   +  + C FC
Sbjct: 171 IFQPRREN---VSTWTIPVKELKDWAEN-------ELKPKAKKAYEGEGDYLPGEWCTFC 220

Query: 232 RAKVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NA 287
           RA V+C A +   L  A  +   P   T  E+ +  S +S +  +             N 
Sbjct: 221 RAAVKCRARAEEKLKLAQMEFKLPPLLTDSEIEEVLSKLSDLTKWANEIISYATDAAVNH 280

Query: 288 GDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLY 339
           G E  G+++VEGR   R +KD     E   +   ++ +++ L T  E+++L 
Sbjct: 281 GKEWHGFKVVEGR-SIRKYKDEEAVAEAAKANGYKDIYRQSLITLTEMQKLM 331


>gi|227497452|ref|ZP_03927684.1| phage-associated protein [Actinomyces urogenitalis DSM 15434]
 gi|226833077|gb|EEH65460.1| phage-associated protein [Actinomyces urogenitalis DSM 15434]
          Length = 312

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 72/322 (22%), Positives = 127/322 (39%), Gaps = 19/322 (5%)

Query: 66  FENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQ 125
            + +  +   +    V+  L   R          E  L+     PG  GT D +I     
Sbjct: 1   IDEEMEVHTDDYVQFVAQHLQSAREHCSDPQVYVEQRLDYSHLAPGGFGTGDCVIVAEPT 60

Query: 126 WIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINE 185
             ++D KYG GV V    N QLMLY  GAL  +  ++     ++L+I QPR      +  
Sbjct: 61  LQVIDLKYGMGVEVSPVENPQLMLYGLGALAAFDALYD-IREVSLSIFQPRRAN---VET 116

Query: 186 WVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVL 245
           W I  ++L+   +         +   ++ A            C+FCR    C A +   L
Sbjct: 117 WTIPVNELIAWGEN-------TVKPIAEIAAHGGGDYQAGPWCQFCRIAPTCRARAESNL 169

Query: 246 LEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKG 302
             A  +   P+  +  E++   + I  +K++    E     +  AG +I G+++V GR  
Sbjct: 170 ALAKHEFAPPAELSIAEVADVLAKIPELKAWASDVEAWALAKARAGTQIPGFKVVAGR-S 228

Query: 303 NRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGK 362
            R + D     E   +    + + + L     +E+L  +      F E L +L+ + +GK
Sbjct: 229 IRKYTDEAAVAEAAKAAGYSDIWDKRLIGITAMERLMGK----RAFTETLGDLVIKPEGK 284

Query: 363 PVIAPRDIPTNKQTQKSQLSEF 384
           P + P         + S  ++F
Sbjct: 285 PTLVPESDKRPALHRVSAATDF 306


>gi|259502606|ref|ZP_05745508.1| phage protein [Lactobacillus antri DSM 16041]
 gi|259169421|gb|EEW53916.1| phage protein [Lactobacillus antri DSM 16041]
          Length = 307

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 78/320 (24%), Positives = 137/320 (42%), Gaps = 20/320 (6%)

Query: 70  TRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIV 129
              +  + AS V       + ++       E  L+     P   GT D +I +     I+
Sbjct: 1   MEDLTDDYASYVLEQYHKAKEYAPDATIRVEQKLDFSKYVPEGFGTGDCVIVSDHLLHII 60

Query: 130 DFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVIS 189
           DFKYG GV V+A+NN Q+ LYA GAL  +G+++   E +  TI QPR+     I+ W I+
Sbjct: 61  DFKYGKGVRVEAKNNPQMKLYAIGALEMFGNLYNVDE-VETTIFQPRMAN---ISTWTIN 116

Query: 190 ADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL--SRHVLLE 247
           A +L+             L  K++ A + +        C+F        A     H L  
Sbjct: 117 AKELMHW-------ANTELKTKAELAFTGKGTVHYGPWCQFSTCNAVLRARFDYHHKLTR 169

Query: 248 AT-KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEIQGYQLVEGRKGNRS 305
              + P+  T  E+++    I  +  +    +D      +N G +  GY++VEGR   R 
Sbjct: 170 FQLRSPNLLTDSEVTEVLEHIDDLNRWAHEIKDYAADLAINNGKQWPGYKIVEGR-SVRH 228

Query: 306 FKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVI 365
           +KD     ++       + +++ L    +LE+   ++K ++ F +E    I +  GKP +
Sbjct: 229 YKDEAAVAKIAEEHGYHDIYQKKLLPITKLEKQVGKKKFTELFSQE----IVKPAGKPTL 284

Query: 366 APRDIPTNKQTQKSQLSEFE 385
            P        ++ +   EF+
Sbjct: 285 VPNSDQRQSISKSNPQDEFK 304


>gi|48697229|ref|YP_024959.1| hypothetical protein BcepC6B_gp39 [Burkholderia phage BcepC6B]
 gi|47779035|gb|AAT38398.1| gp39 [Burkholderia phage BcepC6B]
          Length = 455

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 121/438 (27%), Positives = 188/438 (42%), Gaps = 58/438 (13%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAE----- 57
            HA LS SS++ W++C  +   +   P  +S YA EGT AH L   CLE  +DAE     
Sbjct: 14  EHALLSPSSAYTWIECAASTAAQIGQPDESSEYADEGTAAHELAKWCLESVLDAESFLGT 73

Query: 58  -----------TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPF---------LS 97
                        + + +T    T  VD EMA+ V + +  VR               L 
Sbjct: 74  VIPVGTVTRRDEETGETITEPRRTFEVDEEMAAYVQLYIDGVRERVEALRLAGAEVTLLV 133

Query: 98  ETEVPLEPFTTEPGATGTADILIFN---STQ--WIIVDFKYGAGVPVKAENNTQLMLYAC 152
           E  + +E  T E GA GT+D +I       +    + D KYG GV V AE N Q M+YA 
Sbjct: 134 EQRLSIEHITGERGAKGTSDCVIIAVWPDGRAEIEVRDLKYGRGVAVSAERNPQAMIYAD 193

Query: 153 GALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEK----AKEFKERGTLAL 208
            A  ++   +     + + I QPRV      +EW  +A +L       AK   +R  L +
Sbjct: 194 AAHEEHSAFYDFDR-INIVIHQPRVNEKP--SEWATTATELHAWISETAKPAADRALLYV 250

Query: 209 SLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLE-----------------ATKD 251
                  +S   +   +  C+FC+AK  CPAL+ HV                       +
Sbjct: 251 DSVELAPLSPSDFNPGEKQCKFCKAKAVCPALAAHVEQTIGADFEALADDIYTQAKVGMN 310

Query: 252 PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINR 311
                   L   Y+S+ LI S+ KA    +   L     + G +LV GR+G R + D  +
Sbjct: 311 VDLLDNERLGVIYASLDLIDSWAKAVRGRIEHELLQARVVPGVKLVAGRRGARQWSDAEK 370

Query: 312 AQELLTSV--LGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRD 369
           A+ LL S+    ++ +   L +P + ++L + +  S   W++++  I + DG+P +AP  
Sbjct: 371 AEALLKSMRLKQDQMYNFKLISPTQADKLLRNE--SPRRWKKVEAEIVQRDGRPSVAPDS 428

Query: 370 IPTNKQTQKSQLSEFEVL 387
            P      +    +FEV 
Sbjct: 429 DPRPALEIQPPEDDFEVA 446


>gi|323173138|gb|EFZ58769.1| bbp38 [Escherichia coli LT-68]
          Length = 366

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 105/346 (30%), Positives = 159/346 (45%), Gaps = 36/346 (10%)

Query: 71  RIVDTEMASSVSMVLAYVRTFS--GPFLSETEVPLEPFTTEPGATGTADILIFNSTQWII 128
             VD EM  +V   +  V T +     L E  V     T    + GTAD +I    +  I
Sbjct: 18  PQVDDEMVEAVGRYVDTVWTLAQNNELLVEQRVDFSHITGVEESFGTADGIIIAGNELQI 77

Query: 129 VDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVI 188
            D KYG GV + AE N QL LYA GAL Q+  ++   E + L I QPR+     ++EW +
Sbjct: 78  HDLKYGKGVRIDAEQNEQLQLYALGALEQFSMLYDF-ETVRLFIHQPRLN---HVSEWSL 133

Query: 189 SADDLLEKAKEFKERGTLAL------SLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSR 242
           +  +L    +   E  T A+        +    + LE++   +  CRFC+AK  C A   
Sbjct: 134 TVQELQSFGERALEAATSAILVLNIAECEGIETLPLENFIPGEKQCRFCKAKAICTAQKM 193

Query: 243 HVLLEATKDP------------------STNTTVELSKAYSSISLIKSYVKACEDEMFKR 284
             L  A  D                      T  +L++ YS    I+S++KA  D +   
Sbjct: 194 QHLQTAASDFEDLTKPVSEIITNASARVPLLTIEQLAEIYSQADFIESWLKAVRDRVHNE 253

Query: 285 LNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTS---VLGEEAFKRILKTPKELEQLYKE 341
           LNAG  + G++LV G++GNR++ D   A+ LL        EE F   L +P + E+L   
Sbjct: 254 LNAGHPVPGFKLVTGKQGNRAWSDEEAARALLKDQFRYKTEEVFDFKLISPTKAEKLI-- 311

Query: 342 QKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           +K S   W +++ LITR DGKP + P   P       + +++F+ +
Sbjct: 312 KKASPRRWSKVEALITRADGKPTVVPESDPHPALNI-NPVNDFDDV 356


>gi|302206576|gb|ADL10918.1| Phage-associated protein [Corynebacterium pseudotuberculosis C231]
 gi|308276819|gb|ADO26718.1| phage-associated protein [Corynebacterium pseudotuberculosis I19]
          Length = 337

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 93/366 (25%), Positives = 147/366 (40%), Gaps = 52/366 (14%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV-DAETVSH 61
            HA LSAS +HRWL  P + TLE+ +P+++S  A +GT AH      L + + DA T   
Sbjct: 4   QHALLSASGAHRWLAYPPSATLEAGLPESSSSAAEQGTAAHEFAEWKLRRALHDAPTAKP 63

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIF 121
                + +T  +  +  + V  +L  VR          E  L+     PG  GT D +I 
Sbjct: 64  VSSWHDAETEALTDDYVAFVQELLRDVRQVCADPQVLIEQRLDFSHVVPGGFGTGDCVII 123

Query: 122 NSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGS 181
                 I+D KYG  V V+AE N QLMLYA  AL+ +G +    + + +TI QP      
Sbjct: 124 AEPLLHIIDLKYGQSVMVEAEQNPQLMLYALSALNAFGSL-HDIDQVAVTIFQPSRSN-- 180

Query: 182 PINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALS 241
            I+   IS  DL   A++                                         +
Sbjct: 181 -ISTCTISVTDLEAWAEKVV------------------------------------KPRA 203

Query: 242 RHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEIQGYQLV 297
              L+ A  +   P+     E+++    +  + ++    E       +N G    G++LV
Sbjct: 204 EANLVLAKHEFAPPAELGDAEIAQVLYRLPSLSAWATDAEAHALSLAVNQGKTWPGFKLV 263

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEA--FKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           EGR   R + D +   E+  +    +   +   LKT   LE+   ++     F E L +L
Sbjct: 264 EGR-SIRKYADESAVAEMAGTGGITDIYDYDHKLKTITTLEKQAGKK----RFTELLGDL 318

Query: 356 ITRGDG 361
           +    G
Sbjct: 319 VVEPAG 324


>gi|302331131|gb|ADL21325.1| phage-associated protein [Corynebacterium pseudotuberculosis 1002]
          Length = 337

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 93/366 (25%), Positives = 147/366 (40%), Gaps = 52/366 (14%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV-DAETVSH 61
            HA LSAS +HRWL  P + TLE+ +P+++S  A +GT AH      L + + DA T   
Sbjct: 4   QHALLSASGAHRWLAYPPSATLEAGLPESSSSAAEQGTAAHEFAEWKLRRALHDAPTAKP 63

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIF 121
                + +T  +  +  + V  +L  VR          E  L+     PG  GT D +I 
Sbjct: 64  VPSWHDAETEALTDDYVAFVQELLRDVRQVCADPQVLIEQRLDFSHVVPGGFGTGDCVII 123

Query: 122 NSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGS 181
                 I+D KYG  V V+AE N QLMLYA  AL+ +G +    + + +TI QP      
Sbjct: 124 AEPLLHIIDLKYGQSVMVEAEQNPQLMLYALSALNAFGSL-HDIDQVAVTIFQPSRSN-- 180

Query: 182 PINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALS 241
            I+   IS  DL   A++                                         +
Sbjct: 181 -ISTCTISVTDLEAWAEKVV------------------------------------KPRA 203

Query: 242 RHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEIQGYQLV 297
              L+ A  +   P+     E+++    +  + ++    E       +N G    G++LV
Sbjct: 204 EANLVLAKHEFAPPAELGDAEIAQVLYRLPSLSAWATDAEAHALSLAVNQGKTWPGFKLV 263

Query: 298 EGRKGNRSFKDINRAQELLTSVLGEEA--FKRILKTPKELEQLYKEQKVSDEFWEELQEL 355
           EGR   R + D +   E+  +    +   +   LKT   LE+   ++     F E L +L
Sbjct: 264 EGR-SIRKYADESAVAEMAGTGGITDIYDYDHKLKTITTLEKQAGKK----RFTELLGDL 318

Query: 356 ITRGDG 361
           +    G
Sbjct: 319 VVEPAG 324


>gi|332088058|gb|EGI93183.1| bbp38 [Shigella boydii 5216-82]
          Length = 343

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 102/340 (30%), Positives = 156/340 (45%), Gaps = 36/340 (10%)

Query: 77  MASSVSMVLAYVRTFSG--PFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYG 134
           M  +V   +  V T +     L E  V     T    + GTAD +I    +  I D KYG
Sbjct: 1   MVEAVGRYVDTVWTLAKNNELLVEQRVDFSHITGVEESFGTADGIIIAGNELQIHDLKYG 60

Query: 135 AGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLL 194
            GV + AE N QL LYA GAL Q+  ++   E + L I QPR+     ++EW ++  +L 
Sbjct: 61  KGVRIDAEQNEQLQLYALGALEQFSMLYDF-ETVRLFIHQPRLN---HVSEWSLTVQELQ 116

Query: 195 EKAKEFKERGTLAL------SLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEA 248
              +   E  T A+        +    + LE++   +  CRFC+AK  C A     L  A
Sbjct: 117 SFGERALEAATSAILVLNIAECEGIETLPLENFIPGEKQCRFCKAKAICTAQKMQHLQTA 176

Query: 249 TKDP------------------STNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDE 290
             D                      T  +L++ YS    I+S++KA  D +   LNAG  
Sbjct: 177 ASDFEDLTKPVSEIITNASARVPLLTIEQLAEIYSQADFIESWLKAVRDRVHNELNAGHP 236

Query: 291 IQGYQLVEGRKGNRSFKDINRAQELLTS---VLGEEAFKRILKTPKELEQLYKEQKVSDE 347
           + G++LV G++GNR++ D   A+ LL        EE F   L +P + E+L   +K S  
Sbjct: 237 VPGFKLVTGKQGNRAWSDEEAARALLKDQFRYKTEEVFDFKLISPTKAEKLI--KKASPR 294

Query: 348 FWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
            W +++ LITR DGKP + P   P       + +++F+ +
Sbjct: 295 RWSKVEALITRADGKPTVVPESDPRPALNI-NPVNDFDDV 333


>gi|331007089|ref|ZP_08330313.1| Phage protein [gamma proteobacterium IMCC1989]
 gi|330419106|gb|EGG93548.1| Phage protein [gamma proteobacterium IMCC1989]
          Length = 388

 Score =  256 bits (654), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 115/408 (28%), Positives = 177/408 (43%), Gaps = 46/408 (11%)

Query: 1   MAH--HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET 58
           M    HA LSAS SHRWL CP +  +E   P TTS +A EG+ AH+L   CL +  + + 
Sbjct: 1   MTELIHAKLSASGSHRWLNCPASARMEEGFPDTTSSFAEEGSAAHHLAEICLREEKNTDE 60

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
               +     +   VD EM  SV + L YVR   G  L E  V   P+   P   GT+D 
Sbjct: 61  FLECQFDEYPEHP-VDVEMVESVQLYLDYVRNLDGELLVEQRVDFSPWV--PEGFGTSDA 117

Query: 119 LIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
           ++ +     +VD KYG GV V AE+NTQ MLYA GAL++Y  I+   +   + I+QPR+ 
Sbjct: 118 IVMHEGVATVVDLKYGKGVRVDAEDNTQAMLYALGALNEYDFIY-ECDLFRVVIVQPRLD 176

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND-DSCRFCRAKVRC 237
               I+EW I   DLLE A+         +  K++  +  E         C FC+A   C
Sbjct: 177 ---HISEWEIKRSDLLEWAEN-------TVKPKAELTLQEEAPFNPGEKQCHFCKANGTC 226

Query: 238 PALSRHVLLEAT------------KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL 285
            AL+ H L  A             KD +  +  E++     +  +  +V A E       
Sbjct: 227 KALAEHALQIAADGFEAVEVPLTVKDITKLSNEEIAVLLPQLKTLTKWVSALETHAQAEA 286

Query: 286 NAGDEIQGYQ--LVEGRKGNRSFKDINRAQELL----TSVLGEEAFKRILKTPKELEQLY 339
             G++   ++  L  G+   RS+K+ + A+  L      +  EE       +P + E++ 
Sbjct: 287 EKGEKFPNHKVILKNGQTS-RSWKNDDSAKRALNREFKKLGKEEP-TSNPISPAQAEKII 344

Query: 340 KEQKVSDEFWEELQELITRGDG--KPVIAPRDIPTNKQTQKSQLSEFE 385
            +            + + +  G  K  +       +     +   +FE
Sbjct: 345 GKT------NPLFDKHVVKTTGDAKYKLVHESAKGDPVEI-NPTEDFE 385


>gi|318064640|gb|ADV36549.1| gp43 [Edwardsiella phage eiMSLS]
          Length = 419

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 106/408 (25%), Positives = 164/408 (40%), Gaps = 38/408 (9%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            HA LS SS+ +WL CP A T E  IP  ++  A  GT  H +        +        
Sbjct: 19  EHALLSPSSAKKWLGCPAALTAEIGIPNPSNPAAEAGTAMHAVAEIMANNLIRDGESKAA 78

Query: 63  KL----------TFENDTRIVDTEMASSVSMVLAYVRT----FSGPFLSETEVPLEPFTT 108
                       T ++       EMA  V   +                E+ V L     
Sbjct: 79  SEFVGGYPLHTPTKKSKGPKFTDEMAKMVQGYIDTCVAPLVDAGAEVYIESRVDLSRPLG 138

Query: 109 EPGATGTADILIFNS-----TQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFG 163
            P   GTAD++            I+ D K G   PV A+ N Q+M+YA G L++Y     
Sbjct: 139 APNTFGTADLVAVTELTDGSNMLIVGDLKTGRH-PVDAKENRQMMIYALGLLNKYRFS-H 196

Query: 164 RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKER--GTLALSLKSKRAVSLEHY 221
               + L I QP       ++EW  SA+ +    K  K+R    LA     K A+    +
Sbjct: 197 DITKVRLMIYQPFCGG---VSEWDTSAEVIETFGKFAKDRAAKALACHAAGKAALKPGDF 253

Query: 222 GVNDDSCRFCRAKVRCPALSRHVLLEATKDPST-----NTTVELSKAYSSISLIKSYVKA 276
             + D+C++CR + +C A  +     A  D         T  EL++AY+ +  ++ ++K 
Sbjct: 254 RPSADACQWCRFREKCNAARKFNEQIAADDLRDESGDEMTPEELAEAYAKLPALRQHIKN 313

Query: 277 CEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKE 334
            E   +K L AG ++ G +LV G+ GNR++ D    Q  L       +  + + L TP +
Sbjct: 314 IESATYKALLAGTKLPGLKLVAGKDGNRTWSDEALVQLRLEQGGVTPDAMYTQKLLTPTQ 373

Query: 335 LEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLS 382
            E+            E ++ELITR  G+P IA  D    +    +   
Sbjct: 374 AEKALPAGAF-----EWVEELITRKPGEPSIASADDKRPEYVPVNDDD 416


>gi|318064536|gb|ADV36497.1| gp43 [Edwardsiella phage eiDWF]
          Length = 419

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 106/400 (26%), Positives = 163/400 (40%), Gaps = 38/400 (9%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            HA LS SS+ +WL CP A T E  IP  ++  A  GT  H +        +        
Sbjct: 19  EHALLSPSSAKKWLGCPAALTAEIGIPNPSNPAAEAGTAMHAVAEIMANNLIRDGESKAA 78

Query: 63  KL----------TFENDTRIVDTEMASSVSMVLAYVRT----FSGPFLSETEVPLEPFTT 108
                       T ++       EMA  V   +                E+ V L     
Sbjct: 79  SEFVGGYPLHTPTKKSKGPKFTDEMAKMVQGYIDTCVAPLVDAGAEVYIESRVDLSRPLG 138

Query: 109 EPGATGTADILIFNS-----TQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFG 163
            P   GTAD++            I+ D K G   PV A+ N Q+M+YA G L++Y     
Sbjct: 139 APNTFGTADLVAVTELTDGSNMLIVGDLKTGRH-PVDAKENRQMMIYALGLLNKYRFS-H 196

Query: 164 RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKER--GTLALSLKSKRAVSLEHY 221
               + L I QP       ++EW  SA+ +    K  K+R    LA     K A+    +
Sbjct: 197 DITKVRLMIYQPFCGG---VSEWDTSAEVIETFGKFAKDRAAKALACHAAGKAALKPGDF 253

Query: 222 GVNDDSCRFCRAKVRCPALSRHVLLEATKDPST-----NTTVELSKAYSSISLIKSYVKA 276
             + D+C++CR + +C A  +     A  D         T  EL++AY+ +  ++ ++K 
Sbjct: 254 RPSADACQWCRFREKCNAARKFNEQIAADDLRDESGDEMTPEELAEAYAKLPALRQHIKN 313

Query: 277 CEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFKRILKTPKE 334
            E   +K L AG ++ G +LV G+ GNR++ D    Q  L       +  + + L TP +
Sbjct: 314 IESATYKALLAGTKLPGLKLVAGKDGNRTWSDEALVQLRLEQGGVTPDAMYTQKLLTPTQ 373

Query: 335 LEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNK 374
            E+            E ++ELITR  G+P IA  D    +
Sbjct: 374 AEKALPAGAF-----EWVEELITRKPGEPSIASADDKRPE 408


>gi|282534224|gb|ADA82332.1| hypothetical protein [Escherichia phage K1H]
          Length = 416

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 108/416 (25%), Positives = 168/416 (40%), Gaps = 51/416 (12%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
           HA LS S + +WL C  +   E  IP T+   A  GT  H +    L Q +    +  ++
Sbjct: 13  HALLSPSGAKKWLACSASLACEKDIPNTSGKAAVTGTACHTIAEMHLNQYIKGTALPLER 72

Query: 64  LTFENDTRI-----------------VDTEMASSVSMVLAYVRTFSG---PFLSETEVPL 103
                                     + T+M   V     Y +           E  V L
Sbjct: 73  EVGAYVLDEGKGQIKALISPMKGAVLITTDMIEQVRKYTDYCKAIIDVATYAKLEMRVNL 132

Query: 104 E----PFTTEPGATGTADILIF------NSTQWIIVDFKYGAGVPVKAENNTQLMLYACG 153
                P        GTAD++        +    II D K G    V+A+ N QLMLYA G
Sbjct: 133 TEVLHPGYEGVETFGTADLVAVQELANTDEHMLIIGDLKTGRH-RVEAKENKQLMLYALG 191

Query: 154 ALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSL--K 211
              +    +     + L I QP        +EW IS + L   AK  ++R  LAL    +
Sbjct: 192 VYRRLKRRYN-ITTVRLVIFQPYAGGA---SEWDISVEGLELFAKFAQKRALLALDAYFR 247

Query: 212 SKRAVSLEHYGVNDDSCRFCRAKVRCPALS---RHVLLEATKDPS--TNTTVELSKAYSS 266
            K+ +    +  + D C++CR   +C A +     VL E  +D      TT +L   Y  
Sbjct: 248 GKKNLKASDFKPSVDGCQWCRFSEQCAARTKTVNSVLAEELEDDFVLELTTEQLVVEYEK 307

Query: 267 ISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFK 326
           + L++ ++   E  M   L++G ++ GY+LVEGR+GNR++KD +  +     +L     K
Sbjct: 308 LPLLRQHIDKVEKAMSAALHSGKKVPGYKLVEGRQGNRAWKDADAIEVSHGDILK----K 363

Query: 327 RILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLS 382
            +L TP E  ++    ++       L+  ITR  G P +A  D    +  Q S+  
Sbjct: 364 EVLMTPTEAAKVLSADEM-----AALEPFITRKPGAPCVATADDKRPEWNQVSEED 414


>gi|227496455|ref|ZP_03926739.1| phage-associated protein [Actinomyces urogenitalis DSM 15434]
 gi|226834037|gb|EEH66420.1| phage-associated protein [Actinomyces urogenitalis DSM 15434]
          Length = 342

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 96/359 (26%), Positives = 150/359 (41%), Gaps = 30/359 (8%)

Query: 31  TTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRT 90
            TS  A EGT AH +    L   +  E            +   + EM  +    +  V+T
Sbjct: 5   PTSEAAKEGTRAHAMAEAKLRAWLGHEEP--------PSSDDPEPEMDEATDAYVDLVKT 56

Query: 91  FSGPF--LSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLM 148
            +         E  L+     PG  GTAD +I +     +VD KYG GV V+AE N QL 
Sbjct: 57  IAQELHGTVAVEQHLDLGRIIPGGFGTADAVIVSEPVLHVVDLKYGRGVRVEAEGNPQLR 116

Query: 149 LYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLAL 208
           LYA GAL  +  ++   E + +TI+QPR+     ++   +S  DL E  +         +
Sbjct: 117 LYALGALAAFEPLYD-VETVRMTIVQPRLD---AVSTAEMSRTDLEEWGRTV-------V 165

Query: 209 SLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEATKDP---STNTTVELSKAYS 265
           +  +K A+         D CR+CRAK  C A +   L  A ++       T  EL+   +
Sbjct: 166 APAAKAALDGTGVFRAGDWCRWCRAKAICRARAEENLALARREMAPAPALTPEELADVIT 225

Query: 266 SISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAF 325
               + ++VK  E+     L AG+ + G +LV GR G R+F D   A +           
Sbjct: 226 RGRRLAAWVKDVEEHATAALTAGEGVPGLKLVAGR-GRRAFTDAEAAADAAEKAGYVSR- 283

Query: 326 KRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +        +E+    +     F E L +L+T+ +G P++     P       +  SEF
Sbjct: 284 ETRPLPLSAIEKAMGRK----RFAEVLGDLVTKTEGVPLLVAASDPRPAWEPVTPQSEF 338


>gi|282535274|gb|ADA82480.1| hypothetical protein [Escherichia phage K1ind3]
 gi|282547375|gb|ADA82431.1| hypothetical protein [Escherichia phage K1ind2]
          Length = 416

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 106/416 (25%), Positives = 166/416 (39%), Gaps = 51/416 (12%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
           HA LS S + +WL C  +   E  IP T+   A  GT  H +    L Q +    +  ++
Sbjct: 13  HALLSPSGAKKWLACSASLACEKDIPNTSGKAAVLGTAMHTIAEMHLNQYIKGTALPLER 72

Query: 64  LTFENDTRI-----------------VDTEMASSVSMVLAYVRTFSG---PFLSETEVPL 103
                                     +  +M   V     + +           E  V L
Sbjct: 73  EVGAYVLDEGKGQIKALSSPMKGAVLITADMIEQVRKYTDHCKAVIDVATYAKLEMRVNL 132

Query: 104 E----PFTTEPGATGTADILIF------NSTQWIIVDFKYGAGVPVKAENNTQLMLYACG 153
                P        GTADI+        +    II D K G    V+A+ N QLMLYA G
Sbjct: 133 TEVLHPGYEGVETFGTADIVAVQELANTDEHMLIIGDLKTGRH-RVEAKENKQLMLYALG 191

Query: 154 ALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSL--K 211
              +    +     + L I QP        +EW IS + L   AK  ++R  LAL    +
Sbjct: 192 VYRRLKRRYN-ITVVRLVIFQPYAGGA---SEWDISVEGLELFAKFAQKRALLALDAYFR 247

Query: 212 SKRAVSLEHYGVNDDSCRFCRAKVRCPALS---RHVLLEATKDPS--TNTTVELSKAYSS 266
            K+ +    +  + D C++CR   +C A +     VL E  +D      TT +L   Y  
Sbjct: 248 GKKNLKASDFKPSVDGCQWCRFSEQCAARTKTVNSVLAEELEDDFVLELTTEQLVVEYEK 307

Query: 267 ISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFK 326
           + L++ ++   E  M   L++G ++ GY+LVEGR GNR++KD +  +     +L     K
Sbjct: 308 LPLLRQHIDKVEKAMSATLHSGKKVPGYKLVEGRPGNRAWKDADAIEVSHGDILK----K 363

Query: 327 RILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLS 382
            +L +P E  ++    ++       L+  ITR  G P +A  D    +  Q S+  
Sbjct: 364 EVLMSPTEAAKVLSADEM-----AALEPFITRKPGAPCVATADDKRPEWNQVSEED 414


>gi|282533173|gb|ADA82282.1| hypothetical protein [Escherichia phage K1G]
          Length = 416

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 106/416 (25%), Positives = 167/416 (40%), Gaps = 51/416 (12%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
           HA LS S + +WL C  +   E  IP T+   A  GT  H +    L Q +    +  ++
Sbjct: 13  HALLSPSGAKKWLACSASLACEKDIPNTSGKAAVTGTACHTIAEMHLNQYIKGTALPLER 72

Query: 64  LTFENDTRI-----------------VDTEMASSVSMVLAYVRTFSG---PFLSETEVPL 103
                                     +  +M   V     Y +           E  V L
Sbjct: 73  EVGAYVLDEGKGQIKALISPMKGAVLITADMIEQVRKYTDYCKAIIDVATYAKLEMRVNL 132

Query: 104 E----PFTTEPGATGTADILIF------NSTQWIIVDFKYGAGVPVKAENNTQLMLYACG 153
                P        GTAD++        +    II D K G    V+A+ N QLMLYA G
Sbjct: 133 TEVLHPGYEGVETFGTADLVAVQELANTDEHMLIIGDLKTGRH-RVEAKENKQLMLYALG 191

Query: 154 ALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSL--K 211
              +    +     + L I QP        +EW IS + L   AK  ++R  LAL    +
Sbjct: 192 VYRRLKRRYN-ITVVRLVIFQPYAGGA---SEWDISVEGLELFAKFAQKRALLALDAYFR 247

Query: 212 SKRAVSLEHYGVNDDSCRFCRAKVRCPALS---RHVLLEATKDPS--TNTTVELSKAYSS 266
            K+ +    +  + D C++CR   +C A +     VL E  +D      TT +L   Y  
Sbjct: 248 GKKNLKASDFKPSVDGCQWCRFSEQCAARTKTVNSVLAEELEDDFVLELTTEQLVVEYEK 307

Query: 267 ISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFK 326
           + L++ ++   E  M   L++G+++ GY+LVEGR GNR++KD +  +     +L     K
Sbjct: 308 LPLLRQHIDKVEKAMSAALHSGNKVPGYKLVEGRLGNRAWKDADAIEVSHGDILK----K 363

Query: 327 RILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLS 382
            +L +P E  ++    ++       L+  ITR  G P +A  D    +  Q S+  
Sbjct: 364 EVLMSPTEAAKVLSADEM-----AALEPFITRKPGAPCVATADDKRPEWNQVSEED 414


>gi|62327347|ref|YP_224060.1| hypothetical protein BPKS7gp38 [Salmonella phage SS3e]
 gi|57472381|gb|AAW51243.1| hypothetical protein [Salmonella phage SS3e]
          Length = 427

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 110/423 (26%), Positives = 171/423 (40%), Gaps = 49/423 (11%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLE-----QGVDAET 58
           HA LS S + +WL C  +   E  IP T+   A  GT  H +    L        +  E 
Sbjct: 13  HALLSPSGAKKWLSCAASLACEKDIPNTSGKSAVLGTAMHTIAEVHLNAYIRGTALPLER 72

Query: 59  VSHQKLTFENDTRI------------VDTEMASSVSMVLAYVRTFSG---PFLSETEVPL 103
                +  E   +I            +  +M   V     Y +           E  V L
Sbjct: 73  EVGAYVLDEGKGQIKALISPMKGAVLITADMIEQVRKYTDYCKPIIDVATYAKLEMRVNL 132

Query: 104 E----PFTTEPGATGTADILIF------NSTQWIIVDFKYGAGVPVKAENNTQLMLYACG 153
                P        GTAD++        +    II D K G    V+A+ N QLMLYA G
Sbjct: 133 TEVLHPGYEGVETFGTADLVAVQELANTDEHMLIIGDLKTGRH-RVEAKENKQLMLYALG 191

Query: 154 ALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSL--K 211
              +    +     + L I QP        +EW IS + L   AK  ++R  LAL    +
Sbjct: 192 VYRRLKRRYS-ITVVRLVIFQPYAGGA---SEWDISVEGLELFAKFAQKRALLALDAYFR 247

Query: 212 SKRAVSLEHYGVNDDSCRFCRAKVRCPALS---RHVLLEATKDPSTN--TTVELSKAYSS 266
            K+ +    +  + D C++CR   +C A +      L E  +D      T  +L   Y  
Sbjct: 248 GKKNLKASDFKPSVDGCQWCRFSEQCAARTKTVNSSLAEELEDDFALELTPEQLVAEYEK 307

Query: 267 ISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLT--SVLGEEA 324
           + L++ ++   E  M   L++G ++ GY+LVEGR GNR++KD +   E L+   +  E  
Sbjct: 308 LPLLRQHIDKVEKAMATTLHSGKKVPGYKLVEGRPGNRAWKDTDALLETLSHFELGAEML 367

Query: 325 FKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
            K +L TP E E+ +K      E W  L++ +TR  G P +   +    +    ++  + 
Sbjct: 368 HKEVLMTPTEAEKQHK----GSELWAALEKHVTRKPGAPCVTTVEDKRPEWKNVTE-DDL 422

Query: 385 EVL 387
           E L
Sbjct: 423 EAL 425


>gi|288799803|ref|ZP_06405262.1| putative protein p51 [Prevotella sp. oral taxon 299 str. F0039]
 gi|288333051|gb|EFC71530.1| putative protein p51 [Prevotella sp. oral taxon 299 str. F0039]
          Length = 376

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 92/389 (23%), Positives = 153/389 (39%), Gaps = 41/389 (10%)

Query: 23  TLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDA---------------ETVSHQKLTFE 67
            LE      TS  A EGT AH + A  L +                   + +  + +T E
Sbjct: 2   KLEELFEDKTSEAAQEGTIAHEIAAVRLNEAQTNGLLKPLKKTTLNAICKKLEGEGITKE 61

Query: 68  NDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
               +V  EM +       +V       R  +   + + E  L          GT D  I
Sbjct: 62  FFNEVVTPEMLNYCEDYAQFVCDKLIEARAKTPDTILQVEKKLNANYYGKDMFGTTDAAI 121

Query: 121 FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
            + T   I+D KYG GV V A +N Q+M+YA   +  Y  ++   E++T+TI QPR+   
Sbjct: 122 ISDTALEIIDLKYGQGVKVSAIDNAQMMIYALANIQAYEILYNF-ESVTMTIYQPRMGN- 179

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             I+   +S  DL +  +E        L   + +A   E        C FC+AK  C   
Sbjct: 180 --ISTSTMSVQDLKQWGEE-------YLKPLADKAYKGEGVQSCGSWCGFCKAKTSCAEQ 230

Query: 241 SRHVL-LEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEG 299
            R +  LE  K     T  E ++       + +++ A   ++ +R   G+  +G +LVEG
Sbjct: 231 GRELKGLEELKQKELLTKEEQAEIVLKAPQVIAWLNAVVKDVTERAKQGEAFEGLKLVEG 290

Query: 300 RKGNRSFKDINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSDEFWEELQELIT 357
           R   R   D     + LT+    E   ++  L T   +++L  ++     F E++     
Sbjct: 291 R-SVRKIVDPENLVKALTAKGYTEAQLYESKLITLTAMQKLLGKKA----FTEDVVPYTI 345

Query: 358 RGDGKPVIAPRDIPTNKQTQKSQLSEFEV 386
           +  G   +   D P  + T K   +  ++
Sbjct: 346 KPVGALQLVSLDDPRPEATAKDDFNNTDI 374


>gi|255994006|ref|ZP_05427141.1| hypothetical protein GCWU000322_00063 [Eubacterium saphenum ATCC
           49989]
 gi|255993674|gb|EEU03763.1| hypothetical protein GCWU000322_00063 [Eubacterium saphenum ATCC
           49989]
          Length = 351

 Score =  234 bits (596), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 93/366 (25%), Positives = 156/366 (42%), Gaps = 28/366 (7%)

Query: 24  LESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDT-RIVDTEMASSVS 82
           +E   P  +S YA EG  AH      L++ +  +         E +    V   +   + 
Sbjct: 1   MEEAFPDKSSAYAEEGALAHGYAEKVLKKALKGDIPIRLLGRMEEEMRDAVMDYVQKCLD 60

Query: 83  MVLAYVRTFSGPFLSETEVPLEPFTTEP---GATGTADILIFNSTQWIIVDFKYGAGVPV 139
           +      + +   +    V +E   + P      GT D    N+    IVDFKYG G  V
Sbjct: 61  ISTDLGESRTDDNIGTVAVAVEGTVSIPCIPEGFGTIDFAAHNNETQAIVDFKYGKGNKV 120

Query: 140 KAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKE 199
            A+ N QLMLYA G L          + + L I+QPR+     I+    +  ++ E   +
Sbjct: 121 YAKGNPQLMLYASGCLADLPS----IKNVRLIIVQPRLE---HIDVAEYTRAEIEEFEAK 173

Query: 200 FKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEATK--DPSTNTT 257
                       +++A   E   V+ + C+FC AK  C   ++ +     K   P   TT
Sbjct: 174 I--------KPIAEKAFRGEGDFVSGEHCKFCSAKAVCTTHAKDIATTEPKMIAPKELTT 225

Query: 258 VELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLT 317
            E+++      LI  ++ A +  +     AG E++GY+ VEGR   R + D ++A ELL 
Sbjct: 226 DEVAELIPRAELIADWLAAAKQYLLGECLAGREVKGYKAVEGRA-IRVWSDQDKALELLE 284

Query: 318 SVLGEE--AFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQ 375
               ++   ++    +  +LE++  ++    EF E + E ITR  GKP +AP D      
Sbjct: 285 QAGYDKALIYESAPLSLAKLEKMVGKK----EFGELVGEYITRKTGKPTLAPEDDKRPAL 340

Query: 376 TQKSQL 381
             K+++
Sbjct: 341 KSKAEV 346


>gi|83311035|ref|YP_421299.1| hypothetical protein amb1936 [Magnetospirillum magneticum AMB-1]
 gi|82945876|dbj|BAE50740.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 397

 Score =  232 bits (591), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 97/395 (24%), Positives = 158/395 (40%), Gaps = 40/395 (10%)

Query: 10  SSSHRWLKCPIAPTLESKIP-QTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFEN 68
           SS  R+  CP +     K P +  S YA EGT AH      L QG+DA  +  +K+    
Sbjct: 19  SSYSRYAACPGSIRECRKAPPEKPSPYAEEGTDAHECGEIGLRQGIDAIELIDRKVGGS- 77

Query: 69  DTRIVDTEMASSVSMVLAYVR---TFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQ 125
              IVD +MA++V + L + R           E  V L P           D   +  + 
Sbjct: 78  ---IVDEDMAAAVQVYLDFCRSQIEDGDIVFVELPVDLAPLNPPVPLRSRLDFARYRPST 134

Query: 126 --WIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR-VRTGSP 182
              ++ D+K+G GV V+   N QL  YA GA  +   +      + + I+QPR      P
Sbjct: 135 KALLVTDYKHGQGVAVEVHGNGQLRGYALGACVELDKLGHVVSEVQIAIVQPRAYHEDGP 194

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSR 242
           I   VISA +L E + +  +     L   +             D CRFC+AK  CP + R
Sbjct: 195 IRFEVISAFELFEWSVDLFDVINRTLEPDAPLVA--------GDHCRFCKAKPVCPEMER 246

Query: 243 HVLLEATKDPST-----------NTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEI 291
             L  A    +             T   + +  ++  +I+ ++K+  +     L  G EI
Sbjct: 247 MALTTAEAQFTDTTITVPPAPSSMTPARIGQVLNAAEIIEGWLKSVREHAHASLEQGVEI 306

Query: 292 QGYQLVEGRKGNRSFKDINRAQELLTSVL--GEEAFKRILKTPKELEQLYKEQKVSDEFW 349
            G++LV  R   R + D + A + L +      + + R + +P   E+L  +QK      
Sbjct: 307 PGWKLVPKRA-QRKWADDDLASDALLTAGLPILDIYARKIISPAAAEKLLGKQK------ 359

Query: 350 EELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           + ++ L+        +AP              ++F
Sbjct: 360 DAIKHLVVAESSGTTLAPAGDKRQAV-AGGAAADF 393


>gi|91214215|ref|NP_919005.2| conserved phage protein [Burkholderia phage BcepNazgul]
 gi|88604908|gb|AAQ63372.2| conserved phage protein [Burkholderia phage BcepNazgul]
          Length = 454

 Score =  229 bits (585), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 98/441 (22%), Positives = 156/441 (35%), Gaps = 70/441 (15%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH 61
             H+  S S+S  WL C  +              A+ GT AH +    L+ G+  + +  
Sbjct: 18  GGHSVFSPSASAMWLTCAGSLLANLAAEDNAGEDAAYGTVAHGVSETWLKTGIRPDHLLG 77

Query: 62  QKLTFEN----DTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTAD 117
                          +D EM   V+  + + ++  G    E  V     T  P   GT D
Sbjct: 78  TVEQVAEGKTVFDITIDAEMMEYVAQSVEWAQSLPGDLHIEKRVYFSQLTPIPRQGGTMD 137

Query: 118 ILIFNSTQWIIVDFKYGAGVPVKA-------------------ENNTQLMLYACGALHQY 158
           +  F      I D K+G GV V A                     N+Q MLYA GAL++Y
Sbjct: 138 VGGFEPGVMHIFDHKFGRGVQVFAALRLDDPRSIIVENGKTIINGNSQAMLYALGALYEY 197

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
             I+G    + + I QPR+   +    W  + ++LL  A   K R  LA           
Sbjct: 198 DWIYGF-RKIVIYISQPRL---AHFQTWETTREELLRFADFVKVRAFLAWQ-------KG 246

Query: 219 EHYGVNDDSCRFCRAKVRCPA-------------------------------LSRHVLLE 247
                +D  CRFC+ +  CPA                               L R  L  
Sbjct: 247 APLTPSDKGCRFCKVQKTCPALLAMAHRLSDDCFDDLTAEVTAEQMSSSKEVLMRGELST 306

Query: 248 ATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFK 307
                S  +T +++K      + + +    + E+ +R + G++I G +LV  R   R   
Sbjct: 307 KLLPVSELSTEQMAKLLPYRKVFERWFSEMDSELERRAHNGEDIPGMKLVASRSNRRWNV 366

Query: 308 DINRAQELLTSVLGEE--AFKRILKTPKELEQLYKEQKVSDEFWE-ELQELITRGDGKPV 364
              +A E LT +  +E   F     +P + E+L     +  +  E  +  L+ +  GK  
Sbjct: 367 QQAKAVETLTFLGVKENALFSTDFVSPAKAEELLVASGMRKKAAEKIIAPLVAKAPGKAT 426

Query: 365 IAPRDIPTNKQ--TQKSQLSE 383
           +AP      K          +
Sbjct: 427 LAPVADTREKLGQVADDCFDD 447


>gi|269975291|gb|ACZ55515.1| conserved phage protein [Staphylococcus phage SA1]
          Length = 445

 Score =  228 bits (582), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 105/443 (23%), Positives = 173/443 (39%), Gaps = 72/443 (16%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESK-IPQTTSIY-ASEGTFAHNLLAHCLEQGVDAETV 59
             H+  + S+S RW+ C  +  L +       +IY A+EGT AH +    L   V    +
Sbjct: 17  GGHSIFAPSASARWMACSGS--LIAGLFEHDETIYEAAEGTVAHGIAEQWLRTDVRPTHL 74

Query: 60  SHQKLTFEN----DTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT-- 113
                T           +   M   V   + + R   G   +E  V              
Sbjct: 75  IGTVETITEGDVSHDIPITRSMIDYVQEYVDWCRFEEGEMFTEIRVWFTDLMPRANPDEP 134

Query: 114 -----------GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIF 162
                      GTAD +I      I+ D KYG GV V AE N Q +LYA GA   + D +
Sbjct: 135 DEEPEEFVAQGGTADNIIIRDRTLIVTDLKYGTGVQVFAEGNPQALLYAYGAYRAFADEY 194

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
              + + + I QPR+      + W I+ D+LLE A+  +ER   A SL + R  SL+   
Sbjct: 195 -EFDRIIIRIAQPRLD---HFDTWEITIDELLEFAEYARERIAAAWSLTAPRRASLKG-- 248

Query: 223 VNDDSCRFCRAKVRCPALS--------------------------RHVLLEATKDPST-- 254
                CRFCRA   C A++                          R  L +  K      
Sbjct: 249 -----CRFCRAAHNCAAIAYMMECAVGGDVEFLESEFGEEEMSVLRDALAQEYKFRRAQF 303

Query: 255 --NTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRA 312
              TT +++K      +++++    + E+ +R   G+++ G +LVE R  NR F +   A
Sbjct: 304 GNLTTEQMAKILPYRKVVENWFSRLDFELERRAMNGEKVPGQKLVESRT-NRKFANEKDA 362

Query: 313 QELLT--SVLGEEAFKRILKTPKELEQLYKEQKVSDEFWE--ELQELITRGDGKPVIAPR 368
             L     +  ++  +R L+TP ++E++ +++           +  ++ + +GKP +AP 
Sbjct: 363 IALFKFLDIEEDKYIERKLRTPAQMEEVLRDELGVSRAGAPNIIAGIVYKPEGKPTLAPL 422

Query: 369 DIPTNKQT-----QKSQLSEFEV 386
                              + EV
Sbjct: 423 TDKRPPLDGKYSGAWDDEDDDEV 445


>gi|273810597|ref|YP_003344978.1| gp43 [Sodalis phage SO-1]
 gi|258619882|gb|ACV84135.1| gp43 [Sodalis phage SO-1]
          Length = 476

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 103/465 (22%), Positives = 176/465 (37%), Gaps = 91/465 (19%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH 61
             H+ L  S + +W+ CP A  +E  IP  +   A  GT  H +    L + +  E +  
Sbjct: 15  TEHSLLGPSGAKKWMGCPAALVVEKDIPNESGQAAINGTSMHTVSEVVLNRIIAGEKLIT 74

Query: 62  QK------------------LTFENDTRIVDTEMASSVSMVLAYVR---TFSGPFLSETE 100
            K                          +V+ +M       + + R     +     E  
Sbjct: 75  AKTYKGCYVENEGKGPVKAHPKAPKGGVLVNDDMVKQCDAYIDHWRPLLEVAEFVQLEMR 134

Query: 101 VP--------LEPFTTEPGATGTADILIF---NSTQ--WIIVDFKYGAGVPVKAENNTQL 147
                      E         GTAD+++           I+ D K G    V+A+ N QL
Sbjct: 135 ADLTRVLHSGFEIDGNRIKTFGTADMVMVMKKTDGTYMLIVGDLKTGRH-KVEAKENKQL 193

Query: 148 MLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLA 207
           MLYA G L +   ++     + L I QP        +EW IS + L   AK   +R   A
Sbjct: 194 MLYALGLLRKLQTMYD-ITTVRLVIFQPYCGGA---SEWDISVEALEIFAKFASKRAIAA 249

Query: 208 LSLKSKR--AVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLE------------------ 247
           L   ++    ++   +  + D+C++CR   +C A ++  +                    
Sbjct: 250 LDAYARGKKGLTRADFRPSVDACQWCRFADQCSARAKAAIDTMTPPTATDEDLGDDVSIA 309

Query: 248 -----ATKDPST----------------------NTTVELSKAYSSISLIKSYVKACEDE 280
                A  D +                        +  EL KAY  +  ++ ++KA E  
Sbjct: 310 TDEECANHDRNMAREARKAARRAKRGKIEATPGAMSAAELRKAYEGLDAMRQHIKAIEAA 369

Query: 281 MFKRLNAGD-EIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQ 337
           +FK + AGD E  G ++V G++G R + D +   E+ T      +  +K  L +P + E+
Sbjct: 370 VFKAVMAGDGESLGLKMVAGKEGIRKWADESEVIEIFTKARIKRDVMYKETLLSPTDAEK 429

Query: 338 LYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLS 382
           + K++K   + W +L + ITR   KPV+AP D P    ++ +   
Sbjct: 430 VLKDEK--PKVWAKLCDKITRAPAKPVLAPIDDPRPAWSEATDED 472


>gi|134288573|ref|YP_001110812.1| hypothetical protein SPSV3_gp12 [Salmonella phage SETP3]
 gi|125631938|gb|ABN47341.1| hypothetical protein [Salmonella phage SETP3]
          Length = 475

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 100/462 (21%), Positives = 157/462 (33%), Gaps = 96/462 (20%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
           HA LS S + +WL C  +   E  IP T+   A  GT  H L    L Q +    +  ++
Sbjct: 13  HALLSPSGAKKWLACSASLACEKDIPNTSGKAAVLGTAMHTLAEIHLNQYIKGTELPLER 72

Query: 64  LTFENDTRI-----------------VDTEMASSVSMVLAYVRTFSG---PFLSETEVPL 103
                                     +  +M   V     Y +           E  V L
Sbjct: 73  DVGAYVLEEGKGAVKALIKPMKGAVLITEDMVEQVRKYTDYCKAIIDVATYAKLEMRVNL 132

Query: 104 E----PFTTEPGATGTADILIF------NSTQWIIVDFKYGAGVPVKAENNTQLMLYACG 153
                P        GTAD++        +    II D K G    V+A+ N QLMLYA G
Sbjct: 133 TGVLHPGYEGVETFGTADLVAVQELANTDEHMLIIGDLKTGRH-RVEAKENKQLMLYALG 191

Query: 154 ALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSL--K 211
              +    +     + L I QP        +EW IS + L   AK  ++R   AL    +
Sbjct: 192 VYRRLKRRYN-ITVVRLVIFQPYAGGA---SEWDISVEGLELFAKFAQKRAVAALDAYHR 247

Query: 212 SKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTT------VELS---- 261
            K+ +    +  + D C++CR   +C A +R       K+   +          ++    
Sbjct: 248 GKKNLKPSDFKPSVDGCQWCRFSEQCQARTRASNAVLAKELENDADVYRRAVERVAKFCN 307

Query: 262 --------------KAYSSISL--------------------------------IKSYVK 275
                              +                                  ++ ++ 
Sbjct: 308 EADYMSVWEDVQPSDILKLLPDETDLPKKPVREDDFALELTTKQLVAEYEKLPFLRQHID 367

Query: 276 ACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQEL-LTSVLGEEAFKRILKTPKE 334
             E  M   L++G  + GY+LVEGR GNR++KD +   +     V G    K +   P E
Sbjct: 368 KVEKAMAAALHSGKNVPGYKLVEGRLGNRAWKDEDAVNKFRENHVNGYLLDKTVTVLPAE 427

Query: 335 LEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQT 376
            E++  ++    E W EL +L+ R  G P +A  D       
Sbjct: 428 AEKIIGKE--DPELWAELAKLVIRKPGAPCVASADDRRPDWK 467


>gi|83311819|ref|YP_422083.1| hypothetical protein amb2720 [Magnetospirillum magneticum AMB-1]
 gi|82946660|dbj|BAE51524.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 396

 Score =  222 bits (566), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 95/395 (24%), Positives = 156/395 (39%), Gaps = 41/395 (10%)

Query: 10  SSSHRWLKCPIAPTLESKIP-QTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFEN 68
           SS  R+  CP +     K P +  S YA EGT AH      L QG+DA  +  +K+    
Sbjct: 19  SSYSRYAACPGSIRECRKAPPERPSPYAEEGTDAHECGEIGLRQGIDAIELIDRKVGGS- 77

Query: 69  DTRIVDTEMASSVSMVLAYVR---TFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQ 125
              IVD +MA++V + L + R           E  V L P           D   +  + 
Sbjct: 78  ---IVDEDMAAAVQVYLDFCRSQIEDGDIVFVELPVDLAPLNPPVPLRSRLDFARYRPST 134

Query: 126 --WIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR-VRTGSP 182
              ++ D+K+G  V V+   N QL  YA GA  +   +      + + I+QPR      P
Sbjct: 135 QSLLVTDYKHGQLV-VEVHGNGQLRGYALGACVELDKLGHVVSEVQIAIVQPRAYHEDGP 193

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSR 242
           I   VISA +L E + +  +     L   +             + CRFCRAK  CP + R
Sbjct: 194 IRFEVISAFELFEWSVDLFDVINRTLEPDAPLVA--------GEHCRFCRAKPVCPEMER 245

Query: 243 HVLLEATKDPSTNT-----------TVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEI 291
             L  A    +  T              + +  ++  +I+ ++K+  +     L  G EI
Sbjct: 246 MALATAEAQFTDTTITVPPAPSSMAPARIGQVLNAAEIIEGWLKSVREHAHASLEQGVEI 305

Query: 292 QGYQLVEGRKGNRSFKDINRAQELLTSVL--GEEAFKRILKTPKELEQLYKEQKVSDEFW 349
            G++LV  R   R + D + A + L +      + + R + TP   ++L  + K      
Sbjct: 306 PGWKLVPKRA-QRKWADDDLASDALLTAGLPILDIYTRKIITPAAADKLLGKNK------ 358

Query: 350 EELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           + ++ L+        +AP              ++F
Sbjct: 359 DVVKHLVVAESSGTTLAPAGDKRQAV-AGGAAADF 392


>gi|225220083|ref|YP_002720050.1| hypothetical protein EpSSL_gp11 [Enterobacteria phage SSL-2009a]
 gi|224986024|gb|ACN74588.1| hypothetical protein [Enterobacteria phage SSL-2009a]
          Length = 476

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 102/465 (21%), Positives = 174/465 (37%), Gaps = 91/465 (19%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH 61
             H+ L  S + +W+ CP A  +E  IP  +   A  GT  H +    L + +  E    
Sbjct: 15  TEHSLLGPSGAKKWMGCPAALVVEKDIPNESGQAAINGTSMHTVSEVVLNRIIAGEKKIT 74

Query: 62  QK------------------LTFENDTRIVDTEMASSVSMVLAYVR---TFSGPFLSETE 100
            K                          +V+ +M       + + R     +     E  
Sbjct: 75  AKTYKGCYVENEGKGPVKAHPKAPKGGVLVNDDMVKQCDAYIDHWRPLLEVAEFVQLEMR 134

Query: 101 VP--------LEPFTTEPGATGTADILIF---NSTQ--WIIVDFKYGAGVPVKAENNTQL 147
                      E         GTAD+++           I+ D K G    V+A+ N QL
Sbjct: 135 ADLTRVLHSGFEIDGDRIKTFGTADMVMVMKKTDGTYMLIVGDLKTGRH-KVEAKENKQL 193

Query: 148 MLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLA 207
           MLYA G L +   ++    ++ L I QP        +EW IS + L   AK   +R   A
Sbjct: 194 MLYALGLLRKLQTMYD-ITSVRLVIFQPYCGGA---SEWDISVEALEIFAKFASKRAIAA 249

Query: 208 LSLKSKR--AVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLE------------------ 247
           L   ++    ++   +  + D+C++CR   +C   ++  +                    
Sbjct: 250 LDAYARGKKGLTRADFRPSVDACQWCRFADQCSVRAKAAIDTMTPPTATDEDLGDDVSEA 309

Query: 248 -----ATKDPST----------------------NTTVELSKAYSSISLIKSYVKACEDE 280
                A  D +                        +  EL KAY  +  ++ ++KA E  
Sbjct: 310 TEEECANHDRNMAREARKAARRAKRGKKESTPGAMSAAELRKAYEGLDAMRQHIKAIESA 369

Query: 281 MFKRLNAGD-EIQGYQLVEGRKGNRSFKDINRAQELLTSV--LGEEAFKRILKTPKELEQ 337
           +FK + AGD E  G ++V G++G R + D +   E+ T      +  +K  L +P + E+
Sbjct: 370 VFKAVMAGDGESLGLKMVAGKEGIRKWADESEVIEIFTKARIKRDVMYKETLLSPTDAEK 429

Query: 338 LYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLS 382
           + K++K   + W +L   ITR   KPV+AP D P    ++ +   
Sbjct: 430 VLKDEK--PKVWAKLCAKITRAPAKPVLAPIDDPRPAWSEATDED 472


>gi|290466793|gb|ADD25723.1| hypothetical protein [Lactococcus phage 1358]
          Length = 406

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 91/417 (21%), Positives = 153/417 (36%), Gaps = 54/417 (12%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIP-----------QTTSIYASEGTFAHNLLAHCLE 51
           +HAFLS S+S  WL  P     E+ +              +S  A+EGT  H ++   L 
Sbjct: 4   NHAFLSPSASKLWLASPACWYEEAPVRTDVEQSFFDRFYPSSSAAAEGTLGHEIVEKILR 63

Query: 52  QGVDAETV------------SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSET 99
             +  E                    +    + +     + V  +L         F  E 
Sbjct: 64  TELKHERYYKEHQKSRLFKDIRASEHYSYYLQRLADWCVNQVHEILDEYDGMVDAFYLEK 123

Query: 100 EVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYG 159
           EV  E  +  P   GT+D++I       IVDFK+G  +P+ A++N QL +YA  AL   G
Sbjct: 124 EVHAE--SIHPELWGTSDVVIVAGDVLHIVDFKFGR-LPIHAQDNPQLKIYAYAALDTLG 180

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            IF R + +  TI+QPR              DD+   +++    G   +   +       
Sbjct: 181 -IFDRIKTVRGTILQPR----------DYDRDDMELTSRKLHRWGQKTVKPAAIATAEHT 229

Query: 220 HYGVND-DSCRFCRAKVRCPA-LSRHVLLEATKD-----PSTNTTVELSKAYSSISLIKS 272
                   +CR+C+ +V         + +    D     PS     E+ +   + + +K 
Sbjct: 230 GEMKPSISTCRYCKHRVTDKKHRDEFIKVLGGWDKIGIRPSALDKREIIQIAENAAALKQ 289

Query: 273 YVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLG--EEAFK-RIL 329
           +V         ++  G E++G +LV+G    R F D  R +  L  +    +E  K R L
Sbjct: 290 WVDDVVKYATAQVYDGQELEGLKLVKG-ASRRQFTDEKRVRRKLKRLGYNADEYLKPRPL 348

Query: 330 KTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIP--TNKQTQKSQLSEF 384
           K   E+E L        +F       + + +  P + P            +    +F
Sbjct: 349 KPLTEIEALVGHTAFERDFARS----VIKNEYAPRLVPLSNKGLPAANKLEQAADDF 401


>gi|282547322|gb|ADA82379.1| hypothetical protein [Escherichia phage K1ind1]
          Length = 361

 Score =  220 bits (561), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 91/347 (26%), Positives = 141/347 (40%), Gaps = 42/347 (12%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
           HA LS S + +WL CP +   E  IP T+   A  GT  H +    L Q +    +   +
Sbjct: 13  HALLSPSGAKKWLTCPASLACEKDIPNTSGKAAVLGTAMHTIAEMHLNQYIKGTALPLAR 72

Query: 64  LT-----------------FENDTRIVDTEMASSVSMVLAYVRTFSG---PFLSETEVPL 103
                                  + ++  +M   V     Y +           E  V L
Sbjct: 73  EVGAYVLDEGKGQIKALISPMKGSVLITADMIEQVRKYTDYCKAIIDVATYAKLEMRVNL 132

Query: 104 E----PFTTEPGATGTADILIF------NSTQWIIVDFKYGAGVPVKAENNTQLMLYACG 153
                P        GTAD++        +    II D K G    V+A+ N QLMLYA  
Sbjct: 133 TEVLHPGYEGVETFGTADLVAVQELANTDEHMLIIGDLKTGRH-RVEAKENKQLMLYALS 191

Query: 154 ALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSL--K 211
              +    +     + L I QP        +EW IS + L   AK  ++R  LAL    +
Sbjct: 192 VYRRLKRRYN-VTVVRLVIFQPYAGGA---SEWDISVEGLELFAKFAQKRALLALDAYFR 247

Query: 212 SKRAVSLEHYGVNDDSCRFCRAKVRCPALS---RHVLLEATKDPS--TNTTVELSKAYSS 266
            K+ +    +  + D C++CR   +C A +     VL E  +D      TT +L   Y  
Sbjct: 248 GKKNLKASDFKPSVDGCQWCRFSEQCAARTKTVNSVLAEELEDDFVLELTTEQLVVEYEK 307

Query: 267 ISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQ 313
           + L++ ++   E  M   L++G ++ GY+LVEGR GNR++KD +  +
Sbjct: 308 LPLLRQHIDKVEKAMSAALHSGKKVPGYKLVEGRPGNRAWKDADAIE 354


>gi|307317151|ref|ZP_07596592.1| APSE-2 prophage [Sinorhizobium meliloti AK83]
 gi|306897239|gb|EFN27984.1| APSE-2 prophage [Sinorhizobium meliloti AK83]
          Length = 408

 Score =  214 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 99/417 (23%), Positives = 159/417 (38%), Gaps = 48/417 (11%)

Query: 1   MAHHAFLSASSSHRWLKCPIAP----TLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDA 56
           MA HA  + S S RWL C  A      L       +S  A EGT AH++   CLE G+D 
Sbjct: 1   MAGHARNAPSDSKRWLLCSGALNRCKALGLDQIDDSSDAADEGTAAHSIRELCLEVGLDP 60

Query: 57  ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT----EPGA 112
                 K+     T   D +MA+++   +  +R F G    E  V + P+T         
Sbjct: 61  YDFVGTKIGVNGKTFTCDEDMAAALQPGIDRLREFDGVMFVEFRVDITPWTGPDEHGNPQ 120

Query: 113 TGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTI 172
            GT D  I    +  + D K+G G+PV+A  NTQ+ LY  G   Q      + +     I
Sbjct: 121 GGTLDCGIVGDDEICVGDLKFGKGIPVEAVGNTQIRLYGLGFYEQVAKYLTKAKRFRFII 180

Query: 173 IQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC- 231
            QPR   G    EWV + ++L    +  KER  L     +           + ++C +C 
Sbjct: 181 DQPRNGRGG--GEWVQTLEELQAFGEYVKERAALTFDPNAPC-------TPSKEACLWCS 231

Query: 232 --RAKVRCPALSRHVLL------------------EATKDPSTNTTVELSKAYSSISLIK 271
             +    CP      L                     T D    T       Y  + +I+
Sbjct: 232 AAKVDGACPEFEAWNLEFCDIEFENLDDYDEYGIDIETPDVEGLTVARKRAIYDHLGVIR 291

Query: 272 SYVKACEDEMFKRLNAGD-EIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEE--AFKRI 328
            ++   E  + + + +G  ++ G +LV GR+ +R   D   +++ L     E+   F + 
Sbjct: 292 KFLTRVEQSVAEAVRSGQGDLYGKKLVAGRRSHRKHVDETESEKWLRKKGFEDEQIFTKK 351

Query: 329 LKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           LKTP  L+++  + K          E++  G   P I   +          +    +
Sbjct: 352 LKTPAMLDKVCGKGKFP-------TEMVKGGHPTPSIVSIEDARPALPVDMEFDNLD 401


>gi|295108164|emb|CBL22117.1| Protein of unknown function (DUF2800). [Ruminococcus obeum A2-162]
          Length = 270

 Score =  213 bits (542), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 71/251 (28%), Positives = 121/251 (48%), Gaps = 12/251 (4%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
           H+ L AS++ RW+ C  +  L + +   T+ +A+EGT AH L    + + +         
Sbjct: 6   HSVLGASAADRWMNCTPSAQLTAGMEDETTTFAAEGTAAHALCEWKVRKALKMRAGRRPT 65

Query: 64  LTFE-NDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
             +  ++      +    +  ++   +      ++  E  L+     P   GT D L+  
Sbjct: 66  SDYWTDEMEEFTDDYRDFIMDLVGQAKLTCKDPVTLIEQHLDFSCYVPDGFGTGDFLLVA 125

Query: 123 STQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSP 182
             +  +VDFKYG GV V A++N Q+MLYA GAL+ +  ++   E +T+TI QPR+   S 
Sbjct: 126 DKELNVVDFKYGRGVAVYADHNPQMMLYALGALNLFDCLYD-IEQVTMTIFQPRL---SS 181

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSR 242
           I+ W ISA++L + A+E        L  K++ A   E   ++   CRFC+A+  C A + 
Sbjct: 182 ISTWTISAEELYKWAEEV-------LKPKAELAAKGEGEFISGSWCRFCKARNTCRARAE 234

Query: 243 HVLLEATKDPS 253
             L  A  +  
Sbjct: 235 SFLELAKMEFQ 245


>gi|296277304|ref|ZP_06859811.1| hypothetical protein SauraMR_13202 [Staphylococcus aureus subsp.
           aureus MR1]
          Length = 282

 Score =  212 bits (540), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 71/285 (24%), Positives = 114/285 (40%), Gaps = 20/285 (7%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH- 61
            HA LSAS + +WL CP +      I   +S++A EGTFAH L         +  T    
Sbjct: 9   AHAKLSASGAKQWLNCPPSIKASEGIADKSSVFAEEGTFAHELSELYFSLKYEGLTQFEF 68

Query: 62  -QKLTFENDTRIVDTEMASSVSMVLAYVRT-------FSGPFLSETEVPLEPFTTEPGAT 113
            +        +    E+   V   +A V              ++  E  L+       + 
Sbjct: 69  NKAFQNYKRNQYYSEELREYVEEYVANVEEKYNEALSRDNDVIALFETKLDLGKYVSESF 128

Query: 114 GTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           GT D++IF+     I+D KYG G+ V A +N QL LY  GA      ++     + +TII
Sbjct: 129 GTGDVIIFSGGVLEIIDLKYGKGIEVSAIDNPQLRLYGLGAYELLSLMYD-IHTVRMTII 187

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           QPR+           S ++L        + GT  +   ++ A + E        CRFC+ 
Sbjct: 188 QPRINN--------FSTEELP--ISRLLQWGTDFVKPLARLAYNGEGEFKAGSHCRFCKI 237

Query: 234 KVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACE 278
           K  C   + ++     K P   +  E+++    +  IK +    E
Sbjct: 238 KHSCRTRAEYMQNVPQKPPHLLSDEEIAELLYKLPDIKKWADEVE 282


>gi|160898857|ref|YP_001564439.1| hypothetical protein Daci_3416 [Delftia acidovorans SPH-1]
 gi|160364441|gb|ABX36054.1| hypothetical protein Daci_3416 [Delftia acidovorans SPH-1]
          Length = 463

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 103/461 (22%), Positives = 173/461 (37%), Gaps = 90/461 (19%)

Query: 1   MAH-HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAH-CLEQGVDAET 58
           M+  HA LS SS+ RW  C  +P  +  IP   S  +  GT  H +     L    D + 
Sbjct: 1   MSKKHARLSPSSADRWTSCTASPAAQDGIPNENSDASRAGTTCHQVQEELLLNPERDPQV 60

Query: 59  VSHQKLTFENDTR--------------------------IVDTEMASSVSMVLAYVRT-- 90
               KL F                                V  EM  +V   + ++R   
Sbjct: 61  YLGAKLVFWVHPESDSKGETWNEEFYAGMAAEVQVEAEVEVTQEMIDAVVSAVTFIREQH 120

Query: 91  --FSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAE------ 142
               G  L E  VP+  FT E  A G+AD+++  +    ++D K+G       +      
Sbjct: 121 QLLGGELLVEQRVPIGQFTGEEDAYGSADVILLGADWLHVMDSKFGRKRVHAGKVIRHES 180

Query: 143 --------------NNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVI 188
                          N Q+  YA GA+H +  IFG  + +T+TI+QP +      + +  
Sbjct: 181 VDFITGEILSLLLGPNLQMASYALGAVHAHD-IFGEVKTVTMTIVQPFI---GHTDSFTC 236

Query: 189 SADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEA 248
           S D+L E            L+ K++   +   +  + D+C FCRAK  C A +   L   
Sbjct: 237 SIDELRE--------VEKFLAAKAEETRTAPRFVPDYDNCFFCRAKGTCYAQTSKALGTV 288

Query: 249 TKDPSTNT--------TVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEI---QG--YQ 295
                  T         + L   Y+ +  ++ + K  E+  ++ L  G+ +    G  Y+
Sbjct: 289 FDGFGEATSGVLRRPDPLMLGSQYALVPFVQQWAKDVEEATYRALQNGEPVVRNDGVPYK 348

Query: 296 LVEGRKGNRSFKDIN--RAQELLTSVLGEEAFKRILKTPKELEQLYKEQK---------- 343
           LV GR   R+++D     A      +  +  +   L +P   E + K+++          
Sbjct: 349 LVPGRAAKRTWRDEEAAAAVLHAARIPRDRMYLFQLISPAMAEAMSKQKRPPKGQPPQPA 408

Query: 344 -VSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSE 383
            +    W++LQ LI +G+  P IA    P     +     +
Sbjct: 409 ELPPSKWKDLQPLIAQGEPAPQIALATDPRPALCKADGFED 449


>gi|313898032|ref|ZP_07831571.1| conserved hypothetical protein [Clostridium sp. HGF2]
 gi|312957060|gb|EFR38689.1| conserved hypothetical protein [Clostridium sp. HGF2]
          Length = 207

 Score =  204 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 50/218 (22%), Positives = 94/218 (43%), Gaps = 21/218 (9%)

Query: 170 LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
           +TI QPR +    I+ + +S +DL + A E        L   +  A + +   +  + CR
Sbjct: 1   MTIYQPRRQN---ISTYEVSKEDLYQWADEV-------LKPTADLAFAGDGNFLCGEWCR 50

Query: 230 FCRAKVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLN 286
           FC+AK  C A +   LL A  D   P      E+    S +  + S+    ++   ++  
Sbjct: 51  FCKAKHECRARAEANLLLAQYDFKLPPLLEDSEIEVILSRVDELVSWAGDIKEYALQQAI 110

Query: 287 AGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSD 346
           +G E  G++LVEGR  NR + + +   + + +    + +++ L     +++L  +     
Sbjct: 111 SGKEWTGWKLVEGR-SNRRYTNEDAVSKAVEAAGF-DPYEKKLLGITAMQKLLGK----S 164

Query: 347 EFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
            F E L   I +  GKP + P           +  ++F
Sbjct: 165 RFEELLAAYIEKPQGKPTLVPESDKRPA--MNTAKNDF 200


>gi|331087496|ref|ZP_08336432.1| hypothetical protein HMPREF1025_00015 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330410476|gb|EGG89907.1| hypothetical protein HMPREF1025_00015 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 176

 Score =  180 bits (456), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 71/176 (40%), Gaps = 9/176 (5%)

Query: 214 RAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLI 270
            A   +   +  + C FC+  V+C A +   +  A  +   P   T  E+ +    +  +
Sbjct: 1   MAYDGDGEYLPGEWCTFCKVSVKCRARAEEKMKLARLEFKMPPLLTDAEIEEVLDVLPDL 60

Query: 271 KSYVKACEDEMFKRL-NAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRIL 329
             +         +   + G E  G+++VEGR  NR ++D     E        + +++ L
Sbjct: 61  TKWANEITAYATEAAIHHGKEWNGFKVVEGR-SNRKYRDELLVAEAAREHGYTDIYRQTL 119

Query: 330 KTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
               E+++L  +      F E L +LI +  GKP++ P           +  +EF+
Sbjct: 120 IPMTEMQKLMGKSA----FEEILGDLIYKPPGKPILVPNTDKRPAMNVTNAENEFD 171


>gi|238899050|ref|YP_002924732.1| hypothetical protein HDEF_2004 [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466810|gb|ACQ68584.1| conserved hypothetical phage protein [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 271

 Score =  179 bits (454), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 81/266 (30%), Positives = 129/266 (48%), Gaps = 32/266 (12%)

Query: 134 GAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDL 193
           G GV V+AENN Q +LYA GAL++Y  IF       L ++QPR+     I+E  IS D+L
Sbjct: 21  GKGVRVEAENNPQALLYALGALNEYEFIFDHITTFKLAMVQPRLD---HISEHEISRDEL 77

Query: 194 LEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEAT---- 249
           L   ++ K+R  LAL+  +        +  +  +C+FCRAK RC AL+   L  A     
Sbjct: 78  LVFGEQAKKRAALALAPHAD-------FRPDPKACKFCRAKARCRALAARSLQVAAQEFQ 130

Query: 250 --------KDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRK 301
                   KD +     +++     ++++  ++K+ E    + L  G +I GY+LV GR 
Sbjct: 131 NVVTPIALKDITLLNNRDIAALLPQLNMMADWIKSVEATALQELEQGRDIPGYKLVTGR- 189

Query: 302 GNRSFKDINRAQELL--TSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRG 359
             R ++D  +A++ L  T +   E F + L +P + E+L  ++         L EL    
Sbjct: 190 SIRKWRDEAQAEQSLRKTHLKVAEIFTQKLVSPAQAEKLLGKKH------PLLDELAIHP 243

Query: 360 DGKPVIAPRDIPTNKQTQKSQLSEFE 385
            GKP++AP           S   EF+
Sbjct: 244 QGKPILAPESDKRPALR-SSVEEEFK 268


>gi|163814573|ref|ZP_02205962.1| hypothetical protein COPEUT_00724 [Coprococcus eutactus ATCC 27759]
 gi|158450208|gb|EDP27203.1| hypothetical protein COPEUT_00724 [Coprococcus eutactus ATCC 27759]
          Length = 172

 Score =  177 bits (449), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 67/164 (40%), Gaps = 11/164 (6%)

Query: 224 NDDSCRFCRAKVRCPALSRHVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDE 280
             + C FC+A  +C A +   LL A  D   P      E+    S +  + S+    ++ 
Sbjct: 6   CGEWCGFCKANHKCRARAEANLLLAQHDFKLPPLLEDSEIEVILSRVDELISWANDIKEY 65

Query: 281 MFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYK 340
             ++  +G E   ++LVEGR  NR +   +   + + +    + +++ L     +++L  
Sbjct: 66  ALQQAISGKEWTSWKLVEGR-SNRRYTSEDDVSKAVEAAGF-DPYEKKLLGITAMQKLLG 123

Query: 341 EQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEF 384
           +      F E L   I +  GKP + P           +  +++
Sbjct: 124 K----SRFEELLAAYIEKPQGKPTLVPESDKRPA--MNTAKNDY 161


>gi|300858870|ref|YP_003783853.1| hypothetical protein cpfrc_01453 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300686324|gb|ADK29246.1| hypothetical protein cpfrc_01453 [Corynebacterium
           pseudotuberculosis FRC41]
          Length = 211

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 67/201 (33%), Positives = 97/201 (48%), Gaps = 5/201 (2%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGV-DAETVSH 61
            HA LSAS +HRWL  P + TLE+ +P+++S  A +GT AH      L + + DA T   
Sbjct: 4   QHALLSASGAHRWLAYPPSATLEAGLPESSSSAAEQGTAAHEFAEWKLRRALHDAPTAKP 63

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIF 121
                + +T  +  +  + V  +L  VR          E  L+     PG  GT D +I 
Sbjct: 64  VPSWHDAETEALTDDYVAFVQELLRDVRQVCADPQVLIEQRLDFSHVVPGGFGTGDCVII 123

Query: 122 NSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGS 181
                 I+D KYG  V V+AE N QLMLYA  AL+ +G +    + + +TI QP      
Sbjct: 124 AEPLLHIIDLKYGQSVMVEAEQNPQLMLYALSALNAFGSL-HDIDQVAVTIFQPSRSN-- 180

Query: 182 PINEWVISADDLLEKAKEFKE 202
            I+   IS  DL   A++  +
Sbjct: 181 -ISTCTISVTDLEAWAEKVVK 200


>gi|331028096|ref|YP_004421810.1| hypothetical protein RDJLphi1_gp42 [Roseobacter phage RDJL Phi 1]
 gi|301341559|gb|ADK73443.1| hypothetical protein RDJLphi1_gp42 [Roseobacter phage RDJL Phi 1]
          Length = 480

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 97/480 (20%), Positives = 154/480 (32%), Gaps = 95/480 (19%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLESKIP--QTTSIYASEGTFAHNLLAHCLEQGVDAET 58
           MA HA LSAS +  W  CP    L+   P    +   A  GT AH L+  CLE+GV  E 
Sbjct: 1   MAWHARLSASQTKDWFNCPGTIALKEMFPYDDPSGEAAQLGTCAHALIERCLEEGVSPEA 60

Query: 59  VSHQKLTFENDT-----------------------RIVDTEMASSVSMVLAYVRTFSGPF 95
              + +  ++                           VD +M  + +  + YV       
Sbjct: 61  YRDRLIEIKHPDTDKEETVIMGKNVKWPKQVGRVIFEVDDDMIEATTTFIDYVIGRLVEL 120

Query: 96  L--------------------------SETEVPLEPFTTEPGATGTADI-LIFNSTQWII 128
                                       + E  + P        GTAD+ +        +
Sbjct: 121 FPQAYDTTGFGDEVPYGISVDAVKRGQLKLEGRVNPLPERDDTGGTADVTIDCWPDLMEL 180

Query: 129 VDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSP--INEW 186
           VD+K G GV V  E N QL  Y  G   +     G       TI QPR     P  ++  
Sbjct: 181 VDYKNGTGVLVPVEGNLQLRSYTLGRAVEGDGEIGDYANYRYTIGQPRHHRAPPGGMSWE 240

Query: 187 VISADDLLEKAKEF------KERGTLALSLKSKRAVSLEH------------------YG 222
            +  ++L    KE        ++  L L          +                    G
Sbjct: 241 ELKPNELAAFRKELVAACKRVDKARLVLEQAYNYKRDADEMLTIEEARQALYDAGFLSVG 300

Query: 223 VNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTTV--------ELSKAYSSISLIKSYV 274
            +   C +C     CPA    V   A  D +              L+        I+S++
Sbjct: 301 EDGGHCNWCPHLNDCPAALNKVQDVAGMDFADEPEELEDPMGPNHLAMILPWKGFIESFL 360

Query: 275 KACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFK---DINRAQELLTSVLGEEAFKRILKT 331
           K       +RL  G+E+ GY++V  + GNR++K   D       L    G +  ++I+  
Sbjct: 361 KKAAAIAQERLLKGEEVPGYKMVR-KGGNRTWKPDLDETEVTNRLIEHYGVKR-EKIMNP 418

Query: 332 PKELEQLYK----EQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           P E +        +   +    E  +E + + +G   +   D      T      +F  +
Sbjct: 419 PAEAKMRTGPQIEKAVPAKMREEFAKEFLWKPEGGLTMVTEDDGREAVTPDQAADDFGDV 478


>gi|311900006|dbj|BAJ32414.1| hypothetical protein KSE_66550 [Kitasatospora setae KM-6054]
          Length = 288

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 42/258 (16%), Positives = 75/258 (29%), Gaps = 37/258 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+   L    ++P+  S  A+ GT  H +L    +      T    + 
Sbjct: 19  LSPSRAGDFMTCPLLYRLRVIDRLPEPPSQAATRGTLVHAVLERLFDHPPAERTPERARG 78

Query: 65  TFENDTRIVDTEMASSVSMV-----------------LAYVRTFSGPFL---SETEVPLE 104
             E     +  E      +                  +        P      E E+ +E
Sbjct: 79  LLEPQWERLLGERPELAELFPGEPGELAGWLADAGKLVDRWFRLEDPTRLHPVERELYVE 138

Query: 105 PFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGD 160
                     G  D +      +  +VD+K G       E     Q+  YA       G 
Sbjct: 139 TALASGLPLRGYIDRVDVAPSGEVRLVDYKTGRAPSRDFEGKAMFQMKFYALVVWRWKGV 198

Query: 161 IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
           +  R + + L         G  +  +     DLL   ++            S    + + 
Sbjct: 199 VPKRLQLVYL-------GGGGDVVTYDPDEADLLSVERKL----EALWEAISAAVATGDF 247

Query: 221 YGVNDDSCRFCRAKVRCP 238
               +  C +C  +  CP
Sbjct: 248 PATRNRLCDWCDHQASCP 265


>gi|296394679|ref|YP_003659563.1| RecB family exonuclease [Segniliparus rotundus DSM 44985]
 gi|296181826|gb|ADG98732.1| RecB family exonuclease [Segniliparus rotundus DSM 44985]
          Length = 294

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 44/259 (16%), Positives = 76/259 (29%), Gaps = 39/259 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+   L    +IPQ  ++    GT  H  L   L    ++ T+     
Sbjct: 16  LSPSRASDFRQCPLLYRLRAIDRIPQPPTLAMVRGTLVHAALEELLALPAESRTLDAAAE 75

Query: 65  TFENDTRIVDTEMASSVS----------------MVLAYVRTFSGPFLS-----ETEVPL 103
                 + V  EM                      +LA       P        E  V +
Sbjct: 76  LIAPSWQRVSGEMPEDHRLDLDEHGLSQLFEQSKTLLAMYFALEDPARVTPSACELRVEV 135

Query: 104 EPFTTEPGATGTADILI-FNSTQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGD 160
           +     P   G  D +      +  +VD+K G     P +A+   Q+  YA       G 
Sbjct: 136 DLEPDVP-LRGFVDRVDELADGELRVVDYKTGRAPGGPYEAKALFQMKFYALALWKLRGV 194

Query: 161 IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
           +      + L               +     +L   ++                  + + 
Sbjct: 195 VPQELRLMYL--------GSGDTLTYEPDPGELDRFSRTL----VAIWRAIQTAGRTGDF 242

Query: 221 YGVNDDSCRFCRAKVRCPA 239
                  C++C  + RCPA
Sbjct: 243 RPNPGPLCKWCEHQSRCPA 261


>gi|271967185|ref|YP_003341381.1| RecB family exonuclease-like protein [Streptosporangium roseum DSM
           43021]
 gi|270510360|gb|ACZ88638.1| RecB family exonuclease-like protein [Streptosporangium roseum DSM
           43021]
          Length = 295

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 45/257 (17%), Positives = 81/257 (31%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+        ++P+  S  A  GT  H++L    +    A TV+  + 
Sbjct: 18  LSPSRAGDFMTCPLLYRFRVIDRLPEPPSPAAVRGTMVHSVLERLYDLPAPARTVAAAQE 77

Query: 65  TFENDTRIVDTE----------------MASSVSMVLAYVRTFSGPFLS---ETEVPLEP 105
             E     +  E                  +    +L    T   P      E E+ +E 
Sbjct: 78  LLEPQWHRLLAEDPAYGGMFADDREQAQWLAQAGSMLERYFTLEDPTCLEPAERELYVEA 137

Query: 106 FTT-EPGATGTADILIFNS-TQWIIVDFKYG--AGVPVKAENNTQLMLYACGALHQYGDI 161
                    G  D L      +  +VD+K G   G   +A+   Q+  YA      +G +
Sbjct: 138 VLDNGLMLRGYIDRLDVAPTGEVRVVDYKTGSAPGPAFEAKALFQMKFYALTLWRLHGSV 197

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
               + + L         G  +  +     DL    ++         +   +   + E  
Sbjct: 198 PRLLQLMYL-------GGGGEVLRYAPDEADLRATERKV----QALWTAIERAMETGEWP 246

Query: 222 GVNDDSCRFCRAKVRCP 238
                 C +C  +  CP
Sbjct: 247 PRPSRLCDWCSYQELCP 263


>gi|317124888|ref|YP_004099000.1| RecB family exonuclease-like protein [Intrasporangium calvum DSM
           43043]
 gi|315588976|gb|ADU48273.1| RecB family exonuclease-like protein [Intrasporangium calvum DSM
           43043]
          Length = 279

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 43/258 (16%), Positives = 75/258 (29%), Gaps = 37/258 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+        K+P   +   + GT  H +L    +      T+     
Sbjct: 5   LSPSRASDFMTCPMLYRFRVIDKLPSPPTAATARGTLVHAVLERLFDLPTSERTLEAAVG 64

Query: 65  TFENDTRIVDTEMASSVS-----------------MVLAYVRTFSGPFLS---ETEVPLE 104
               +   +  E    +S                  +L        P      E E+ +E
Sbjct: 65  LVPQEWERIAAEEPEMLSLLAEHDGRTDEWFSGAGSLLETWFGLEDPTRLEPAERELYVE 124

Query: 105 PFTTEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDI 161
                    G  D L         +VD+K G     + E     Q+  YA       G++
Sbjct: 125 TEIDGLVLRGYVDRLDVAPDGAMRVVDYKTGRSPSERFEGKALFQMKFYALVLWRLRGEV 184

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
               + + L            I  +     DLL   ++ K       +   + A   +  
Sbjct: 185 PRLLQLVYL--------GNGEIVRYRPDEQDLLAVERKIK----ALWAAIERAARLGDWQ 232

Query: 222 GVNDDSCRFCRAKVRCPA 239
                 C +C  +  CPA
Sbjct: 233 PSPSRLCDWCEHRALCPA 250


>gi|229493655|ref|ZP_04387440.1| conserved hypothetical protein [Rhodococcus erythropolis SK121]
 gi|229319616|gb|EEN85452.1| conserved hypothetical protein [Rhodococcus erythropolis SK121]
          Length = 353

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 39/259 (15%), Positives = 66/259 (25%), Gaps = 42/259 (16%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        +IP+T +     GT  H  L                  
Sbjct: 83  LSPSRAGDYKQCPLLYRFRAVDRIPETPTRAQVRGTVVHAALEALFALPTGHRVPDRAAE 142

Query: 65  TFENDTRIVDTEMASSVS----------------------MVLAYVRTFSGPFLSETEVP 102
                   V  E   +                         +    R  +       E  
Sbjct: 143 LVRPAWERVSAESPEAADLVPEGELDSFLDEVGKLVATYYTLEDPTRFDAEACEVYVETE 202

Query: 103 LEPFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYG 159
           LE         G  D +      +  +VD+K G       E+    Q+  YA   L   G
Sbjct: 203 LE---NGVRLRGFVDRIDVAPTGEVRVVDYKTGKAPREFTESKALFQMKFYALVLLRTRG 259

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +  +   + L            I  +    D+L+   +      +           + +
Sbjct: 260 IVPAQLRLIYLA--------SGSILTYAPDHDELIRFERTL----SAIWKAILAAGATGD 307

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  K  CP
Sbjct: 308 FRPKPGKLCDWCDHKSLCP 326


>gi|239932266|ref|ZP_04689219.1| hypothetical protein SghaA1_28841 [Streptomyces ghanaensis ATCC
           14672]
          Length = 317

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 38/262 (14%), Positives = 72/262 (27%), Gaps = 40/262 (15%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +++CP+        ++P+  S  A+ GT  H++L    +      T    
Sbjct: 39  ASLSPSRASDFMQCPLLYRFRVIDRLPEKPSEAATRGTLVHSVLERLFDAPAAERTAPRA 98

Query: 63  KLTFENDTRIVDT-------------------EMASSVSMVLAYVRTFSGPFLS---ETE 100
           K         +                        +    ++    T   P      E E
Sbjct: 99  KALVPGQWERLRESRPEVAELFADDPEGERLARWLAEAERLVERWFTLEDPSRLEPAERE 158

Query: 101 VPLEPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALH 156
           + +E          G  D +      +  IVD+K G     +       Q+  YA     
Sbjct: 159 LFVEAELDSGLRLRGIIDRVDVAPTGEVRIVDYKTGKAPRPEYAEGALFQMKFYALVVWR 218

Query: 157 QYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAV 216
               +  R + + L            +  +     DL    ++                 
Sbjct: 219 LKKVVPRRLQLVYL--------GSGDVLTYDPVPADLERVERKLL----ALWDAIRTATG 266

Query: 217 SLEHYGVNDDSCRFCRAKVRCP 238
           + +        C +C  +  CP
Sbjct: 267 TGDWRPRPSKLCGWCDHQAHCP 288


>gi|296129851|ref|YP_003637101.1| RecB family exonuclease-like protein [Cellulomonas flavigena DSM
           20109]
 gi|296021666|gb|ADG74902.1| RecB family exonuclease-like protein [Cellulomonas flavigena DSM
           20109]
          Length = 284

 Score =  166 bits (421), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 44/257 (17%), Positives = 78/257 (30%), Gaps = 37/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S ++ +L+CP+        ++P+  S  A+ GT  H +L H  +      T+   + 
Sbjct: 16  LSPSRANDFLQCPLLFRYRVVDRLPEPASPAAARGTLVHAVLEHLFDLPAPERTLDAARA 75

Query: 65  TFENDTRIVDTEMASSVSMVLAY----------------VRTFSGPFLSE---TEVPLEP 105
                   V  E    + +                      T   P   E    E+ +E 
Sbjct: 76  ALPERWAQVQQEDPRCLDLHADDAERAAFLAEAERLLTTWFTLEDPTRLEPRARELRVEH 135

Query: 106 FT-TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDI 161
                P   G  D +         +VD+K G       E++   Q+  YA       G +
Sbjct: 136 DLEDGPRLRGVVDRVDVAPNGWVRVVDYKTGRSPRAGFESSALFQMRFYAYVVWRTRGVL 195

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
             R +   L            +     +  ++       + R     +     A S +  
Sbjct: 196 PKRLQLTYL--------GDGVVVSHEPTEAEM----HTLEARVRSIWAGIEDTARSGDWR 243

Query: 222 GVNDDSCRFCRAKVRCP 238
                 C +C  + RCP
Sbjct: 244 PRPSRLCDWCAFRDRCP 260


>gi|29833214|ref|NP_827848.1| hypothetical protein SAV_6672 [Streptomyces avermitilis MA-4680]
 gi|29610336|dbj|BAC74383.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 286

 Score =  165 bits (419), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 37/260 (14%), Positives = 70/260 (26%), Gaps = 40/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  +++CP+        K+P+  S  A+ GT  H +L    +      T    + 
Sbjct: 10  LSPSRASDFMQCPLLYRFRVIDKLPEKPSEAATRGTLVHAVLERLFDAPAAERTAPRARS 69

Query: 65  TFENDTRIVDTEMASSVSMV-------------------LAYVRTFSGPFLS---ETEVP 102
                   +       V +                    +    +   P      E E+ 
Sbjct: 70  LVPGQWDRLRESRPEVVELFADDPEGERLARWLGEAEQLVERWFSLEDPTRLEPAERELF 129

Query: 103 LEPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQY 158
           +E          G  D +      +  IVD+K G     +       Q+  YA       
Sbjct: 130 VEAELDSGLRLRGIIDRVDVAPSGEVRIVDYKTGKAPRPEYAEGALFQMKFYALVVWRLK 189

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
             +  R + + L            +  +     DL    +  + +             + 
Sbjct: 190 NVVPRRLQLVYL--------GSGDVLTYDPVVADL----ERVERKLHALWDAIQLATETG 237

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
                    C +C  +  CP
Sbjct: 238 NWRPRPTKLCGWCDHQAVCP 257


>gi|291440630|ref|ZP_06580020.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
 gi|291343525|gb|EFE70481.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
          Length = 282

 Score =  165 bits (419), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 38/262 (14%), Positives = 72/262 (27%), Gaps = 40/262 (15%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +++CP+        ++P+  S  A+ GT  H++L    +      T    
Sbjct: 4   ASLSPSRASDFMQCPLLYRFRVIDRLPEKPSEAATRGTLVHSVLERLFDAPAAERTAPRA 63

Query: 63  KLTFENDTRIVDT-------------------EMASSVSMVLAYVRTFSGPFLS---ETE 100
           K         +                        +    ++    T   P      E E
Sbjct: 64  KALVPGQWERLRESRPEVAELFADDPEGERLARWLAEAERLVERWFTLEDPSRLEPAERE 123

Query: 101 VPLEPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALH 156
           + +E          G  D +      +  IVD+K G     +       Q+  YA     
Sbjct: 124 LFVEAELDSGLRLRGIIDRVDVAPTGEVRIVDYKTGKAPRPEYAEGALFQMKFYALVVWR 183

Query: 157 QYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAV 216
               +  R + + L            +  +     DL    ++                 
Sbjct: 184 LKKVVPRRLQLVYL--------GSGDVLTYDPVPADLERVERKLL----ALWDAIRTATG 231

Query: 217 SLEHYGVNDDSCRFCRAKVRCP 238
           + +        C +C  +  CP
Sbjct: 232 TGDWRPRPSKLCGWCDHQAHCP 253


>gi|297198514|ref|ZP_06915911.1| RecB family exonuclease [Streptomyces sviceus ATCC 29083]
 gi|197716174|gb|EDY60208.1| RecB family exonuclease [Streptomyces sviceus ATCC 29083]
          Length = 283

 Score =  165 bits (419), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 41/262 (15%), Positives = 74/262 (28%), Gaps = 40/262 (15%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S ++ +++CP+        ++P+  S  A+ GT  H++L    +      T    
Sbjct: 8   ASLSPSRANDFMQCPLLYRFRVIDRLPEKPSAAATRGTLVHSVLERLFDAPAGERTAPVA 67

Query: 63  KLTFENDTRIVDTEMASSVSMV-------------------LAYVRTFSGPFLS---ETE 100
           K         +       V +                    +    T   P      E E
Sbjct: 68  KSLIPGQWDRLRESRPEVVELFADDPDGERLAQWLGEAERLVERWFTLEDPTRLEPAERE 127

Query: 101 VPLEPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALH 156
           + +E          G  D +      +  IVD+K G     +       Q+  YA     
Sbjct: 128 LFVEAELDSGLRLRGIIDRVDVAPTGEVRIVDYKTGKAPRPEYAEGALFQMKFYALVVWR 187

Query: 157 QYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAV 216
               I  R + + L            +  +     DL    ++             +   
Sbjct: 188 LKNVIPRRLQLVYL--------GSGDVLTYDPVLADLERVERKLL----ALWEAIRQATQ 235

Query: 217 SLEHYGVNDDSCRFCRAKVRCP 238
           S +        C +C  +  CP
Sbjct: 236 SGDWRPRPTKLCGWCDHQEHCP 257


>gi|258653148|ref|YP_003202304.1| RecB family exonuclease-like protein [Nakamurella multipartita DSM
           44233]
 gi|258556373|gb|ACV79315.1| RecB family exonuclease-like protein [Nakamurella multipartita DSM
           44233]
          Length = 323

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 69/256 (26%), Gaps = 36/256 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  +  CP+   L    ++P+  S  A  GT  H +L     +     T      
Sbjct: 34  LSPSRASDFKSCPLLYRLRAVDRLPEPPSPAAVRGTLVHTVLEEMFGRPGPERTPRRTAE 93

Query: 65  TFENDTRIVDTEMASSV--------SMVLAYVRTF-SGPFLSETEVPLEP---------- 105
                   +  +    V        +  L   R      F  E     EP          
Sbjct: 94  AVGPAWERMAEQCPELVGMLPDEAMAGWLDSARDLVRSYFRLEDPRRFEPQACEYAVEID 153

Query: 106 FTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENNT--QLMLYACGALHQYGDIF 162
                   G  D L      +  IVD+K G       E     QL  YA       G + 
Sbjct: 154 TVDGVPLRGFIDRLDLAPTGELRIVDYKTGRSPGPDFEGRALYQLKFYALMIYRLRGVVP 213

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            + + + L              ++  S  +L+  +              +    S     
Sbjct: 214 AQLKLIYLA--------DGLSLQYAPSESELIGFSHAV----GALWRAVTAALESGNFPA 261

Query: 223 VNDDSCRFCRAKVRCP 238
                CR+C  +  CP
Sbjct: 262 RRGPMCRWCTHQALCP 277


>gi|317506021|ref|ZP_07963851.1| hypothetical protein HMPREF9336_00220 [Segniliparus rugosus ATCC
           BAA-974]
 gi|316255679|gb|EFV14919.1| hypothetical protein HMPREF9336_00220 [Segniliparus rugosus ATCC
           BAA-974]
          Length = 288

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 45/286 (15%), Positives = 79/286 (27%), Gaps = 39/286 (13%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+   L    +IPQ  ++    GT  H  L   L    ++ T+     
Sbjct: 16  LSPSRASDFRQCPLLYRLRAIDRIPQPPTLAMVRGTLVHAALEDLLALPAESRTLDAAHG 75

Query: 65  TFENDTRIVDTEMASSVSMVLAY----------------VRTFSGPFLS-----ETEVPL 103
                   V  EMA    + L                        P        E  V +
Sbjct: 76  LVAPSWERVSGEMAEDNRLDLDEQGLEQLFEQSKTLLAGYFALEDPASVTPHACELRVEV 135

Query: 104 EPFTTEPGATGTADILI-FNSTQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQYGD 160
           E     P   G  D +      +  +VD+K G       +A+   Q+  YA       G 
Sbjct: 136 ELEPDVP-LRGFVDRVDELAGGELRVVDYKTGRAPGGLYEAKALFQMKFYALALWKLRGV 194

Query: 161 IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
           +      + L               +    D+L   ++                  + + 
Sbjct: 195 VPNELRLMYL--------GSGDTLTYEPEPDELDRFSRTL----VAIWRAIQAAGRTGDF 242

Query: 221 YGVNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSS 266
                  C++C  + RCPA               +    + +  + 
Sbjct: 243 RPNPGPLCKWCEHQSRCPAFGNTPPEYPGWPDEVDDEALVLELLAE 288


>gi|254385059|ref|ZP_05000393.1| conserved hypothetical protein [Streptomyces sp. Mg1]
 gi|194343938|gb|EDX24904.1| conserved hypothetical protein [Streptomyces sp. Mg1]
          Length = 279

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 39/262 (14%), Positives = 71/262 (27%), Gaps = 40/262 (15%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           + LS S +  +++CP+        K+P+  S  A+ GT  H +L    +   +  T    
Sbjct: 7   SSLSPSRAGDFMRCPLLYRFRVIDKLPEKPSAAATRGTLVHAVLERLFDHPAEERTAPRA 66

Query: 63  KLTFENDTRIVDTEMASS-------------------VSMVLAYVRTFSGPFLSE-TEVP 102
           K         +                             ++    T   P   E  E  
Sbjct: 67  KALIPGQWDRLLEAKPELSELFPEGDEGAGLARWLTEAEALVDRWFTLEDPTRLEPVERE 126

Query: 103 LEPFTT---EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALH 156
               T         G  D +      +  IVD+K G     +       Q+  YA     
Sbjct: 127 FFVETELESGLRLRGIIDRVDVAPSGEVRIVDYKTGKAPRPEYAEGALFQMKFYALVVWR 186

Query: 157 QYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAV 216
             G +  R + + L            +  +     DL    ++             +   
Sbjct: 187 LKGVVPRRLQLVYL--------GSGDVVTYDPVVADLERVERKLL----ALWDAIREATE 234

Query: 217 SLEHYGVNDDSCRFCRAKVRCP 238
           + +        C +C  +  CP
Sbjct: 235 TGDWRPRPTKLCGWCDHRAVCP 256


>gi|328881293|emb|CCA54532.1| RecB family exonuclease [Streptomyces venezuelae ATCC 10712]
          Length = 315

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 36/260 (13%), Positives = 69/260 (26%), Gaps = 40/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  +++CP+        ++P+  S  A+ GT  H +L    +      T    + 
Sbjct: 32  LSPSRASDFMQCPLLYRFRVIDRLPEKPSEAATRGTLVHAVLERLFDDPAAERTAPRARA 91

Query: 65  TFENDTRIVDTEMASS-------------------VSMVLAYVRTFSGPFLS---ETEVP 102
                   +                             ++    +   P      E E+ 
Sbjct: 92  MVPGQWERLLETKPELGQLFAEDPEGQRLAGWLGEAERLVERWFSLEDPTRLEPAERELF 151

Query: 103 LEPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQY 158
           +E          G  D +         IVD+K G     +  +    Q+  YA       
Sbjct: 152 VETELDSGLRLRGVIDRIDVAPSGDVRIVDYKTGKAPRPEYRDGALFQMTFYALVVWRLR 211

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
             I  R + + L            +  +     DL    ++                 + 
Sbjct: 212 RVIPRRLQLVYL--------GSGEVLTYDPVEADLRRVERKLL----ALWDAIRTATETG 259

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
           +        C +C  +  CP
Sbjct: 260 DWRPRPTKLCGWCDHQAVCP 279


>gi|3790598|gb|AAC68687.1| unknown [Rhodococcus erythropolis]
          Length = 323

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 39/259 (15%), Positives = 66/259 (25%), Gaps = 42/259 (16%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        +IP+T +     GT  H  L                  
Sbjct: 53  LSPSRAGDYKQCPLLYRFRAVDRIPETPTRAQVRGTVVHAALEALFALPTGHRVPDRAAE 112

Query: 65  TFENDTRIVDTEMASSVS----------------------MVLAYVRTFSGPFLSETEVP 102
                   V  E   +                         +    R  +       E  
Sbjct: 113 LVRPAWERVSAESPEAAELIPEDELDAFLGEVGKLVATYYTLEDPTRFDAEACEVYVETE 172

Query: 103 LEPFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYG 159
           LE         G  D +      +  +VD+K G       E+    Q+  YA   L   G
Sbjct: 173 LE---NGVRLRGFVDRIDVAPTGEVRVVDYKTGKAPREFTESKALFQMKFYALVLLRTRG 229

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +  +   + L            I  +    D+L+   +      +           + +
Sbjct: 230 IVPAQLRLIYL--------PSGSILTYAPDHDELIRFERTL----SAIWKAILAAGATGD 277

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  K  CP
Sbjct: 278 FRPKPGKLCDWCDHKSLCP 296


>gi|291450479|ref|ZP_06589869.1| conserved hypothetical protein [Streptomyces albus J1074]
 gi|291353428|gb|EFE80330.1| conserved hypothetical protein [Streptomyces albus J1074]
          Length = 281

 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 37/263 (14%), Positives = 71/263 (26%), Gaps = 44/263 (16%)

Query: 8   SASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           S S +  +++CP+        ++P+  S  A+ GT  H +L    +      T       
Sbjct: 2   SPSRASDFMQCPLLYRFRVIDRLPEKPSPAATRGTLVHAVLERLFDAPAAERTAPRATGL 61

Query: 66  FENDTRIVDTEMASSVSMV-----------------------LAYVRTFSGPFLS---ET 99
              +   +  E      +                        +    T   P      E 
Sbjct: 62  LPGEWERLLAERPELAELFSGEEGESTPGERLERWLGEAERLVERWFTLEDPTRLEPAER 121

Query: 100 EVPLEPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGAL 155
           E+ +E          G  D +      +  IVD+K G     +       Q+  YA    
Sbjct: 122 ELFVEAELESGLRLRGIIDRVDVAPTGEVRIVDYKTGKAPRPQYAEGALFQMTFYALVVW 181

Query: 156 HQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRA 215
              G +  R + + L            +  +     DL    ++             +  
Sbjct: 182 RLKGVLPRRLQLVYL--------GSGEVRSYDPVMADLERVERKLL----ALWEAIQEAT 229

Query: 216 VSLEHYGVNDDSCRFCRAKVRCP 238
            + +        C +C  +  CP
Sbjct: 230 RTGDWRPKPSKLCGWCDHQAVCP 252


>gi|302533531|ref|ZP_07285873.1| RecB family exonuclease [Streptomyces sp. C]
 gi|302442426|gb|EFL14242.1| RecB family exonuclease [Streptomyces sp. C]
          Length = 294

 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 37/260 (14%), Positives = 70/260 (26%), Gaps = 40/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  +++CP+        ++P+  S  A+ GT  H +L    +      TV   K 
Sbjct: 22  LSPSRAGDFMQCPLLYRFRVIDRLPEKPSAAATRGTLVHAVLERLFDHPAHERTVPRAKE 81

Query: 65  TFENDTRIVDTEMASSVSMV-------------------LAYVRTFSGPFLSE-TEVPLE 104
                   +         +                    +    T   P   E  E    
Sbjct: 82  LLPGQWERLLEAKPELAELFPEGDGGAGLARWLSEAEALVERWFTLEDPTRLEPVEREFF 141

Query: 105 PFTT---EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQY 158
                       G  D +   +  +  IVD+K G     +       Q+  YA       
Sbjct: 142 VEAELESGLRLRGIIDRVDVAATGEVRIVDYKTGKAPRPEYAEGALFQMKFYALVVWRLR 201

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
             +  R + + L            +  +     DL    +  + +         +   + 
Sbjct: 202 QVVPRRLQLVYL--------GSGDVLTYDPVPADL----ERVERKLYALWEAIREATETG 249

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
           +        C +C  +  CP
Sbjct: 250 DWRPRPTKLCGWCDHQAVCP 269


>gi|72162215|ref|YP_289872.1| hypothetical protein Tfu_1816 [Thermobifida fusca YX]
 gi|71915947|gb|AAZ55849.1| conserved hypothetical protein [Thermobifida fusca YX]
          Length = 280

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 44/258 (17%), Positives = 78/258 (30%), Gaps = 37/258 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  +++CP+        +IP+  S  A  GT  H +L    E   ++ T      
Sbjct: 13  LSPSRATDFMQCPLLFRFRVIDRIPEPPSPAARRGTLVHAVLEKLFELPAESRTPDAALA 72

Query: 65  TFENDTRIVDTE----------------MASSVSMVLAYVRTFSGPFLSE---TEVPLEP 105
             E     +  +                       ++        P   E    EV LE 
Sbjct: 73  LLEPQWERMREQEPDVEAMFPDAEALAAWLEEARALVRRYFDLESPQRLEPQQREVRLEV 132

Query: 106 FTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDI 161
                P   G  D +      Q  IVD+K G     + E+    Q+  Y      + G +
Sbjct: 133 PLESGPLLLGYVDRVDVAPTGQVRIVDYKTGKSPAPRYEDKARFQIFFYGVMVWRETGRV 192

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
             R + L L            +  +  + +++    +  +           + A +    
Sbjct: 193 PDRLQLLYL--------GDGAVRWYDPTEEEM----RNAEAHIRAVWDTIVETARTGRWL 240

Query: 222 GVNDDSCRFCRAKVRCPA 239
                 C +C  +  CPA
Sbjct: 241 PRRSPLCNWCDHRALCPA 258


>gi|294811705|ref|ZP_06770348.1| putative RecB family exonuclease [Streptomyces clavuligerus ATCC
           27064]
 gi|294324304|gb|EFG05947.1| putative RecB family exonuclease [Streptomyces clavuligerus ATCC
           27064]
          Length = 307

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 35/260 (13%), Positives = 71/260 (27%), Gaps = 40/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  +++CP+        ++P+  S  A+ GT  H +L    +      T    + 
Sbjct: 35  LSPSRASDFMQCPLLYRFRVIDRLPERPSAAATRGTLVHAVLERLFDAPAAERTAGRARS 94

Query: 65  TFENDTRIVDTEMASS-------------------VSMVLAYVRTFSGPFLS---ETEVP 102
                   +  +                          ++    +   P      E E+ 
Sbjct: 95  LVPGQWDRLLADRPELGGLFEGDTGGERLAGWLAEAEALVERWFSLEDPTRLEPAEREMF 154

Query: 103 LEPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQY 158
           +E          G  D +      +  IVD+K G     +       Q+  YA       
Sbjct: 155 VEVGLDSGLRLRGVIDRVDVAPTGEVRIVDYKTGKAPRPEYSEGALFQMHFYALVIWRLK 214

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
             +  R + + L            +  +     DL    ++             +   + 
Sbjct: 215 KVVPRRLQLVYL--------GSGDVLTYDPVPADLERVERKLL----ALWDAIRRATETG 262

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
           +        C +C  +  CP
Sbjct: 263 DWRPRPTKLCGWCDHQAVCP 282


>gi|269795394|ref|YP_003314849.1| RecB family exonuclease [Sanguibacter keddieii DSM 10542]
 gi|269097579|gb|ACZ22015.1| RecB family exonuclease [Sanguibacter keddieii DSM 10542]
          Length = 297

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 39/257 (15%), Positives = 75/257 (29%), Gaps = 37/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S ++ + +CP+        ++P+  S  A+ GT  H++L    +  +   TV   + 
Sbjct: 29  LSPSRANDFTQCPLLFRFRVVDRLPEPPSSAAARGTLVHSVLERLYDAPLGERTVELAQS 88

Query: 65  TFENDTRIVDTEMASSVSMVLAYVRTFSG----------PFLSETEVPLEPF-------- 106
               +   +         +     +T              F  E    LEP         
Sbjct: 89  LIPGEWDRLREASPEYGELFADAAQTEGWLDGAGRLVSTYFTLEDPNRLEPESRETFVES 148

Query: 107 --TTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDI 161
                P   G  D +         +VD+K G         +   Q+  Y      + G+I
Sbjct: 149 QLDGGPLMRGIVDRIDVAPNGAVRVVDYKSGKSPRPGYAGSAEFQMRFYGLVLWRERGEI 208

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
               + + L            +     +   LL   ++ +       +     A +    
Sbjct: 209 PKMLQLVYL--------GDGQVLRSEPTEAQLLATEQKVRT----IWTSIETAATTGVWA 256

Query: 222 GVNDDSCRFCRAKVRCP 238
                 C +C  +  CP
Sbjct: 257 PRRSKLCGWCAHQSVCP 273


>gi|84496467|ref|ZP_00995321.1| hypothetical protein JNB_03070 [Janibacter sp. HTCC2649]
 gi|84383235|gb|EAP99116.1| hypothetical protein JNB_03070 [Janibacter sp. HTCC2649]
          Length = 281

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 46/258 (17%), Positives = 72/258 (27%), Gaps = 38/258 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        K+    S  A+ GT  H +L H  E      T      
Sbjct: 5   LSPSRAADFKQCPLLFRFRTIDKLDGPPSPAAARGTLVHEVLEHLFELPAAERTPEAALA 64

Query: 65  TFENDTRIVDTEMASSVSM------------------VLAYVRTFSGPFLS---ETEVPL 103
             +     +  E     +M                  ++    T   P      E E+ +
Sbjct: 65  LLQPRWASLVEERPELATMIEDDETLTEDGWFTAAGALVERWFTLENPQWLEPAERELYV 124

Query: 104 EPFTTEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGD 160
           E         G  D L         +VD+K G       E     Q+  YA     Q G 
Sbjct: 125 ETEVDGLTLRGYVDRLDIAPDGSMRVVDYKTGRSPREAFEGKALFQMKFYALVLWRQRGV 184

Query: 161 IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
           I    + + L            I  +     DLL   +              + + + + 
Sbjct: 185 IPKLLQLVYL--------GNGEIVRYEPDEHDLLGLERNV----QAVWQAIVRASETGDW 232

Query: 221 YGVNDDSCRFCRAKVRCP 238
                  C +C  K  CP
Sbjct: 233 RPRASKLCDWCDFKEFCP 250


>gi|325676838|ref|ZP_08156511.1| RecB family exonuclease [Rhodococcus equi ATCC 33707]
 gi|325552386|gb|EGD22075.1| RecB family exonuclease [Rhodococcus equi ATCC 33707]
          Length = 301

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 43/257 (16%), Positives = 74/257 (28%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+T S    +GT  H  L                K 
Sbjct: 30  LSPSRAGDFKQCPLLYRFRAIDRLPETPSKAQVKGTVVHAALEALFALPAGERVADRAKE 89

Query: 65  TFENDTRIVDTEMASSVS---------MVLAYVRTFSGPFLSETEVPLEPF--------- 106
             E     V  +                +    R  +  +  E     +P          
Sbjct: 90  LVEPAWDRVLADSPELAELIGPADRGQFLTDARRLIANYYRLEDPTRFDPEACELRVETE 149

Query: 107 -TTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
                   G  D +  +      +VD+K G      +E+    Q+  YA   L   G + 
Sbjct: 150 LDDGVLLRGFVDRVDVSPTGLVRVVDYKTGRAPWELSESKALFQMKFYALVLLRTRGVVP 209

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            R + L L               +    D+LL   +      +      S+   + +   
Sbjct: 210 ARLQLLYL--------GDGQTLTYDPVEDELLRFERTL----SAIWQAISEAGTTGDFRP 257

Query: 223 VNDDSCRFCRAKVRCPA 239
                C +C  + RCPA
Sbjct: 258 NPGRLCDWCDHRSRCPA 274


>gi|290961676|ref|YP_003492858.1| hypothetical protein SCAB_73381 [Streptomyces scabiei 87.22]
 gi|260651202|emb|CBG74323.1| conserved hypothetical protein [Streptomyces scabiei 87.22]
          Length = 307

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 38/262 (14%), Positives = 71/262 (27%), Gaps = 40/262 (15%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +++CP+        ++P+  S  A+ GT  H +L    +      T    
Sbjct: 29  ASLSPSRASDFMQCPLLYRFRVIDRLPEKPSEAATRGTLVHAVLERLFDAPAAERTAPRA 88

Query: 63  KLTFENDTRIVDT-------------------EMASSVSMVLAYVRTFSGPFLS---ETE 100
           +         +                        +    ++    T   P      E E
Sbjct: 89  RSLVPGQWDRLRETRPEVEELFADDEEGERLARWLAEAEQLVERWFTLEDPTRLEPAERE 148

Query: 101 VPLEPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALH 156
           + +E          G  D +      +  IVD+K G     +       Q+  YA     
Sbjct: 149 LFVEAELESGLRLRGIIDRVDVAPTGEVRIVDYKTGKAPRPEYAEGALFQMKFYALVVWR 208

Query: 157 QYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAV 216
               +  R + + L            +  +     DL    ++                 
Sbjct: 209 LKRVVPRRLQLVYL--------GSGDVLTYDPVIADLERVERKLL----ALWEAIRMATE 256

Query: 217 SLEHYGVNDDSCRFCRAKVRCP 238
           S +        C +C  +  CP
Sbjct: 257 SGDWRPRPTKLCGWCDHRAVCP 278


>gi|302550304|ref|ZP_07302646.1| RecB family exonuclease [Streptomyces viridochromogenes DSM 40736]
 gi|302467922|gb|EFL31015.1| RecB family exonuclease [Streptomyces viridochromogenes DSM 40736]
          Length = 281

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 37/259 (14%), Positives = 69/259 (26%), Gaps = 40/259 (15%)

Query: 8   SASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           S S +  +++CP+        ++P+  S  A+ GT  H +L    +      T    K  
Sbjct: 2   SPSRASDFMQCPLLYRFRVIDRLPEKPSEAATRGTLVHAVLERLFDAPAAERTAPRAKSL 61

Query: 66  FENDTRIVDT-------------------EMASSVSMVLAYVRTFSGPFLS---ETEVPL 103
                  +                             ++    T   P      E E+ +
Sbjct: 62  IPGQWDRLRETRPEVVELFADDPQGERLARWLGEAERLVERWFTLEDPSRLEPAERELFV 121

Query: 104 EPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYG 159
           E          G  D +      +  IVD+K G     +       Q+  YA        
Sbjct: 122 EAELESGLRLRGIIDRVDVAPTGEVRIVDYKTGKAPRPEYSEGALFQMKFYALVVWRLKN 181

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +  R + + L            +  +     DL    ++             +   S +
Sbjct: 182 VVPRRLQLVYL--------GSGEVLTYDPVLADLERVERKLL----ALWEAIRQATESGD 229

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  +  CP
Sbjct: 230 WRPRPTKLCGWCDHQAHCP 248


>gi|47842849|ref|NP_958125.2| gp20 [Burkholderia phage Bcep43]
 gi|47719037|gb|AAR89311.2| gp20 [Burkholderia phage Bcep43]
          Length = 424

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 71/389 (18%), Positives = 133/389 (34%), Gaps = 34/389 (8%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            H+ LS S   RW  CP + TL   +P  +S  A+EGT AH +    + Q  D    + +
Sbjct: 21  EHSTLSVSGRERWRNCPASVTLSKGMPDNSSPAAAEGTCAHTVGEFYVRQHFDLPGAAPR 80

Query: 63  KLTFENDT------------RIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFT 107
                  +               + ++         ++ +   P        E  +    
Sbjct: 81  GAEAPPQSVPEGLDLKGKTVEEWNDDLRRHGKAYRDFIISLIPPGVEAFVSLEQRVAAKA 140

Query: 108 TEPGATGTADILIFNSTQ--WIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRP 165
            +    GTAD LI+       I+VD+KYG  V             A  A+        + 
Sbjct: 141 IDGRLFGTADCLIWCPGARVLIVVDYKYGFMVVDVGTAEKPNAQLAAYAVAALDSCTLQA 200

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV-- 223
             + L + QPR   G P ++  +SA+ +  + +  +E         +   +  +      
Sbjct: 201 NGVMLAVFQPRRNIGEPGHKVYLSAEHVTAEQQRMREEVVRVDMAANFAPIGNDPTNPYI 260

Query: 224 -NDDSCRFCRAKVRCPALSRHVLLEATK------DPSTNTTVELSKAYSSISLIKSYVKA 276
              D CR+C+AK  CP   +  L  A                +L   YS+ S +KS  + 
Sbjct: 261 VAGDHCRYCKAKPACP-RMQDALQIAFDVNAGRRSVLDMPEDDLIALYSARSGVKSLWED 319

Query: 277 CEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKT--PKE 334
            E  +      G +    +   GR   R +++   A   L ++   +  + +  +     
Sbjct: 320 VEQRIELLAQRGHDALTIKTSPGR---RMWRNAKAAALTLLALDRTDLLQPVALSEAIAH 376

Query: 335 LEQLYKEQKVSDEFWEELQELITRGDGKP 363
           + +   +  +        Q ++ +    P
Sbjct: 377 IPEALHDDLIGKSRDS--QSIVVKTPAAP 403


>gi|291443539|ref|ZP_06582929.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
 gi|291346486|gb|EFE73390.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
          Length = 290

 Score =  163 bits (412), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 36/259 (13%), Positives = 70/259 (27%), Gaps = 40/259 (15%)

Query: 8   SASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           S S +  +++CP+        K+P+  S  A+ GT  H +L    +      T    +  
Sbjct: 2   SPSRASDFMQCPLLYRFRVIDKLPEKPSEAATRGTLVHAVLERLFDVPAADRTAPRARAL 61

Query: 66  FENDTRIVDT-------------------EMASSVSMVLAYVRTFSGPFLS---ETEVPL 103
                  +                             ++    +   P      E E+ +
Sbjct: 62  IPGQWDRLLESKPELSDLFAGDSEGERLTRWLGEAERLVDRWFSLEDPTRLEPAEREMFV 121

Query: 104 EPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENNT--QLMLYACGALHQYG 159
           E          G  D +      +  IVD+K G     +  +    Q+  YA       G
Sbjct: 122 ETELESGLRLRGVIDRVDIAPSGEVRIVDYKTGKAPRPEYSDGPLFQMTFYALVIWRLKG 181

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +  R + + L            +  +     DL    ++                 + +
Sbjct: 182 VVPRRLQLVYL--------GSGDVMTYDPVVADLERVERKLL----ALWDAIRLATETGD 229

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  +  CP
Sbjct: 230 WRPRPTKLCGWCDHQAVCP 248


>gi|309813116|ref|ZP_07706840.1| conserved hypothetical protein [Dermacoccus sp. Ellin185]
 gi|308432920|gb|EFP56828.1| conserved hypothetical protein [Dermacoccus sp. Ellin185]
          Length = 281

 Score =  163 bits (412), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 46/259 (17%), Positives = 77/259 (29%), Gaps = 37/259 (14%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +++CP+        K+P++ S  AS GT  H++L    +      T+   
Sbjct: 3   ASLSPSRASDFMQCPLLYRFRVIDKLPESPSAAASRGTLVHSVLERIFDVDAPKRTLERA 62

Query: 63  KLTFENDTRIV-DTE----------------MASSVSMVLAYVRTFSGPFLS---ETEVP 102
                +    +   E                       ++        P      E E+ 
Sbjct: 63  LDLVPHAWEDMLTDEPELAELAGSTPHDLATWLRDAEKLVEKWFAMENPQFLEPAERELY 122

Query: 103 LEPFTTEPGATGTADILIFNSTQ-WIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYG 159
           +E         G  D L         +VD+K G       EN    Q+  YA       G
Sbjct: 123 VEADLDGLTLRGYIDRLDVAPGGQIRVVDYKTGRAPSELFENKALFQMKFYALVIWRTRG 182

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +    + + L          S    +     DLL   ++ K           + A + +
Sbjct: 183 VMPLMLQLVYL--------GNSQFLRYQPDEADLLALERKLK----ALWRAIERCARTGD 230

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  K  CP
Sbjct: 231 WRPKKSRLCSWCDHKALCP 249


>gi|326329757|ref|ZP_08196078.1| RecB family exonuclease [Nocardioidaceae bacterium Broad-1]
 gi|325952522|gb|EGD44541.1| RecB family exonuclease [Nocardioidaceae bacterium Broad-1]
          Length = 293

 Score =  162 bits (411), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 45/260 (17%), Positives = 73/260 (28%), Gaps = 39/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  +  CP+        ++P+  S  A+ GT  H +L    +      T    + 
Sbjct: 22  LSPSRASDFTSCPLLYRFRTIDQLPEPPSEAAARGTVVHKVLEDLFDLPAPERTPRQARS 81

Query: 65  TFENDTRIV------------DTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE--- 109
             E     V                    + + +  +     F  E    LEP   E   
Sbjct: 82  MVEQAWEDVRSLDPALATLFTTAADEEEAAWLESCRQVLRRYFDLEDPRRLEPAEREHYV 141

Query: 110 -------PGATGTADILIF-NSTQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYG 159
                      G  D +      +  +VD+K         +A+   QL  YA       G
Sbjct: 142 EALLDSKLLLRGFIDRVDIAADGRIRVVDYKTSRIPSETYEAKALFQLRFYALVIWRTRG 201

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +    + + L            I  +V    DLL   ++                 + E
Sbjct: 202 VVPAMLQLIYL--------GSGDILRYVPDEADLLATERK----AEAIWRAIRTAQETGE 249

Query: 220 HYGVNDDSCRFCRAKVRCPA 239
                   C +C  K  CPA
Sbjct: 250 WLPNPGKLCGWCAHKPLCPA 269


>gi|149882920|ref|YP_001294857.1| BcepNY3gp19 [Burkholderia phage BcepNY3]
 gi|148763571|gb|ABR10554.1| BcepNY3gp19 [Burkholderia phage BcepNY3]
          Length = 417

 Score =  162 bits (410), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 76/386 (19%), Positives = 135/386 (34%), Gaps = 35/386 (9%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD------- 55
            H+ LS S   RW  CP + TL   +P  +S  A+EGT AH +    + Q  D       
Sbjct: 21  EHSTLSFSGRERWRNCPASVTLSKGMPDNSSPAAAEGTCAHTVGEFYVRQHFDLPGAAPR 80

Query: 56  -AETVSHQKLTFENDT----RIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFT 107
             E          +         + ++         ++ +   P        E  +   T
Sbjct: 81  GTEAPLQAVPEGLDLEGKTVEEWNDDLRRHGKAYRDFIISLIPPGVEAFVSLEQRVAAKT 140

Query: 108 TEPGATGTADILIFNSTQ--WIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRP 165
            +    GTAD LI+       I+VD+KYG  V             A  A+        + 
Sbjct: 141 IDGRLFGTADCLIWCPGARVLIVVDYKYGFMVVDVGTAEKPNAQLAAYAVAALDSCTLQA 200

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
             + L + QPR   G P ++  +SA+ +  + +  +E          K   S + + V  
Sbjct: 201 NGVMLAVFQPRRNIGEPGHKVYLSAEHVAAEQQRMREEVVRV----DKATASPDLFIVAG 256

Query: 226 DSCRFCRAKVRCPALSRHVLLEATK------DPSTNTTVELSKAYSSISLIKSYVKACED 279
           D CR+C+AK  CP   +  L  A                +L   YS+ S +KS  +  E 
Sbjct: 257 DHCRYCKAKPACP-RMQDALQIAFDVNAGRRSILDMPEDDLIALYSARSGVKSLWEDVEQ 315

Query: 280 EMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKT--PKELEQ 337
            +      G +    +   GR   R +++   A   L ++   +  + +  +     + +
Sbjct: 316 RIELLAQRGHDALTIKTSPGR---RMWRNAKAAALTLLALDRTDLLQPVALSEAIAHIPE 372

Query: 338 LYKEQKVSDEFWEELQELITRGDGKP 363
              +  +        Q ++ +    P
Sbjct: 373 ALHDDLIGKSRDS--QSIVVKTPAAP 396


>gi|226306669|ref|YP_002766629.1| hypothetical protein RER_31820 [Rhodococcus erythropolis PR4]
 gi|226185786|dbj|BAH33890.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 291

 Score =  162 bits (410), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 39/259 (15%), Positives = 66/259 (25%), Gaps = 42/259 (16%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        +IP+T +     GT  H  L                  
Sbjct: 21  LSPSRAGDYKQCPLLYRFRAVDRIPETPTRAQVRGTVVHAALEALFALPTGHRVPDRAAE 80

Query: 65  TFENDTRIVDTEMASSVS----------------------MVLAYVRTFSGPFLSETEVP 102
                   V  E   +                         +    R  +       E  
Sbjct: 81  LVRPAWERVSAESPEAADLIPEDELDAFLGEVGKLVATYYTLEDPTRFDAEACEVYVETE 140

Query: 103 LEPFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYG 159
           LE         G  D +      +  +VD+K G       E+    Q+  YA   L   G
Sbjct: 141 LE---NGVRLRGFVDRIDVAPTGEVRVVDYKTGKAPREFTESKALFQMKFYALVLLRTRG 197

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +  +   + L            I  +    D+L+   +      +           + +
Sbjct: 198 IVPAQLRLIYLA--------SGSILTYAPDHDELIRFERTL----SAIWKAILAAGATGD 245

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  K  CP
Sbjct: 246 FRPKPGKLCDWCDHKSLCP 264


>gi|312139712|ref|YP_004007048.1| recb family exonuclease [Rhodococcus equi 103S]
 gi|311889051|emb|CBH48364.1| RecB family exonuclease [Rhodococcus equi 103S]
          Length = 295

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 44/260 (16%), Positives = 75/260 (28%), Gaps = 36/260 (13%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+T S    +GT  H  L                K 
Sbjct: 24  LSPSRAGDFKQCPLLYRFRAIDRLPETPSKAQVKGTVVHAALEALFALPAGERVADRAKE 83

Query: 65  TFENDTRIVDTEMASSVS---------MVLAYVRTFSGPFLSETEVPLEPF--------- 106
             E     V  +                +    R  +  +  E     +P          
Sbjct: 84  LVEPAWDRVLADSPELAELIGPADRGQFLTDARRLIANYYRLEDPTRFDPEACELRVETE 143

Query: 107 -TTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
                   G  D +  +      +VD+K G      +E+    Q+  YA   L   G + 
Sbjct: 144 LDDGVLLRGFVDRVDVSPTGLVRVVDYKTGRAPWELSESKALFQMKFYALVLLRTRGVVP 203

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            R + L L               +    D+LL   +      +      S+   + +   
Sbjct: 204 ARLQLLYL--------GDGQTLTYDPVEDELLRFERTL----SAIWQAISEAGTTGDFRP 251

Query: 223 VNDDSCRFCRAKVRCPALSR 242
                C +C  + RCPA  R
Sbjct: 252 NPGRLCDWCDHRSRCPAFGR 271


>gi|21220149|ref|NP_625928.1| hypothetical protein SCO1653 [Streptomyces coelicolor A3(2)]
 gi|6119695|emb|CAB59506.1| conserved hypothetical protein SCI41.36 [Streptomyces coelicolor
           A3(2)]
          Length = 284

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 36/262 (13%), Positives = 72/262 (27%), Gaps = 40/262 (15%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +++CP+        ++P+  S  A+ GT  H +L    +      T    
Sbjct: 6   ASLSPSRAGDFMQCPLLYRFRVIDRLPEKPSEAATRGTLVHAVLERLFDAPAAERTAPTA 65

Query: 63  KLTFENDTRIVDT-------------------EMASSVSMVLAYVRTFSGPFLS---ETE 100
           +         +                     +  +    ++    +   P      E E
Sbjct: 66  RALVPGQWDRLRESRPEVGELFADDPEGERLAQWLAEAERLVERWFSLEDPSRLEPAERE 125

Query: 101 VPLEPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALH 156
           + +E          G  D +      +  IVD+K G     +       Q+  YA     
Sbjct: 126 LFVEAELDSGLRLRGIIDRVDVAPTGEVRIVDYKTGKAPRPQYAEGALFQMKFYALVVWR 185

Query: 157 QYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAV 216
               +  R + + L            +  +     DL    ++                 
Sbjct: 186 LKKVVPRRLQLVYL--------GSGDVLTYDPVLADLERVERKLL----ALWEAIRLATE 233

Query: 217 SLEHYGVNDDSCRFCRAKVRCP 238
           + +        C +C  +  CP
Sbjct: 234 TGDWRPRPTKLCGWCDHQAHCP 255


>gi|54025152|ref|YP_119394.1| hypothetical protein nfa31830 [Nocardia farcinica IFM 10152]
 gi|54016660|dbj|BAD58030.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 302

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 45/258 (17%), Positives = 73/258 (28%), Gaps = 38/258 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+   L    +IP+  S +A  GT  H +L                  
Sbjct: 29  LSPSRAMDFKQCPLKYRLRAIDRIPEPPSRHAVRGTVVHAVLEDLYGLPAAERGRDRAAA 88

Query: 65  TFENDTRIVDTEMASSVS---------------MVLAYVRTFSGPFLS-----ETEVPLE 104
             E     V  E                      ++        P        E  V +E
Sbjct: 89  LIEPAWARVLAERPEIAELVAEDGPAAFLAEVAALVDTYYRLEDPTRFSPESREARVEVE 148

Query: 105 PFTTEPGATGTADILIFNS-TQWIIVDFKYGA--GVPVKAENNTQLMLYACGALHQYGDI 161
                    G  D +      +  +VD+K G   G   + +   QL  YA   L   G +
Sbjct: 149 LG-DGVLLRGFVDRIDVAPTGELRVVDYKTGRAPGPAQETKALFQLKFYALVVLRTRGIL 207

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
             +   + L            I  +   A++L    +          +   +   + E  
Sbjct: 208 PAQLRLIYLA--------DGQILTYAPDAEELDRFERTL----AALWTAIREAGRTGEFP 255

Query: 222 GVNDDSCRFCRAKVRCPA 239
                 C +C  K  CPA
Sbjct: 256 PSTSWLCGYCDYKPLCPA 273


>gi|269126538|ref|YP_003299908.1| RecB family exonuclease-like protein [Thermomonospora curvata DSM
           43183]
 gi|268311496|gb|ACY97870.1| RecB family exonuclease-like protein [Thermomonospora curvata DSM
           43183]
          Length = 311

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 45/287 (15%), Positives = 76/287 (26%), Gaps = 43/287 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+        +IP+  S  A  GT  H +L    +      TV     
Sbjct: 26  LSPSRAGDFMTCPLLYRFRVIDQIPERPSPAAVRGTLVHAVLERLYDLPAAERTVEAAVA 85

Query: 65  TFENDTRIV----------------------DTEMASSVSMVLAYVRTFSGPFLS---ET 99
                   +                                ++    T   P      E 
Sbjct: 86  LLGPQWERLLAEEPDLAAMFAPEAADDPDADQEAWMERARQMVERYFTLEDPRRLEPAER 145

Query: 100 EVPLEPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPV--KAENNTQLMLYACGAL 155
           E+ +E          G  D +      +  IVD+K G       +A    Q+  YA    
Sbjct: 146 ELYVETVLESGLKLRGYIDRVDIAPTGEIRIVDYKTGTAPRADFEARALFQMKFYALVVW 205

Query: 156 HQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRA 215
             YG +    + + L            +  +V    +L    ++             +  
Sbjct: 206 RLYGAVPRMLQLMYL--------GNGEVLRYVPDEAELRATQRKV----EALWQAIVRAM 253

Query: 216 VSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSK 262
            + E        C +C  K RCP             P   +  +L  
Sbjct: 254 RTGEWRARPSRLCDWCDHKQRCPEFGGTPPPLPAVPPLRRSPADLEA 300


>gi|38638628|ref|NP_944329.1| gp21 [Burkholderia phage Bcep1]
 gi|34486010|gb|AAQ73367.1| gp21 [Burkholderia phage Bcep1]
          Length = 417

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 76/386 (19%), Positives = 135/386 (34%), Gaps = 35/386 (9%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVD------- 55
            H+ LS S   RW  CP + TL   +P  +S  A+EGT AH +    + Q  D       
Sbjct: 21  EHSTLSISGRERWRNCPASVTLSKGMPDNSSPAAAEGTCAHTVGEFYVRQHFDLPGAAPR 80

Query: 56  -----AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFT 107
                 + V              + ++         ++ +   P        E  +   T
Sbjct: 81  GTEAPLQAVPEGLDLKGKTVEEWNDDLRRHGKAYRDFIISLIPPGVEAFVSLEQRVAAKT 140

Query: 108 TEPGATGTADILIFNSTQ--WIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRP 165
            +    GTAD LI+       I+VD+KYG  V             A  A+        + 
Sbjct: 141 IDGRLFGTADCLIWCPGARVLIVVDYKYGFMVVDVGTAEKPNAQLAAYAVAALDSCTLQA 200

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
             + L + QPR   G P ++  +SA+ +  + +  +E          K   S + + V  
Sbjct: 201 NGVMLAVFQPRRNIGEPGHKVYLSAEHVAAEQQRMREEVVRV----DKATASPDLFIVAG 256

Query: 226 DSCRFCRAKVRCPALSRHVLLEATK------DPSTNTTVELSKAYSSISLIKSYVKACED 279
           D CR+C+AK  CP   +  L  A                +L   YS+ S +KS  +  E 
Sbjct: 257 DHCRYCKAKPACP-RMQDALQIAFDVNAGRRSILDMPEDDLIALYSARSGVKSLWEDVEQ 315

Query: 280 EMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKT--PKELEQ 337
            +      G +    +   GR   R +++   A   L ++   +  + +  +     + +
Sbjct: 316 RIELLAQRGHDALTIKTSPGR---RMWRNAKAAALTLLALDRTDLLQPVALSEAIAHIPE 372

Query: 338 LYKEQKVSDEFWEELQELITRGDGKP 363
              +  +        Q ++ +    P
Sbjct: 373 ALHDDLIGKSRDS--QSIVVKTPAAP 396


>gi|284031137|ref|YP_003381068.1| RecB family exonuclease-like protein [Kribbella flavida DSM 17836]
 gi|283810430|gb|ADB32269.1| RecB family exonuclease-like protein [Kribbella flavida DSM 17836]
          Length = 295

 Score =  161 bits (407), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 46/263 (17%), Positives = 76/263 (28%), Gaps = 40/263 (15%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  ++ CP+        ++P+  S  A  GT  H +L    +      T+   
Sbjct: 15  AALSPSRAADFMSCPLKYRFRVVDRLPEKPSAAAVRGTVVHAVLERLYDLPRGQRTLEQA 74

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYV-------------------RTFSGPFLS---ETE 100
            L  E   + V  +      +                         T   P      E E
Sbjct: 75  ALMLEPQWQRVLADEPEVAQLFEDDAEGTELAKWLAEAHQLLGKYFTLEDPNALEPAERE 134

Query: 101 VPLEPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVK--AENNTQLMLYACGALH 156
           + +E          G  D L      +  +VD+K G        A+   Q+  YA     
Sbjct: 135 LYVETELESGLTLRGYVDRLDVAPTGEIRVVDYKTGRSPSEFFEAKALFQMKFYALVLWR 194

Query: 157 QYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAV 216
             G +    + + L            I  +V    DL    ++            ++   
Sbjct: 195 LRGVVPSMLQLVYL--------GNGEIVRYVPDEADLRACERKV----GALWEAITRALE 242

Query: 217 SLEHYGVNDDSCRFCRAKVRCPA 239
           S +        C +C  K  CPA
Sbjct: 243 SGDWRPSRGPLCAWCDHKALCPA 265


>gi|302561541|ref|ZP_07313883.1| RecB family exonuclease [Streptomyces griseoflavus Tu4000]
 gi|302479159|gb|EFL42252.1| RecB family exonuclease [Streptomyces griseoflavus Tu4000]
          Length = 277

 Score =  161 bits (407), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 36/259 (13%), Positives = 70/259 (27%), Gaps = 40/259 (15%)

Query: 8   SASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           S S +  +++CP+        ++P+  S  A+ GT  H +L    +      T    K  
Sbjct: 2   SPSRASDFMQCPLLYRFRVIDRLPEKPSEAATRGTLVHAVLERLFDAPAAERTAPRAKSL 61

Query: 66  FENDTRIVDT-------------------EMASSVSMVLAYVRTFSGPFLS---ETEVPL 103
                  +                        +    ++    T   P      E E+ +
Sbjct: 62  VPGQWDRLRESRPEVVELFADDPEGERLARWLAEAEALVERWFTLEDPSRLEPAERELFV 121

Query: 104 EPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYG 159
           E          G  D +      +  IVD+K G     +       Q+  YA        
Sbjct: 122 EAELDSGLRLRGIIDRVDVAPTGEVRIVDYKTGKAPRPEYAEGALFQMKFYALVVWRLKN 181

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +  R + + L            +  +     DL    ++             +   + +
Sbjct: 182 VVPRRLQLVYL--------GSGDVLTYDPVLADLERVERKLL----ALWEAIREATETGD 229

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  +  CP
Sbjct: 230 WRPRPTKLCGWCDHRTHCP 248


>gi|145223651|ref|YP_001134329.1| RecB family exonuclease [Mycobacterium gilvum PYR-GCK]
 gi|315443977|ref|YP_004076856.1| RecB family exonuclease [Mycobacterium sp. Spyr1]
 gi|145216137|gb|ABP45541.1| putative RecB family exonuclease [Mycobacterium gilvum PYR-GCK]
 gi|315262280|gb|ADT99021.1| RecB family exonuclease [Mycobacterium sp. Spyr1]
          Length = 291

 Score =  161 bits (407), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 41/260 (15%), Positives = 70/260 (26%), Gaps = 41/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+ +S     G+  H  L                  
Sbjct: 14  LSPSRAGDFKQCPLLYRFRAIDRLPEPSSTAQVRGSVVHAALEQLYALPAAERRPETALS 73

Query: 65  TFENDTRIV---------------DTEMASSVSMVLAYVRTFSGPFL-----SETEVPLE 104
                   V                 EM      +L+       P        E  V +E
Sbjct: 74  LVAPAWERVVAEQPSLATDIDPALRAEMLEQARTLLSGYYRLEDPTRFDPQSCEQRVEVE 133

Query: 105 PFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPV-----KAENNTQLMLYACGALHQY 158
                    G  D +      +  +VD+K G   P      + +   Q+  YA   L   
Sbjct: 134 L-ADGTLLRGFIDRIDVAPTGEMRVVDYKTGKAPPEARALAEFKAMFQMKFYAVALLRSR 192

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G +  R   + L   Q        I ++  + D+L    K                  + 
Sbjct: 193 GSLPARLRLVYLADHQ--------ILDYTPTLDELERFEKTLM----AIWRAIQSAGATG 240

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
           +        C +C  +  CP
Sbjct: 241 DFRPSPSRLCNWCAHQAHCP 260


>gi|329939098|ref|ZP_08288472.1| RecB family exonuclease [Streptomyces griseoaurantiacus M045]
 gi|329301983|gb|EGG45876.1| RecB family exonuclease [Streptomyces griseoaurantiacus M045]
          Length = 354

 Score =  161 bits (407), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 34/260 (13%), Positives = 68/260 (26%), Gaps = 40/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  +++CP+        ++P+  S  A+ GT  H +L    +      T    + 
Sbjct: 74  LSPSRAGDFMQCPLLYRFRVIDRLPEKPSPAATRGTLVHAVLERLFDAPAAERTAPRARS 133

Query: 65  TFENDTRIVDTEMASSVSMV-------------------LAYVRTFSGPFLSE-TEVPL- 103
                   +         +                    +        P   E  E  + 
Sbjct: 134 LVPGQWDRLLKNRPELAELFADDEDGSRLAGWLEEAGQLVERWFALEDPTRLEPVEREMF 193

Query: 104 --EPFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENNT--QLMLYACGALHQY 158
                 +     G  D +      +  IVD+K G     +       Q+  YA       
Sbjct: 194 VQTRLESGLTLRGIIDRVDVAPTGEVRIVDYKTGKAPRPEYAEGPLFQMKFYALVIWRLK 253

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
             +  R + + L            +  +    +DL    ++                 + 
Sbjct: 254 KVVPRRLQLVYL--------GSGDVVTYDPVIEDLQGVERKLL----ALWEAIRTATETG 301

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
           +        C +C  +  CP
Sbjct: 302 DWRPRPTKLCGWCDHQEFCP 321


>gi|37626198|gb|AAQ96573.1| hypothetical protein [Vibrio phage VP16C]
          Length = 375

 Score =  160 bits (405), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 70/389 (17%), Positives = 129/389 (33%), Gaps = 39/389 (10%)

Query: 2   AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH 61
             HA +  S +  W  C     +  K+    +     GT +H   +  +   +DAE    
Sbjct: 3   GQHASIPPSGAPIWGHCSGYLGVMHKVADFDTDATRAGTASHWAFSEAVLNDLDAEDYIG 62

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPF---LSETEVPLEPFTTEPGATGTADI 118
                + D  IVD  MA    +++  VR             E  +      P   GT D 
Sbjct: 63  HA---DPDGTIVDEGMAHGAQLMVDMVREDMEKHPGGQLYIEQRVYMPDIHPDNWGTLDY 119

Query: 119 LIFNSTQWIIV--DFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR 176
                    ++  D+K+G  + V  E N QL+ Y  G  +  G  F              
Sbjct: 120 AYVLPAIKRVILGDYKHGH-LEVSPERNLQLVDYLKGLENLVGYTFDGWRIDLKVCQPYA 178

Query: 177 VRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
                P   W  S  D++    +  E+               + +      CR+C    R
Sbjct: 179 YSPHGPKKVWQASRADIVPLWAQLSEQAHS------------DPHMTTGKHCRYCPLVGR 226

Query: 237 CPA--LSRHVLLEATKDPSTNTTVELSKAYSSIS-------LIKSYVKACEDEMFKRLNA 287
           C A   + + L+   K+P    T+  +   +          ++K+ ++  E+++  RL  
Sbjct: 227 CSAARQAGYSLISYVKEPFEVDTMTGADLEAERDILTEGSVILKARLEDIEEQLQNRLRK 286

Query: 288 GDEIQGYQL--VEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVS 345
           G++  G  L    GR     +   ++        +G +  K    TP +     K++  +
Sbjct: 287 GEKGIGLTLRQTTGRA---KWTQSDKVVITALKSIGLDVSKETTITPTQA----KDKAKT 339

Query: 346 DEFWEELQELITRGDGKPVIAPRDIPTNK 374
           +     ++ L  R +GK  +         
Sbjct: 340 EAQKAAVKALQRRPNGKIELVKLKDSPAH 368


>gi|326773434|ref|ZP_08232717.1| RecB family exonuclease [Actinomyces viscosus C505]
 gi|326636664|gb|EGE37567.1| RecB family exonuclease [Actinomyces viscosus C505]
          Length = 309

 Score =  160 bits (405), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 42/257 (16%), Positives = 67/257 (26%), Gaps = 37/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  +++CP+   L    ++P+  S+   +GT  H +L    +             
Sbjct: 40  LSPSRAKDFMQCPLMFRLRTVDRLPEPGSLATHKGTVVHGVLERLYDLPASERLPQAALE 99

Query: 65  TFENDTRIVDT---------EMASSVSMVLAYVRTF-SGPFLSETEVPLEP--------- 105
                               E A  V   L   R      F  E    LEP         
Sbjct: 100 LLPGQWASHREKNPEVMDLFEDADQVETWLEEARGLIRTYFTLENPQRLEPAERELFVQT 159

Query: 106 -FTTEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDI 161
                    G  D L         +VD+K G     +       Q+  YA       G  
Sbjct: 160 ETGDGLLLRGFVDRLDVAPDGAMRVVDYKTGRSPGTRFMEEALFQMRFYALVLWRLRGRA 219

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
             R + + L            +        +L         R           A +   +
Sbjct: 220 PARLQLVYL--------KDGRVLTHDPRLAELERTE----TRLAHLWDEVEDCARNGSFH 267

Query: 222 GVNDDSCRFCRAKVRCP 238
                 C +C  + +CP
Sbjct: 268 PRRSRLCDWCAFQAQCP 284


>gi|302546670|ref|ZP_07299012.1| RecB family exonuclease [Streptomyces hygroscopicus ATCC 53653]
 gi|302464288|gb|EFL27381.1| RecB family exonuclease [Streptomyces himastatinicus ATCC 53653]
          Length = 306

 Score =  160 bits (405), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 41/265 (15%), Positives = 73/265 (27%), Gaps = 43/265 (16%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +++CP+        K+P+  S  A+ GT  H +L    +      T    
Sbjct: 21  ASLSPSRAADFMRCPLLYRFRVIDKLPEKPSAAATRGTVVHAVLERLFDAPAAERTAPRA 80

Query: 63  KLTFENDTRIVDT----------------------EMASSVSMVLAYVRTFSGPFLSE-T 99
           +     +   +                        E  +    ++    +   P   E  
Sbjct: 81  RAMVPGEWERLVAAKPELAELFQGEDGAESPERLSEWLAGAQKLVEGWFSLEDPTRLEPA 140

Query: 100 EVPL---EPFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACG 153
           E  L       +     G  D +         IVD+K G     +       Q+  YA  
Sbjct: 141 ERELFVETALESGLTLRGIIDRVDIAPTGDVRIVDYKTGKAPAPQYAGEALFQMKFYALV 200

Query: 154 ALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSK 213
                G +  R + + L            +  +     DLL   ++              
Sbjct: 201 LWRLRGAVPRRLQLVYL--------GSGDVLTYDPVERDLLGVERKVL----ALWEAIRL 248

Query: 214 RAVSLEHYGVNDDSCRFCRAKVRCP 238
              S +        C +C  +  CP
Sbjct: 249 ATESGDFLPRRTKLCGWCDHQAHCP 273


>gi|255325695|ref|ZP_05366792.1| RecB family exonuclease [Corynebacterium tuberculostearicum SK141]
 gi|311739434|ref|ZP_07713269.1| exodeoxyribonuclease V beta subunit [Corynebacterium
           pseudogenitalium ATCC 33035]
 gi|255297305|gb|EET76625.1| RecB family exonuclease [Corynebacterium tuberculostearicum SK141]
 gi|311305250|gb|EFQ81318.1| exodeoxyribonuclease V beta subunit [Corynebacterium
           pseudogenitalium ATCC 33035]
          Length = 276

 Score =  160 bits (404), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 77/256 (30%), Gaps = 36/256 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        K+P+  +I   +GT  H +L    +   +  T      
Sbjct: 12  LSPSRASDYKQCPLLYRFRAIDKLPEPKTIAQVKGTLVHAVLEEMHKLPREERTYPAAVK 71

Query: 65  TFENDTRIV---DTEMASSV------SMVLAYVRTFSGPFLSETEVPLE----------P 105
             +     +   D E+   V         +A  +   G F  E     +           
Sbjct: 72  MIKPSWAEMTSKDDELLELVPEEDTYDFFVAARQLLKGYFQMENPQGFDCQETEMYVNTV 131

Query: 106 FTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
                   G  D +      +  +VD+K G     +  ++   Q+  YA       G I 
Sbjct: 132 LPNGVPVRGFIDRVDRAPTGEVRVVDYKTGKKPLPRYSHDAQFQMRFYALVYWRILGTIP 191

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L ++               + ++L    ++  E      +       + +   
Sbjct: 192 HQLRLMYLKVLDSM--------FLTPNREELEYFERDLGE----LWAKIEADGRAGDFRP 239

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  +  CP
Sbjct: 240 KPSKLCGWCAHQDLCP 255


>gi|257056217|ref|YP_003134049.1| RecB family exonuclease [Saccharomonospora viridis DSM 43017]
 gi|256586089|gb|ACU97222.1| RecB family exonuclease [Saccharomonospora viridis DSM 43017]
          Length = 333

 Score =  160 bits (404), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 34/260 (13%), Positives = 71/260 (27%), Gaps = 40/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  +     GT  H++L           T    + 
Sbjct: 59  LSPSRASDFKQCPLLYRFRAVDRLPEPPTKAQVRGTLVHSVLERLFGLPRADRTPERARE 118

Query: 65  TFENDTRIVDTEMASSVSMVLAYVRT-------------FSGPFLSETEVPLEPF----- 106
                   +  E    + +                        F  E    L+P      
Sbjct: 119 LLRPTWSQLSEECPEWMELFSEENFDKELNQWLTSAEKLLDSYFKLEDPRRLDPEACELH 178

Query: 107 -----TTEPGATGTADILIFNS-TQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQY 158
                ++     G  D +      +  +VD+K GA      +A+   Q+  YA       
Sbjct: 179 VETELSSGVLLRGYIDRVDVAPTGEIRVVDYKTGAAPREIGEAKAMFQMKFYAVVLWRLR 238

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G +  + + + L+              +     +L    +              +   + 
Sbjct: 239 GIVPRQLKLMYLS--------DGQALAYTPDEPELARFERTL----EAIWQAILRAGKTG 286

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
           +        C +C  +  CP
Sbjct: 287 DFRPNPSKLCGWCSHQALCP 306


>gi|297195363|ref|ZP_06912761.1| RecB family exonuclease [Streptomyces pristinaespiralis ATCC 25486]
 gi|197719267|gb|EDY63175.1| RecB family exonuclease [Streptomyces pristinaespiralis ATCC 25486]
          Length = 277

 Score =  159 bits (403), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 37/259 (14%), Positives = 68/259 (26%), Gaps = 40/259 (15%)

Query: 8   SASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           S S +  +++CP+        K+P+  S  A+ GT  H +L    +      T    K  
Sbjct: 2   SPSRASDFMQCPLLYRFRVIDKLPEKPSEAATRGTLVHAVLERLFDDPAAERTAPRAKAM 61

Query: 66  FENDTRIVDT-------------------EMASSVSMVLAYVRTFSGPFLS---ETEVPL 103
                  +                             ++    T   P      E E+ +
Sbjct: 62  VPGQWSRLLQTRPELGELFAEDPGGERLSRWLGEAEQLVERWFTLEDPTRLEPREREMFV 121

Query: 104 EPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYG 159
           E          G  D +      +  IVD+K G     +       Q+  YA        
Sbjct: 122 ETELESGLRLRGVIDRVDIAPTGEVRIVDYKTGKAPRPEYSEGALFQMKFYALVIWRLKQ 181

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +  R + + L            +  +     DL    ++                 + +
Sbjct: 182 VVPRRLQLVYL--------GSGDVLTYDPVTADLERMERKLL----ALWEAIRLATETGD 229

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  +  CP
Sbjct: 230 WRPRPTKLCGWCDHRSVCP 248


>gi|291301936|ref|YP_003513214.1| RecB family exonuclease-like protein [Stackebrandtia nassauensis
           DSM 44728]
 gi|290571156|gb|ADD44121.1| RecB family exonuclease-like protein [Stackebrandtia nassauensis
           DSM 44728]
          Length = 267

 Score =  159 bits (403), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 48/254 (18%), Positives = 78/254 (30%), Gaps = 34/254 (13%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S ++ +  CP+        K+P+ TS    +GT  H++L    + G    T      
Sbjct: 11  LSPSRANDFKSCPLKYRYRVIDKLPEPTSSAQVKGTLVHSVLERLYDLGAAERTSGRALE 70

Query: 65  TFENDTRIVDTEMASSV------SMVLAYVRTF-SGPFLSETEVPLEP----------FT 107
             E + + +    A +       S  +A VR      F  E    L+P            
Sbjct: 71  LVEPEWKRLRDADAEAAGVVDDESAWIAEVRKLVEAYFAVEDPRRLQPAERECLVEATTA 130

Query: 108 TEPGATGTADILIFNS-TQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFGR 164
                 G  D L      +  +VD+K G       +AE   QL  YA    H  G +   
Sbjct: 131 DGVRLKGYIDRLDVAPTGEIRVVDYKTGGVPREAFRAEALFQLKFYAVALWHVRGVVPTV 190

Query: 165 PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVN 224
              + L              ++  +  +L    +              +     +     
Sbjct: 191 LRLIYL--------KDGQAIDYSPTEAELRATERNIT----ALWRAIGEAVTRGDFRAKK 238

Query: 225 DDSCRFCRAKVRCP 238
              C +C  K RCP
Sbjct: 239 SGLCGWCHFKDRCP 252


>gi|269956281|ref|YP_003326070.1| RecB family exonuclease-like protein [Xylanimonas cellulosilytica
           DSM 15894]
 gi|269304962|gb|ACZ30512.1| RecB family exonuclease-like protein [Xylanimonas cellulosilytica
           DSM 15894]
          Length = 302

 Score =  159 bits (403), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 41/281 (14%), Positives = 81/281 (28%), Gaps = 42/281 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S ++ +++CP+        ++P+  S  A+ GT  H++L    +  +   T      
Sbjct: 36  LSPSRANDFMQCPLLFRFRMIDRLPEPPSPAAARGTLVHSVLERLYDAPLGERTPDAALR 95

Query: 65  TFENDTRIV-----------------DTEMASSVSMVLAYVRTFSGPFLS---ETEVPLE 104
              ++ R +                 + +       +L    T   P        E+ +E
Sbjct: 96  LVPDEWRRLLESEPRYQELTAGDGWTEEDWFGGAGRLLHTYFTLEDPNRLQPEARELRVE 155

Query: 105 PFT-TEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGD 160
                 P   G  D L         +VD+K G       E+N   Q+  Y      + G 
Sbjct: 156 HRLADGPLLRGIVDRLDVAPDGALRVVDYKTGKSPRPGYESNALFQMRFYGLVLWRERGV 215

Query: 161 IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
           +    + + L            +        +L    ++ +       +   K   + E 
Sbjct: 216 LPKMLQLVYL--------GDGQVLRAEPRERELELTEQKVR----ALWAAIEKAGHAGEF 263

Query: 221 YGVNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTTVELS 261
                  C +C  +  CP           +         L 
Sbjct: 264 RPRRSALCGWCAHQAVCPEFEG----TPPELDPALAAERLG 300


>gi|256391609|ref|YP_003113173.1| RecB family exonuclease-like protein [Catenulispora acidiphila DSM
           44928]
 gi|256357835|gb|ACU71332.1| RecB family exonuclease-like protein [Catenulispora acidiphila DSM
           44928]
          Length = 351

 Score =  159 bits (402), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 47/257 (18%), Positives = 70/257 (27%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+        K+P+  S  A+ GT  H +L H  +      T +    
Sbjct: 58  LSPSRAADFMTCPLLFRFRVIDKLPERKSAAATRGTLIHAVLEHLFDLPTGQRTPTSASG 117

Query: 65  TFENDTRIV----------------DTEMASSVSMVLAYVRTFSGPFLSE-TEVPL---E 104
               +   +                D         +L        P   E  E  L    
Sbjct: 118 MLSPEWERMVQADPELKALAEEAGGDEAWLKGAVDLLERYFRLEDPNRLEPAERELFVHA 177

Query: 105 PFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDI 161
                    G  D L         +VD+K G       E     Q+  YA       G +
Sbjct: 178 RIADGLLLRGFVDRLDVAPNGALRVVDYKTGRAPGPAFEGKALFQMKFYALVLWKTRGVV 237

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
             R + + L          S I  +     DL    ++         S     A   E  
Sbjct: 238 PRRLQLMYL-------GGESQIVTYDPDESDLRATERKV----AALWSAIRAAAERGEWR 286

Query: 222 GVNDDSCRFCRAKVRCP 238
                 C +C  K  CP
Sbjct: 287 ANPSRLCDWCDHKALCP 303


>gi|169629241|ref|YP_001702890.1| hypothetical protein MAB_2155c [Mycobacterium abscessus ATCC 19977]
 gi|169241208|emb|CAM62236.1| Conserved hypothetical protein [Mycobacterium abscessus]
          Length = 293

 Score =  159 bits (402), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 39/257 (15%), Positives = 71/257 (27%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+   L    ++P+  S   + G+  H  L     +       +    
Sbjct: 15  LSPSRASDFKQCPLLYRLRAIDRLPEPPSAAQARGSLVHAALEDLYTRPAAEREYATAAG 74

Query: 65  TFENDTRIVDT---------EMASSVSMVLAYVRTFSGPFLSETEVPLEPFT-------- 107
             E     +           E               SG +  E     +P +        
Sbjct: 75  LVEPAWERLVESNPELAEVVEAERLPRFFDEARDLLSGYYRLEDPTRFDPDSCEERVEVE 134

Query: 108 --TEPGATGTADILIFNSTQ-WIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIF 162
                   G  D +         +VD+K G       +A+   Q+  YA       G + 
Sbjct: 135 LADGTMLRGFIDRIDIAPGGAMRLVDYKTGRAPRALFEAKALFQMKFYAVALYRTRGVVP 194

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            R   L L+           + ++     +LL+  K                  + +   
Sbjct: 195 RRLRLLYLS--------DGEVLDYAPDEAELLKFEKTLM----AIWRAIQNIGTTGDFRP 242

Query: 223 VNDDSCRFCRAKVRCPA 239
                C +C  +  CPA
Sbjct: 243 NPSRLCDWCAHQSLCPA 259


>gi|307330766|ref|ZP_07609902.1| conserved hypothetical protein [Streptomyces violaceusniger Tu
           4113]
 gi|306883569|gb|EFN14619.1| conserved hypothetical protein [Streptomyces violaceusniger Tu
           4113]
          Length = 316

 Score =  159 bits (402), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 38/265 (14%), Positives = 70/265 (26%), Gaps = 43/265 (16%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +++CP+        K+P+  S  A+ GT  H +L    +      T    
Sbjct: 40  ASLSPSRAADFMRCPLLYRFRVIDKLPEKPSAAATRGTVVHAVLERLFDAPAAERTSPRA 99

Query: 63  KLTFENDTRIVDTEMASSVSMV----------------------LAYVRTFSGPFLS--- 97
           +     +   +         +                       +    +   P      
Sbjct: 100 RAMVPGEWDRLLAAKPELAELFQEEDGAPAPDRLAEWLTGAQALVDQWFSLEDPTRLEPA 159

Query: 98  ETEVPLEPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACG 153
           E E+ +E          G  D +         IVD+K G     +       Q+  YA  
Sbjct: 160 ERELFVETELESGLRLRGIIDRIDIAPTGDVRIVDYKTGKAPAPQYAGEALFQMKFYALV 219

Query: 154 ALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSK 213
                G I  R + + L            +  +     +L    ++              
Sbjct: 220 LWRLRGVIPRRLQLVYL--------GSGDVLTYDPDERELRAVERKVL----ALWEAIRL 267

Query: 214 RAVSLEHYGVNDDSCRFCRAKVRCP 238
              +          C +C  +  CP
Sbjct: 268 ATETGAFVPRQTRLCGWCDHQAHCP 292


>gi|300858460|ref|YP_003783443.1| hypothetical protein cpfrc_01043 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300685914|gb|ADK28836.1| hypothetical protein cpfrc_01043 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302206173|gb|ADL10515.1| RecB family exonuclease [Corynebacterium pseudotuberculosis C231]
 gi|302330730|gb|ADL20924.1| RecB family exonuclease [Corynebacterium pseudotuberculosis 1002]
 gi|308276413|gb|ADO26312.1| RecB family exonuclease [Corynebacterium pseudotuberculosis I19]
          Length = 303

 Score =  159 bits (401), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 40/257 (15%), Positives = 77/257 (29%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S ++ + +CP+        K+P+  ++   +GT  H +L    E   +         
Sbjct: 43  LSPSRANDYQQCPLLYRFRAIDKLPEPKTVAQVKGTLVHAVLEEMHEWPREQRLYPAAVK 102

Query: 65  TFENDTRIV---DTEMASSV------SMVLAYVRTFSGPFLSETEVPLEPFT-------- 107
             +     +   D+E+   V        ++       G F  E     +           
Sbjct: 103 RLKPQWAKMCSEDSELEELVPEDKTYDFLVECRSLLRGYFEMENPQGFDAHECEMYISAE 162

Query: 108 --TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
                   G  D +      +  +VD+K G     +       Q+  YA      YG I 
Sbjct: 163 LPNGVPVRGFIDRVDIAPTGEVRVVDYKTGKKPIPRFSQQAIFQMRFYALVYWRLYGKIP 222

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L +        +     + S ++L    ++  E     L   +          
Sbjct: 223 DQLRLMYLKV--------TDSMFLMPSKEELEYFERDLGELWQKILDDAAA----GSFRP 270

Query: 223 VNDDSCRFCRAKVRCPA 239
                C +C  +  CPA
Sbjct: 271 KTSKLCGWCSHQSICPA 287


>gi|152965821|ref|YP_001361605.1| RecB family exonuclease [Kineococcus radiotolerans SRS30216]
 gi|151360338|gb|ABS03341.1| putative RecB family exonuclease [Kineococcus radiotolerans
           SRS30216]
          Length = 294

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 45/266 (16%), Positives = 79/266 (29%), Gaps = 47/266 (17%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  +++CP+        ++P+T S  A+ GT  H +L    +      T +    
Sbjct: 15  LSPSRAADFMQCPLLYRFRTIDRLPETPSAAAARGTLVHAVLERLYDLPAAERTAARAGA 74

Query: 65  TFENDTRIVDTEMASS------------------------VSMVLAYVRTFSGPFLSETE 100
             E   R +                                  +L        P   E E
Sbjct: 75  MVEPQWRELLEREPRLQALFGAQPKPGTPTGDALARWLAGARALLQKYFALEDPTRLEPE 134

Query: 101 -----VPLEPFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPV--KAENNTQLMLYAC 152
                V ++     P   G  D L      +  +VD+K G       +A    Q+  YA 
Sbjct: 135 AREMHVEVDLE-DGPVLRGIVDRLDVTPAGRMRVVDYKTGRAPSETAEARALFQMRFYAL 193

Query: 153 GALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKS 212
                 G++    + + L            +        DLL   ++ +           
Sbjct: 194 VLWRLRGEVPLSLQLVYL--------GSGDVLRHTPDEGDLLATERKVR----ALWDAIE 241

Query: 213 KRAVSLEHYGVNDDSCRFCRAKVRCP 238
           +   + +       +C +C  KVRCP
Sbjct: 242 RNRATGDWRPRPGRACTWCDHKVRCP 267


>gi|119716861|ref|YP_923826.1| hypothetical protein Noca_2636 [Nocardioides sp. JS614]
 gi|119537522|gb|ABL82139.1| conserved hypothetical protein [Nocardioides sp. JS614]
          Length = 299

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 50/287 (17%), Positives = 83/287 (28%), Gaps = 41/287 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+        ++P+  S  A  GT  H +L    +      T    + 
Sbjct: 25  LSPSRAGDFMSCPLLYRFRTVDRLPEPFSPDAVRGTVVHKVLEDLFDLPAGDRTPDRAQA 84

Query: 65  TFENDTRIVDTEMAS------------SVSMVLAYVRT-FSGPFLSETEVPLEPFTTEPG 111
             E     +                   V+  LA  R      F  E    LEP   E  
Sbjct: 85  MLEPAWERLVEAAPELSELFPVDEDGAQVAAWLASCRAVLERYFTLEDPRRLEPAERELY 144

Query: 112 A----------TGTADILIFN-STQWIIVDFKYGAGVPVK--AENNTQLMLYACGALHQY 158
                       G  D +         +VD+K G        A+   Q+  YA       
Sbjct: 145 VEALLDSRLLLRGFVDRIDVAPDGAIRVVDYKSGRSPSEMFEAKALFQMKFYALVIWRTR 204

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G +    + + L            +  +V    DLL   ++             +   S 
Sbjct: 205 GVVPAMLQLIYL--------GNGELLRYVPDERDLLATERKI----EAIWQAIRRAEESG 252

Query: 219 EHYGVNDDSCRFCRAKVRCPALSRHVLLEATKDPST-NTTVELSKAY 264
           +        C +C  +  CPA          ++PS   +  E ++A 
Sbjct: 253 DWRPSPGRLCDWCAHRAICPAWGGTPPPIPAREPSLDLSVDESAEAL 299


>gi|227549279|ref|ZP_03979328.1| RecB family exonuclease [Corynebacterium lipophiloflavum DSM 44291]
 gi|227078598|gb|EEI16561.1| RecB family exonuclease [Corynebacterium lipophiloflavum DSM 44291]
          Length = 263

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 71/258 (27%), Gaps = 34/258 (13%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  +    +GT  H +L        +  T      
Sbjct: 8   LSPSRASDYKQCPLLYRFRAIDRLPEPKTEAQVKGTLVHAVLEEMHSWRREERTYPAAVK 67

Query: 65  TFENDTRIVDTEMASSVSMVLAYVRTFSGPFLS----------------ETEVPLEPFTT 108
                   +  +       +    +                        E E+ ++    
Sbjct: 68  AIVPAWERLIEQDPEVAEPISDRQQLLVDARTLIRGYFHMENPLGFDSTEQEMYVDGVLP 127

Query: 109 -EPGATGTADILIFNS-TQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGR 164
                 G  D +      +  +VD+K G        A+   Q+  YA      +G I  +
Sbjct: 128 NGVPVRGFIDRVDVAPTGEVRVVDYKTGKKPLPRYSADAQFQMRFYALVYWRFFGAIPTQ 187

Query: 165 PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVN 224
              + L ++   +           S ++L    ++  E      +               
Sbjct: 188 LRLMYLKVVDSMI--------LTPSREELEYFERDLGE----LWAKIEADGREGRFRPRT 235

Query: 225 DDSCRFCRAKVRCPALSR 242
              C +C  +  CPA   
Sbjct: 236 SKLCNWCPFQDICPAFDG 253


>gi|295839794|ref|ZP_06826727.1| RecB family exonuclease [Streptomyces sp. SPB74]
 gi|197697732|gb|EDY44665.1| RecB family exonuclease [Streptomyces sp. SPB74]
          Length = 284

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 40/266 (15%), Positives = 72/266 (27%), Gaps = 47/266 (17%)

Query: 8   SASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           S S +  +++CP+        ++P+  S  A+ GT  H +L    +      T    +  
Sbjct: 2   SPSRAGDFMRCPLLYRFRVIDRLPEKPSEAATRGTLVHAVLERLFDAPAGERTAERARAL 61

Query: 66  FENDTRIVD-------------------------TEMASSVSMVLAYVRTFSGPFLSE-T 99
                  +                           E  +S   ++    T   P   E  
Sbjct: 62  LPGQWEKLRAARPELDELFAGTAGGDAAAAGERLAEWLASAERLIERWFTLEDPTRLEPA 121

Query: 100 EVPL---EPFTTEPGATGTADILIFNS--TQWIIVDFKYGAGVPVKAENN--TQLMLYAC 152
           E  L       +     G  D +          IVD+K G     +       Q+  YA 
Sbjct: 122 ERELFVETALDSGLRLRGIIDRIDVAPATGDVRIVDYKTGKAPRPQYAEEALFQMKFYAL 181

Query: 153 GALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKS 212
                 G +  R + + L            +  +     DL    +  + +         
Sbjct: 182 VVWRLKGVLPRRLQLVYL--------GSGDVLTYDPVQGDL----ERVERKLHALWRAIE 229

Query: 213 KRAVSLEHYGVNDDSCRFCRAKVRCP 238
           +   S E        C +C  +  CP
Sbjct: 230 EATASGEWRPRPSKLCGWCDHRAVCP 255


>gi|23752331|ref|NP_705646.1| gp20 [Burkholderia phage Bcep781]
 gi|23507198|gb|AAN38021.1| gp20 [Burkholderia phage Bcep781]
          Length = 417

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 72/386 (18%), Positives = 136/386 (35%), Gaps = 35/386 (9%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            H+ LS S   RW  CP + TL   +P  +S+ A+EGT AH +    + Q  D    + +
Sbjct: 21  EHSTLSFSGRERWRNCPASVTLSKGMPDNSSLAAAEGTCAHTVGEFYVRQHFDLPGAAPR 80

Query: 63  KLTFENDT------------RIVDTEMASSVSMVLAYVRTFSGP---FLSETEVPLEPFT 107
                  +               + ++         ++ +   P        E  +    
Sbjct: 81  GAEAPLQSVPEGLDLKGKTVEEWNDDLRRHGKAYRDFIISLIPPGVEAFVSLEQRVAAKA 140

Query: 108 TEPGATGTADILIFNSTQ--WIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRP 165
            +    GTAD LI+       I+VD+KYG  V             A  A+        + 
Sbjct: 141 IDGRLFGTADCLIWCPGARVLIVVDYKYGFMVVDVGTAEKPNAQLAAYAVAALDSCTLQA 200

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
             + L + QPR   G P ++  +SA+ +  + +  +E         +    S + + V  
Sbjct: 201 NGVMLAVFQPRRNIGEPGHKVYLSAEHVTAEQQRMREEVVRVDKAAA----SPDLFIVAG 256

Query: 226 DSCRFCRAKVRCPALSRHVLLEATK------DPSTNTTVELSKAYSSISLIKSYVKACED 279
           D CR+C+AK  CP   +  L  A                +L   YS+ S +KS  +  E 
Sbjct: 257 DHCRYCKAKPACP-RMQDALQIAFDVNAGRRSVLDMPEDDLIALYSARSGVKSLWEDVEQ 315

Query: 280 EMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKT--PKELEQ 337
            +      G +    +   G   +R +++   A   L ++   +  + +  +     + +
Sbjct: 316 RIELLAQRGHDALTIKTSPG---HRMWRNAKAAALTLLALDRTDLLQPVALSEAIAHIPE 372

Query: 338 LYKEQKVSDEFWEELQELITRGDGKP 363
              +  +        Q ++ +    P
Sbjct: 373 ALHDDLIGKSRDS--QSIVVKTPAAP 396


>gi|226360004|ref|YP_002777782.1| hypothetical protein ROP_05900 [Rhodococcus opacus B4]
 gi|226238489|dbj|BAH48837.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 301

 Score =  157 bits (397), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 71/256 (27%), Gaps = 36/256 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  S    +GT  H  L             +    
Sbjct: 30  LSPSRAGDFKQCPLLYRFRAVDRLPEAPSRAQVKGTVVHAALETLFGLPAAERVPARAVD 89

Query: 65  TFENDTRIVDTEMASSV--------SMVLAYVRTF-SGPFLSETEVPLEPFT-------- 107
                   +  E    +           L   R+  +  +  E     E  +        
Sbjct: 90  LVRPSWERLLDEAPDLIDLVPVDQRESFLDEARSLVTAYYQLEDPTRFEAESCEQRVETE 149

Query: 108 --TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
                   G  D +      +  +VD+K G      +E+    Q+  YA   L   G + 
Sbjct: 150 LADGVLLRGFVDRIDVAPTGEVRVVDYKTGRAPREMSESKALFQMKFYALVLLRTRGIVP 209

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   L L            +  +    D+LL   +      +          V+ +   
Sbjct: 210 AQLRLLYLA--------SGTVLTYAPDEDELLRFERTL----SAIWKAILAAGVTGDFRP 257

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  K  CP
Sbjct: 258 KPSRLCDWCDHKSLCP 273


>gi|256376349|ref|YP_003100009.1| RecB family exonuclease-like protein [Actinosynnema mirum DSM
           43827]
 gi|255920652|gb|ACU36163.1| RecB family exonuclease-like protein [Actinosynnema mirum DSM
           43827]
          Length = 297

 Score =  157 bits (397), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 39/263 (14%), Positives = 67/263 (25%), Gaps = 39/263 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  +     GT  H +L                + 
Sbjct: 24  LSPSRAGDFKQCPLLYRFRAVDRLPEKPTKAQVRGTVVHAVLEDLFALPAAERVPERARE 83

Query: 65  TFENDTRIVDTEMASSVSMVLAYVRT------------FSGPFLSETEVPLEPFTT---- 108
             E     V  E      +  A                  G F  E     +P +     
Sbjct: 84  LVEPAWARVRQERPEFAELFGADQDEEQADWLTSARELLEGYFGLEDPRRFDPESRELLV 143

Query: 109 ------EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYG 159
                      G  D +      +  +VD+K GA      E     Q+  YA     Q G
Sbjct: 144 EWELPSGVLLRGYVDRVDVAPTGEIRVVDYKTGAAPREHVEGKALFQMKFYALVLWRQRG 203

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +  +   + L               +     +L    +              +   + +
Sbjct: 204 VVPRQLRLMYLA--------DRQALAYSPDEGELARFERTL----EAIWEAILRAGRTGD 251

Query: 220 HYGVNDDSCRFCRAKVRCPALSR 242
                   C +C  K  CPA   
Sbjct: 252 FRPNPSRLCDYCDHKALCPAFDG 274


>gi|68536027|ref|YP_250732.1| RecB family exonuclease [Corynebacterium jeikeium K411]
 gi|260578719|ref|ZP_05846627.1| RecB family exonuclease [Corynebacterium jeikeium ATCC 43734]
 gi|68263626|emb|CAI37114.1| putative RecB family exonuclease [Corynebacterium jeikeium K411]
 gi|258603216|gb|EEW16485.1| RecB family exonuclease [Corynebacterium jeikeium ATCC 43734]
          Length = 266

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 42/257 (16%), Positives = 81/257 (31%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S ++ + +CP+        K+ + +++   +GT  H +L +  +    + T      
Sbjct: 7   LSPSRANDYKQCPLLYRFRAIDKLEEPSTVAQVKGTLVHAVLENLHQLPRGSRTYPAAVK 66

Query: 65  TFENDTRIV---DTEMASS------VSMVLAYVRTFSGPFLSETEVPLEPFT-------- 107
               +   +   D E++        V           G F  E     +           
Sbjct: 67  MIRPEWEKMLAKDPELSELVPEQSTVEFWEECRALVKGYFQMENPDGFDAHECEQFVNLT 126

Query: 108 --TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
              +    G  D +      Q  +VD+K G     +  ++   Q+M YA       G++ 
Sbjct: 127 LPNDVPVRGFIDRVDIAETGQVRVVDYKTGKKPAPRFADSARFQMMFYALVWWRMTGELP 186

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L +        S       +A +L    +E  E     L+       S     
Sbjct: 187 TQLRLMYLKV--------SDDMVLQPTATELAAFERELGELWGRILA----DVRSGNFQP 234

Query: 223 VNDDSCRFCRAKVRCPA 239
                C +C  +  CPA
Sbjct: 235 RTTKLCGWCHFQDLCPA 251


>gi|297560441|ref|YP_003679415.1| hypothetical protein Ndas_1478 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296844889|gb|ADH66909.1| conserved hypothetical protein [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 273

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 43/257 (16%), Positives = 75/257 (29%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  +L+CP+        ++P+  S  A  GT  H  L    E   ++    +   
Sbjct: 10  LSPSRASDFLQCPLLFRFRTIDRLPEAPSAAALRGTLVHACLERLYELPAESRNPRNAVG 69

Query: 65  TFENDTRIVDT----------------EMASSVSMVLAYVRTFSGPFLSE---TEVPLEP 105
             E   + +                      S   ++        P   E    E+ LE 
Sbjct: 70  LVEPQWKKLREKKPELDELFADDAERDTWLESARDLVRRYFDLENPTALEPRDREMRLEV 129

Query: 106 FTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDI 161
                    G  D +      Q  IVD+K G     + E+    Q+  YA       G +
Sbjct: 130 SLPTGLRLRGYVDRIDATPSGQIRIVDYKTGKSPAPRFEDKARFQIFFYAVMIWRDLGVV 189

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
             R + + L            +  +  + D+L     E  +      +       +    
Sbjct: 190 PTRLQLVYL-------GGDGAVRWYDPTEDELRAAESEIAD----IWARIEAAGRAGVWE 238

Query: 222 GVNDDSCRFCRAKVRCP 238
                 C +C  +  CP
Sbjct: 239 PRRSKLCGWCEHQALCP 255


>gi|227833082|ref|YP_002834789.1| putative RecB family exonuclease [Corynebacterium aurimucosum ATCC
           700975]
 gi|262182428|ref|ZP_06041849.1| putative RecB family exonuclease [Corynebacterium aurimucosum ATCC
           700975]
 gi|227454098|gb|ACP32851.1| putative RecB family exonuclease [Corynebacterium aurimucosum ATCC
           700975]
          Length = 267

 Score =  156 bits (395), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 36/257 (14%), Positives = 74/257 (28%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        K+P+  +    +GT  H +L    +   +         
Sbjct: 7   LSPSRASDYKQCPLLYRFRAIDKLPEPKTKAQVKGTLVHAVLEKMHQLPREQREYPAAVK 66

Query: 65  TFENDTRIV---DTEMASSV------SMVLAYVRTFSGPFLSETEVPLEPFT-------- 107
             + +  ++   D E+   V         +       G F  E     +           
Sbjct: 67  MIKPEWAVMLESDPELRELVPEPEELDFFVEARELIKGYFQMENPQGFDAHECEMYVDTV 126

Query: 108 --TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
                   G  D +      +  +VD+K G     +   +   Q+  YA       G I 
Sbjct: 127 LPNGVPVRGFIDRVDVAPTGEVRVVDYKTGKKPLPRYSQDAQFQMNFYALVYWRLLGTIP 186

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L ++                 ++L    ++  E      +       + +   
Sbjct: 187 TQLRLMYLKVLDSM--------FLTPGPEELEYFERDLGE----LWAKIEGDGKTGDFRP 234

Query: 223 VNDDSCRFCRAKVRCPA 239
                C +C  +  CPA
Sbjct: 235 KTSKLCGWCSFQDLCPA 251


>gi|300781190|ref|ZP_07091044.1| exodeoxyribonuclease V beta subunit [Corynebacterium genitalium
           ATCC 33030]
 gi|300532897|gb|EFK53958.1| exodeoxyribonuclease V beta subunit [Corynebacterium genitalium
           ATCC 33030]
          Length = 274

 Score =  156 bits (395), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 39/254 (15%), Positives = 75/254 (29%), Gaps = 34/254 (13%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S ++ +L+CP+   L    +IP+  +     GT  H +L        +  T      
Sbjct: 10  LSPSRANDYLQCPLKYRLRAIDRIPEPKTEAQVTGTLVHAVLEEMHAWPREERTYPAAVK 69

Query: 65  TFENDTRIV-------DTEMASSVSMVLAYVRTFSGPFLSETEVPLE----------PFT 107
             +   + +          +A   ++ +A      G F  E     +             
Sbjct: 70  RIKPAWQKMLIDDSSCADPIADEYALFVAARSLLRGYFEMENPHGFDSHAQEMYVDAVLP 129

Query: 108 TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIFGR 164
                 G  D +      +  +VD+K G     +  +    Q+  YA      +G I  +
Sbjct: 130 NGVPVRGFIDRVDIAPTGEIRVVDYKTGKKPSPRFSDEAKFQMRFYALVYWRMFGTIPHQ 189

Query: 165 PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVN 224
              + L +I               S ++L    ++  +              S       
Sbjct: 190 LRLMYLKVI--------DSLFLAPSREELEFFERDLGD----LWHKIQSDGQSGNFRPKP 237

Query: 225 DDSCRFCRAKVRCP 238
              C +C  +  CP
Sbjct: 238 SKLCNWCSFQALCP 251


>gi|311742505|ref|ZP_07716314.1| RecB family exonuclease [Aeromicrobium marinum DSM 15272]
 gi|311314133|gb|EFQ84041.1| RecB family exonuclease [Aeromicrobium marinum DSM 15272]
          Length = 298

 Score =  156 bits (395), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 44/261 (16%), Positives = 79/261 (30%), Gaps = 39/261 (14%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +  CP+        ++P+  S   + GT  H +L H  +   +A T+   
Sbjct: 16  ARLSPSRAGDFQTCPLLFRFRTIDRLPEPASPVMARGTLVHAVLEHLYDAPAEARTLEAA 75

Query: 63  KLTFENDTRIVDTEMASS------------------VSMVLAYVRTFSGPFLSE---TEV 101
                +  + +  E                       + +L        P   E    E+
Sbjct: 76  TAMLPDAWQTLQAEDERLQELFDAGRPDDQAAWLASAAELLGSYFALEDPTRLEPAAREL 135

Query: 102 PLEPFTTE-PGATGTADILIFN-STQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQ 157
            +E    +     G  D L      +  IVD+K G       +A    Q+  YA      
Sbjct: 136 RVEHVLDDAVTLGGIVDRLDVAPDGRIRIVDYKTGRSPDPRFEASALFQMKFYALVVWRS 195

Query: 158 YGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVS 217
            G +    + + L            + ++  +  DLL   ++ +          +     
Sbjct: 196 RGVLPTLLQLMYL--------GDRQVLQYTPTESDLLATERKVR----ALWDAITASTER 243

Query: 218 LEHYGVNDDSCRFCRAKVRCP 238
            E        C FC  +  CP
Sbjct: 244 REFRPRRSALCGFCAHQSLCP 264


>gi|38233839|ref|NP_939606.1| hypothetical protein DIP1251 [Corynebacterium diphtheriae NCTC
           13129]
 gi|38200100|emb|CAE49780.1| Conserved hypothetical protein [Corynebacterium diphtheriae]
          Length = 288

 Score =  156 bits (394), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 39/260 (15%), Positives = 76/260 (29%), Gaps = 36/260 (13%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S ++ + +CP+        K+P+  ++   +GT  H +L        +         
Sbjct: 13  LSPSRANDYQQCPLLYRFRAIDKLPEPKTVAQVKGTLVHAVLEEMHGWPRNERLFPAAVK 72

Query: 65  TFENDTRIV---DTEMASSV------SMVLAYVRTFSGPFLSETEVPLEPFT-------- 107
             +    ++   DTE+ S V        ++       G F  E     +           
Sbjct: 73  RLKPHWSLMCSKDTELVSLVPEEDTYDFLVECRSLLRGYFEMENPQGFDALACEMYVNAT 132

Query: 108 --TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIF 162
                   G  D +      +  +VD+K G     +       Q+  YA      YG I 
Sbjct: 133 LPNGVPIRGFIDRVDKAPTGEIRVVDYKTGKKPIPRFSQQAQFQMRFYALVYWRIYGRIP 192

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L +        +       S ++L    ++                 + +   
Sbjct: 193 DQLRLMYLKV--------ADSMFLTPSREELEYFERDI----QELWEKIVTDGETGQFRP 240

Query: 223 VNDDSCRFCRAKVRCPALSR 242
                C +C  +  CPA   
Sbjct: 241 KTSKLCGWCSFQNLCPAFDG 260


>gi|288923768|ref|ZP_06417860.1| RecB family exonuclease-like protein [Frankia sp. EUN1f]
 gi|288344884|gb|EFC79321.1| RecB family exonuclease-like protein [Frankia sp. EUN1f]
          Length = 363

 Score =  155 bits (393), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 47/263 (17%), Positives = 74/263 (28%), Gaps = 40/263 (15%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  ++ CP+        +IP+  S  A+ GT  H +L    +      T    
Sbjct: 84  ASLSPSRAADFVNCPLRYRFRVIDRIPEPPSEAATRGTVVHGVLERLFDLPPRERTQPAA 143

Query: 63  KLTFENDTRIVDTEMAS---------SVSMVLAYVRT-FSGPFLSETEVPLEPFTT---- 108
               E     +    AS         +++  L   R   +G F  E    L P       
Sbjct: 144 AGLVEPVWADLLARDASLGGLFTDPTALAAWLDSARDLLTGYFTLEDPRRLAPAARELYV 203

Query: 109 ------EPGATGTADILIFN----STQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALH 156
                      G  D L        T   ++D+K G       E     Q+  YA     
Sbjct: 204 EHVLGSGLRLRGYVDRLDEAQTPQGTALRVIDYKTGRSPGPAFEGAAMFQMRFYALVLWR 263

Query: 157 QYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAV 216
             G +        L                     +L    +    R     +  ++   
Sbjct: 264 SRGVLPRELRLYYL--------GDRTWLRAAPDEAELRATER----RIEALWAAIARAHS 311

Query: 217 SLEHYGVNDDSCRFCRAKVRCPA 239
           + +        C +C  K RCPA
Sbjct: 312 TGDWRATPGRLCDWCDHKARCPA 334


>gi|145594767|ref|YP_001159064.1| hypothetical protein Strop_2236 [Salinispora tropica CNB-440]
 gi|145304104|gb|ABP54686.1| hypothetical protein Strop_2236 [Salinispora tropica CNB-440]
          Length = 322

 Score =  155 bits (393), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 43/260 (16%), Positives = 72/260 (27%), Gaps = 38/260 (14%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +  CP+        ++P+  ++  + GT  H +L    +      T    
Sbjct: 42  ASLSPSRAADFKTCPLLYRFRSIDRLPEQPTVEQARGTLVHAVLERLFDLSPAGRTPRAA 101

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRTFS-----------GPFLSETEVPLEP------ 105
                     +  E     ++        S           G F  E    LEP      
Sbjct: 102 SDLVAPQWERLVAEQPELAALFTDDGEARSAFLRSAAGLLQGYFTVEDPRRLEPAERESL 161

Query: 106 ----FTTEPGATGTADILIFN-STQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQY 158
                  E    G  D L         +VD+K G       +A    QL  YA       
Sbjct: 162 ISAVVDEELLIRGYLDRLDVAPDGALRVVDYKTGGAPREAFEARALFQLKFYALVLWRTR 221

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G +      L L          + + ++   AD+L+   +                  + 
Sbjct: 222 GVVPRVLRLLYL--------KDAEVCDYTPDADELVRFERTV----VALWRAIEAATAAQ 269

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
           +        C +C  +  CP
Sbjct: 270 DFRPRPSRLCDWCSHQRLCP 289


>gi|269218415|ref|ZP_06162269.1| RecB family exonuclease [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269211526|gb|EEZ77866.1| RecB family exonuclease [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 304

 Score =  155 bits (392), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 47/264 (17%), Positives = 80/264 (30%), Gaps = 37/264 (14%)

Query: 1   MAHHAFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET 58
           M+ HA LS S +  + +CP+        ++P+  S+ A  GT  H++L H  +    A T
Sbjct: 6   MSRHAALSPSRAKDFKQCPLMFRFRTVDRLPEPPSLEALRGTLVHSVLEHLYDGPAAART 65

Query: 59  VSHQKLTFENDTRIVDT---------EMASSVSMVLAYVRTF-SGPFLSETEVPLEPFTT 108
               +                     E  + +   L   RT     F  E    +EP   
Sbjct: 66  EEAAQGLLLPRWNAHLESKPRDRDLFEGPAHLETWLGSARTLIGNYFRMENPTFIEPAAR 125

Query: 109 ----------EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGAL 155
                          G  D +         IVD+K G     + ++    Q+  Y     
Sbjct: 126 EQFVNARLASGLAVRGIVDRIDEAPNGALRIVDYKTGKSPGPRFQDEALFQMRFYTAAIA 185

Query: 156 HQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRA 215
              G +  R + + L               +    DD+     E         +   +R 
Sbjct: 186 LSRGKLARRTQIIYL--------KDGRTLTYDPVPDDVDAVVFEL----DSIWNAIEERL 233

Query: 216 VSLEHYGVNDDSCRFCRAKVRCPA 239
            + +        C +C  +  CPA
Sbjct: 234 DAADFEHKPSRLCDWCHFQEHCPA 257


>gi|111222283|ref|YP_713077.1| hypothetical protein FRAAL2865 [Frankia alni ACN14a]
 gi|111149815|emb|CAJ61509.1| conserved hypothetical protein [Frankia alni ACN14a]
          Length = 328

 Score =  155 bits (392), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 45/261 (17%), Positives = 75/261 (28%), Gaps = 40/261 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+        ++P+  S  AS GT  H++L +  +      T+   + 
Sbjct: 51  LSPSRAADFVNCPLRYRFRVVDRLPEPPSEAASRGTVVHSVLENLFDLPPAGRTLEAART 110

Query: 65  TFENDTRIVDTEM---------ASSVSMVLAYVRT-FSGPFLSETEVPLEPFTT------ 108
             E   + +               +++  L   R   +G F  E    L P         
Sbjct: 111 LVEPAWQALREREPAVETLFDGPDALAAWLDSARDLLAGYFALEDPARLAPSARELYVEH 170

Query: 109 ----EPGATGTADILIFN----STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQY 158
                    G  D L            +VD+K G       E +   Q+  YA       
Sbjct: 171 VLDSGLRLRGYVDRLDEATTPQGLALRVVDYKTGRSPGPAFEASAMFQMRFYALLLWRIR 230

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G I        L                     DL    +    R     +   +   S 
Sbjct: 231 GVIPRELRLYYL--------GDRTWLRAAPDEADLRATER----RIEALWAAIDRAHRSG 278

Query: 219 EHYGVNDDSCRFCRAKVRCPA 239
           +     +  C +C  +  CPA
Sbjct: 279 DWRATPNRLCSWCHHQALCPA 299


>gi|312197574|ref|YP_004017635.1| hypothetical protein FraEuI1c_3758 [Frankia sp. EuI1c]
 gi|311228910|gb|ADP81765.1| hypothetical protein FraEuI1c_3758 [Frankia sp. EuI1c]
          Length = 347

 Score =  155 bits (392), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 44/261 (16%), Positives = 71/261 (27%), Gaps = 40/261 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+        ++P+  S  A+ GT  H++L    +      T      
Sbjct: 68  LSPSRAADFVSCPLKYRFRVVDRLPEPPSPAATRGTMVHSVLERLFDLPPAGRTPEAAVE 127

Query: 65  TFENDTRIVDTEMA---------SSVSMVLAYVRT-FSGPFLSETEVPLEPFTT------ 108
                   +               ++   LA  R   +G F  E    L P         
Sbjct: 128 LLPAAWADLLAREPELAAMFPDGEALEAWLASARELLAGYFALEDPRRLAPAARELYVEH 187

Query: 109 ----EPGATGTADILIF----NSTQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQY 158
                    G  D L      +     +VD+K G       E     Q+  YA       
Sbjct: 188 VLGSGLRLRGYVDRLDEATTPDGLALRVVDYKTGRSPGPAFEGTALFQMRFYALLLWRIR 247

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G +        L                     DLL   +    R     +   +   + 
Sbjct: 248 GVVPRELRLYYL--------GDRTWLRVTPDESDLLATER----RVQALWAAIDRAHRTG 295

Query: 219 EHYGVNDDSCRFCRAKVRCPA 239
           +        C +C  + RCPA
Sbjct: 296 DWRATPSKLCGWCDHQSRCPA 316


>gi|120404435|ref|YP_954264.1| RecB family exonuclease [Mycobacterium vanbaalenii PYR-1]
 gi|119957253|gb|ABM14258.1| putative RecB family exonuclease [Mycobacterium vanbaalenii PYR-1]
          Length = 304

 Score =  155 bits (392), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 39/260 (15%), Positives = 70/260 (26%), Gaps = 41/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+ +S     GT  H  L             +    
Sbjct: 23  LSPSRASDFKQCPLLYRFRAIDRLPEPSSAAQVRGTVVHAALEQLYRLPAVERGPATAAA 82

Query: 65  TFENDTRIVDT---------------EMASSVSMVLAYVRTFSGPFL-----SETEVPLE 104
                   +                 E+      +L+       P        E  V +E
Sbjct: 83  LVAPVWERLLAEQPSLAVDIEPALHGELLEQARALLSGYYRLEDPTRFDPQSCEQRVEVE 142

Query: 105 PFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPV-----KAENNTQLMLYACGALHQY 158
                    G  D +      +  +VD+K G   P      + +   Q+  YA   L   
Sbjct: 143 L-VDGTLLRGYVDRIDVAPTGEVRVVDYKTGKAPPEARALAEFKAMFQMKFYAVALLRSR 201

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G +  R   L L            + ++    ++L    K                  + 
Sbjct: 202 GVLPSRLRLLYLA--------DGQVLDYSPDLEELERFEKTLM----AIWRAIQSAGATG 249

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
           +        C +C  +V CP
Sbjct: 250 DFRPNPSKLCDWCAHRVHCP 269


>gi|25028185|ref|NP_738239.1| hypothetical protein CE1629 [Corynebacterium efficiens YS-314]
 gi|23493469|dbj|BAC18439.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
          Length = 291

 Score =  154 bits (390), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 33/256 (12%), Positives = 69/256 (26%), Gaps = 36/256 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+   L    ++P+  ++   +GT  H +L        D         
Sbjct: 28  LSPSRAGDYQQCPLLYRLRAIDRLPEPKTVAQVKGTLVHAVLEEMHRLPRDQRDYPAMVK 87

Query: 65  TFENDTRIVDTEMASSVS---------MVLAYVRTFSGPFLSETEVPLEPFT-------- 107
             +     +  E                ++       G F  E     +           
Sbjct: 88  RLKPHWAQMCAEDPDLNELVPGDQLYDFLVECRTLLRGYFEMENPQGFDASDVEMYVDTV 147

Query: 108 --TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIF 162
                   G  D +      +  +VD+K G     +       Q++ YA      +  I 
Sbjct: 148 LPNGVPVRGFIDRVDTAPTGEIRVVDYKTGKKPKPQWSQQAQFQMLFYALVYWRLFDQIP 207

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L +                S + L    ++  +      +       + +   
Sbjct: 208 AQLRLMYLKVNDSM--------FLTPSREQLEYFERDLGD----LWARIEMDGRAGKFRT 255

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  +  CP
Sbjct: 256 KTSKLCGWCPHQSLCP 271


>gi|86741325|ref|YP_481725.1| RecB family exonuclease [Frankia sp. CcI3]
 gi|86568187|gb|ABD11996.1| putative RecB family exonuclease [Frankia sp. CcI3]
          Length = 303

 Score =  154 bits (390), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 44/261 (16%), Positives = 72/261 (27%), Gaps = 40/261 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+        ++P+  S  A+ GT  H +L    +      T+   + 
Sbjct: 26  LSPSRAADFVNCPLRYRFRVVDRLPEPPSEAATRGTVVHAVLEKLFDLPASRRTLQAARE 85

Query: 65  TFENDTRIVDTE----------------MASSVSMVLAYVRTFSGP---FLSETEVPLEP 105
             E     V                      S   +LA       P        E+ +E 
Sbjct: 86  LVEPAWDTVRAREPAVEALFGGRDELAAWLESARELLAGYFALEDPSRLAPVARELYVEH 145

Query: 106 FTT-EPGATGTADILIFN----STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQY 158
                    G  D L            +VD+K G       E++   Q+  YA       
Sbjct: 146 VLDSGLRLRGYLDRLDEATTAQGPALRVVDYKTGRSPGPAFESSAMFQMKFYALLLWRIR 205

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G I        L                     DL    +    R     +   +   + 
Sbjct: 206 GVIPRELRLYYL--------GDRTWLRATPDEADLRAAER----RIEALWAAIDRAHRTG 253

Query: 219 EHYGVNDDSCRFCRAKVRCPA 239
           +     +  C +C  + RCPA
Sbjct: 254 DWRATPNRLCSWCDHQARCPA 274


>gi|330468532|ref|YP_004406275.1| RecB family exonuclease [Verrucosispora maris AB-18-032]
 gi|328811503|gb|AEB45675.1| RecB family exonuclease [Verrucosispora maris AB-18-032]
          Length = 320

 Score =  154 bits (390), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 42/261 (16%), Positives = 74/261 (28%), Gaps = 39/261 (14%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +  CP+        ++P+  ++  + GT  H +L    +      T    
Sbjct: 39  ASLSPSRAADFKTCPLLYRFRSIDRLPERPTVEQARGTLVHAVLERLFDLPAAGRTPQAA 98

Query: 63  KLTFENDTRIV------------DTEMASSVSMVLAYVRTFSGPFLSETEVPLEP----- 105
                     +            D     +V  + +      G F  E    LEP     
Sbjct: 99  GDLVAPQWDRLVTEQPELAGLFTDDGTVDAVEFLRSAATLLEGYFSVEDPRRLEPAERES 158

Query: 106 -----FTTEPGATGTADILIFN-STQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQ 157
                   E    G  D L         +VD+K G       +A    QL  YA      
Sbjct: 159 LISAVIDEELLIRGYLDRLDVAPDGALRVVDYKTGGAPREAFEARALFQLKFYALVLWRT 218

Query: 158 YGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVS 217
            G +      L L          + + ++   A++L+   +              +   +
Sbjct: 219 RGVVPRVLRLLYLR--------DAEVCDYSPDAEELVRFERTV----VALWRAIEQATAA 266

Query: 218 LEHYGVNDDSCRFCRAKVRCP 238
            +        C +C  +  CP
Sbjct: 267 QDFRPRPSRLCDWCSHQALCP 287


>gi|111017871|ref|YP_700843.1| hypothetical protein RHA1_ro00852 [Rhodococcus jostii RHA1]
 gi|110817401|gb|ABG92685.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 301

 Score =  154 bits (390), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 41/256 (16%), Positives = 70/256 (27%), Gaps = 36/256 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  S    +GT  H  L                  
Sbjct: 30  LSPSRAGDFKQCPLLYRFRAVDRLPEAPSRAQVKGTVVHAALETLFGLPAAERVPQKAVD 89

Query: 65  TFENDTRIVDTEMASSVSMVLAYVR---------------TFSGPFLSET---EVPLEPF 106
                   +  E    + +V    R                   P   E    E  +E  
Sbjct: 90  LILPSWERILAEAPDLIDLVPDEERDAFLDEARSLVTTYYELEDPTRFEAESCEQRVETE 149

Query: 107 T-TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
                   G  D +      +  +VD+K G      +E+    Q+  YA   L   G + 
Sbjct: 150 LADGVLLRGFVDRIDVAPTGEVRVVDYKTGRAPREMSESKALFQMKFYALVLLRTRGIVP 209

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   L L            +  +    D+LL   +      +          V+ +   
Sbjct: 210 AQLRLLYLA--------SGTVLTYAPDEDELLRFERTL----SAIWKAILAAGVTGDFRP 257

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  K  CP
Sbjct: 258 KPSRLCDWCDHKSMCP 273


>gi|183983094|ref|YP_001851385.1| hypothetical protein MMAR_3095 [Mycobacterium marinum M]
 gi|183176420|gb|ACC41530.1| conserved hypothetical protein [Mycobacterium marinum M]
          Length = 293

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 39/261 (14%), Positives = 71/261 (27%), Gaps = 41/261 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  S     G+  H  L                + 
Sbjct: 17  LSPSRAADFKQCPLLYRFRAIDRLPEKPSTAQLRGSVVHAALEQLYALPAVQRGPDTARS 76

Query: 65  TFENDTRIV---------------DTEMASSVSMVLAYVRTFSGPFL-----SETEVPLE 104
             E+    V                 ++      +L+       P        E  V +E
Sbjct: 77  LVESAWEQVIAGELDLAGELAADQQAQLLEDARALLSGYYRLEDPRRFDPQSCEQRVEVE 136

Query: 105 PFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVP-----VKAENNTQLMLYACGALHQY 158
                    G  D +   +  +  +VD+K G   P      + +   Q+  Y        
Sbjct: 137 L-ADGTLLRGYIDRIDVAATGELRVVDYKTGKAPPAARALAEFKAMFQMKFYGVALFRSR 195

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G +  R   + L            + ++    D+LL   K                  S 
Sbjct: 196 GVLPSRLRLIYLA--------DGQVLDYSPDRDELLRFEKTLM----AIWRAIQSAGQSG 243

Query: 219 EHYGVNDDSCRFCRAKVRCPA 239
           +        C +C  +  CPA
Sbjct: 244 DFRPNASRLCNWCPHQQHCPA 264


>gi|227503632|ref|ZP_03933681.1| RecB family exonuclease [Corynebacterium accolens ATCC 49725]
 gi|306836102|ref|ZP_07469089.1| exodeoxyribonuclease V beta subunit [Corynebacterium accolens ATCC
           49726]
 gi|227075668|gb|EEI13631.1| RecB family exonuclease [Corynebacterium accolens ATCC 49725]
 gi|304568020|gb|EFM43598.1| exodeoxyribonuclease V beta subunit [Corynebacterium accolens ATCC
           49726]
          Length = 273

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 36/256 (14%), Positives = 74/256 (28%), Gaps = 36/256 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        KIP+  +I   +GT  H +L    +   +  T      
Sbjct: 12  LSPSRASDYQQCPLLYRFRAIDKIPEPKTIAQVKGTLVHAVLEETHKLPREERTYPAAVK 71

Query: 65  TFENDTRIVDTEMASSV---------SMVLAYVRTFSGPFLSETEVPLE----------P 105
             +     +  + A  +            +A      G F  E     +           
Sbjct: 72  MIKPSWAAMTEKDAELLELVPEEETYDFFVAARELLKGYFQMENPQGFDCQETEMYVNTV 131

Query: 106 FTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
                   G  D +      +  +VD+K G     +  ++   Q+  YA       G I 
Sbjct: 132 LPNGVPVRGFIDRVDRAPTGEVRVVDYKTGKKPAPRFSHSAQFQMRFYALVYWRLLGTIP 191

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L ++               + ++L    ++         +       + +   
Sbjct: 192 HQLRLMYLKVLDSM--------FLAPTQEELEYFERDL----GQLWAKIEADGRAGDFRP 239

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  +  CP
Sbjct: 240 KRSKLCDWCAHQAICP 255


>gi|296269817|ref|YP_003652449.1| RecB family exonuclease-like protein [Thermobispora bispora DSM
           43833]
 gi|296092604|gb|ADG88556.1| RecB family exonuclease-like protein [Thermobispora bispora DSM
           43833]
          Length = 286

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 45/257 (17%), Positives = 79/257 (30%), Gaps = 37/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+        ++P+  S  A  GT  H +L    +    A TV+  + 
Sbjct: 13  LSPSRAGDFMTCPLLYRFRVIDQLPERPSPAAVRGTLVHAVLERLYDLPAAARTVAAARD 72

Query: 65  TFENDTRIVDTEMASS----------------VSMVLAYVRTFSGPFLS---ETEVPLEP 105
             E + R +  E                       ++    T   P      E E+ +E 
Sbjct: 73  LLEPEWRRLLAEEPEYAGLFATDEERDAWLARAREMIERYFTLEDPRRLEPAEREMYIEA 132

Query: 106 FTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDI 161
                    G  D L      +  IVD+K G+      +A+   Q+  Y        G +
Sbjct: 133 VLDSGLLLRGYIDRLDVAPTGEVRIVDYKTGSAPGPEFEAKALFQMKFYGLALWRARGVV 192

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
               + + L            +  +V    DL    ++         +   +   S E  
Sbjct: 193 PRMLQLMYL--------GSGEVVRYVPDEADLRATERKV----EALWAAIDRALRSREWR 240

Query: 222 GVNDDSCRFCRAKVRCP 238
                 C +C  +  CP
Sbjct: 241 ARRSRLCDWCDHQALCP 257


>gi|260205407|ref|ZP_05772898.1| hypothetical protein MtubK8_13997 [Mycobacterium tuberculosis K85]
 gi|289574798|ref|ZP_06455025.1| conserved hypothetical protein [Mycobacterium tuberculosis K85]
 gi|289539229|gb|EFD43807.1| conserved hypothetical protein [Mycobacterium tuberculosis K85]
          Length = 278

 Score =  154 bits (389), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 40/261 (15%), Positives = 72/261 (27%), Gaps = 41/261 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+ TS     G+  H  L           +    + 
Sbjct: 14  LSPSRATDFKQCPLLYRFRAIDRLPEATSAAQLRGSVVHAALEQLYGLPAGLRSPDTARS 73

Query: 65  TFENDTRIVDTEMASSV--------SMVLAYVRTFS------------GPFLSETEVPLE 104
             +     +                + +L   R                P   E  V +E
Sbjct: 74  LVQRAWDQMVAAEPELAGELDPGQPTQLLEDARALVSGYYRLEDPTRFDPQCCEQRVEVE 133

Query: 105 PFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVP-----VKAENNTQLMLYACGALHQY 158
                    G  D +   +  +  +VD+K G   P      + +   Q+  YA       
Sbjct: 134 L-ADGTLLRGYIDRIDVAATGELRVVDYKTGKAPPAARALTEFKAMFQMKFYAVALFRSR 192

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G    R   + L            + ++    D+LL   K                  + 
Sbjct: 193 GVPPTRLRLIYLA--------DGQLLDYSPDRDELLRFEKTLM----AIWRAIQSAGETG 240

Query: 219 EHYGVNDDSCRFCRAKVRCPA 239
           +        C +C  + RCPA
Sbjct: 241 DFRPNPSRLCDWCPHQQRCPA 261


>gi|259507243|ref|ZP_05750143.1| RecB family exonuclease [Corynebacterium efficiens YS-314]
 gi|259165186|gb|EEW49740.1| RecB family exonuclease [Corynebacterium efficiens YS-314]
          Length = 287

 Score =  154 bits (389), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 33/256 (12%), Positives = 69/256 (26%), Gaps = 36/256 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+   L    ++P+  ++   +GT  H +L        D         
Sbjct: 24  LSPSRAGDYQQCPLLYRLRAIDRLPEPKTVAQVKGTLVHAVLEEMHRLPRDQRDYPAMVK 83

Query: 65  TFENDTRIVDTEMASSVS---------MVLAYVRTFSGPFLSETEVPLEPFT-------- 107
             +     +  E                ++       G F  E     +           
Sbjct: 84  RLKPHWAQMCAEDPDLNELVPGDQLYDFLVECRTLLRGYFEMENPQGFDASDVEMYVDTV 143

Query: 108 --TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIF 162
                   G  D +      +  +VD+K G     +       Q++ YA      +  I 
Sbjct: 144 LPNGVPVRGFIDRVDTAPTGEIRVVDYKTGKKPKPQWSQQAQFQMLFYALVYWRLFDQIP 203

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L +                S + L    ++  +      +       + +   
Sbjct: 204 AQLRLMYLKVNDSM--------FLTPSREQLEYFERDLGD----LWARIEMDGRAGKFRT 251

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  +  CP
Sbjct: 252 KTSKLCGWCPHQSLCP 267


>gi|159146274|gb|ABW90600.1| conserved hypothetical protein [Bacteriophage APSE-2]
          Length = 271

 Score =  154 bits (388), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 68/259 (26%), Positives = 115/259 (44%), Gaps = 31/259 (11%)

Query: 53  GVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETE--VPLEPFTTEP 110
           G DA+         + ++  VD EM   V   +  V   +   + + E  V         
Sbjct: 17  GFDAKEYIGTYPLLKANSPQVDEEMIEHVQTYIDTVWQLADEKILQVEGRVDFSAVIGVE 76

Query: 111 GATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTL 170
            + GTAD +I +  +  I D KYG GV V A+NN QLMLYA GALHQ+  ++   + + L
Sbjct: 77  NSFGTADAIIVSDDELQIHDLKYGKGVKVNAQNNEQLMLYALGALHQFDLVYDF-KTVRL 135

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLK------SKRAVSLEHYGVN 224
            I QPR+     ++EW +S D+L +  ++ K     A+ +          A+    +   
Sbjct: 136 FIHQPRLN---HLSEWALSVDELKDFGEQAKSVAQKAMKMATLAQRSGLDALPDNAFSPG 192

Query: 225 DDSCRFCRAK-VRCPALSRHV------------------LLEATKDPSTNTTVELSKAYS 265
              C+FC+AK   C A ++ V                  + +A K  +  T  +++K Y 
Sbjct: 193 IKQCQFCKAKGGLCFAQAQFVHNEVIGDFVDLTQPLAPQINDAPKRITLLTPEQMAKLYP 252

Query: 266 SISLIKSYVKACEDEMFKR 284
            + LI+S+ K+  + + + 
Sbjct: 253 HVDLIESFCKSLRNRVTEA 271


>gi|302527193|ref|ZP_07279535.1| RecB family exonuclease [Streptomyces sp. AA4]
 gi|302436088|gb|EFL07904.1| RecB family exonuclease [Streptomyces sp. AA4]
          Length = 296

 Score =  154 bits (388), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 37/259 (14%), Positives = 69/259 (26%), Gaps = 39/259 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  +     GT  H +L                K 
Sbjct: 23  LSPSRASDFKQCPLLYRFRAVDRLPEVPTRAQLRGTLVHAVLERLFALPAAERVAPRAKE 82

Query: 65  TFENDTRIVDTEMASS------------------VSMVLAYVRTFSGPFLSE---TEVPL 103
                   +  E                         +L        P   E    E+ +
Sbjct: 83  LLAPTWTELSAESPEWTELFADGEPGETDKWLASAEKLLDSYFELEDPRRLEPEACELHV 142

Query: 104 EPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYG 159
           E          G  D +      +  +VD+K GA      +A+   Q+  YA       G
Sbjct: 143 EIELGSGVLLRGYIDRVDVAPTGEIRVVDYKTGAAPREIGEAKALFQMKFYALVLWRLRG 202

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +  + + + LT              +     +L+   +              K   + +
Sbjct: 203 VVPRQLKLMYLT--------DGQSLAYTPDEAELVRFERTL----EAIWQAILKAGKTGD 250

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  +  CP
Sbjct: 251 FRPNKGKLCSWCDHQAHCP 269


>gi|108800103|ref|YP_640300.1| RecB family exonuclease [Mycobacterium sp. MCS]
 gi|119869231|ref|YP_939183.1| RecB family exonuclease [Mycobacterium sp. KMS]
 gi|126435728|ref|YP_001071419.1| RecB family exonuclease [Mycobacterium sp. JLS]
 gi|108770522|gb|ABG09244.1| putative RecB family exonuclease [Mycobacterium sp. MCS]
 gi|119695320|gb|ABL92393.1| putative RecB family exonuclease [Mycobacterium sp. KMS]
 gi|126235528|gb|ABN98928.1| putative RecB family exonuclease [Mycobacterium sp. JLS]
          Length = 277

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 39/259 (15%), Positives = 71/259 (27%), Gaps = 39/259 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  S     G+  H  L                  
Sbjct: 13  LSPSRAADFKQCPLLYRFRAIDRLPEPQSTAQLRGSVVHAALEQLYALPAADRGPDTALT 72

Query: 65  TFENDTRIVDTEMASSVSMVLAYVRT---------FSGPFLSETEVPLEP---------- 105
                   V  E   +   +   VR           +G +  E     +P          
Sbjct: 73  LVAPAWDRVIAERPEAAEDIEPAVREALLGEARALLAGYYRLEDPTRFDPQCCEQHVEVE 132

Query: 106 FTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPV-----KAENNTQLMLYACGALHQYG 159
                   G  D +      +  +VD+K G   P      +A+   Q+  YA   L   G
Sbjct: 133 LDDGTLLRGFVDRIDVAPTGELRVVDYKTGKAPPEARALAEAKALFQMKFYAVALLRSRG 192

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +  R   L L          S + ++    ++L+   +                  + +
Sbjct: 193 VLPTRLRLLYLA--------DSQVLDYSPDLEELVRFERTLT----AIWRAILAAGATGD 240

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  +  CP
Sbjct: 241 FRPKPSKLCDWCSHRALCP 259


>gi|254819651|ref|ZP_05224652.1| RecB family protein exonuclease [Mycobacterium intracellulare ATCC
           13950]
          Length = 298

 Score =  153 bits (387), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 38/259 (14%), Positives = 70/259 (27%), Gaps = 39/259 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  S     G+  H  L    E             
Sbjct: 23  LSPSRAADFKQCPLLYRFRAIDRLPEAPSPAQLRGSLVHAALQQLYELPAAQRGPDTALS 82

Query: 65  TFENDTRIVDTEMASSVSMVLAYVRT---------FSGPFLSETEVPLEP---------- 105
             +     V        + +    R+          +G +  E     +P          
Sbjct: 83  LVQPAWEQVMAATPEMTAGLDPAQRSQLLAEAQALLAGYYRLEDPTRFDPQCCEERVEVE 142

Query: 106 FTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPV-----KAENNTQLMLYACGALHQYG 159
                   G  D +   +  +  +VD+K G   P      + +   Q+  YA   L   G
Sbjct: 143 LADGTLLRGFIDRIDVAATGELRVVDYKTGKAPPEARALAEFKAMFQMKFYAVALLRSRG 202

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
               R   + L            + ++    D+LL   K                  + +
Sbjct: 203 VPPTRLRLIYLA--------DGQVLDYSPDHDELLRFEKTLI----AIWRAIQSAGQTGD 250

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  +  CP
Sbjct: 251 FRPTQSRLCDWCPHQQHCP 269


>gi|319440412|ref|ZP_07989568.1| RecB family exonuclease [Corynebacterium variabile DSM 44702]
          Length = 278

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 37/257 (14%), Positives = 71/257 (27%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S    + +CP+        ++P+ +++   +GT  H +L        +  T      
Sbjct: 18  LSPSRVGDYNQCPLLYRFRAIDRLPEPSTVAQVKGTLVHAVLEELHGLPREERTYPTAVK 77

Query: 65  TFENDTRIVDTEMA---------SSVSMVLAYVRTFSGPFLSETEVPLEPFT-------- 107
             +     +  +             +  ++A      G FL E     +  +        
Sbjct: 78  MLKPHWAAMTAKDPQLNELVPESDFMDFLIASRDLVKGYFLMENPEAFDADSMEKFVDLT 137

Query: 108 --TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
                   G  D +      +  +VD+K G     +       Q+  YA      Y  I 
Sbjct: 138 LPNGVPVRGFIDRVDVAPTGEVRVVDYKTGKKPIPRFAGQAMFQMRFYALVWWRLYDHIP 197

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L +                +  +L    K+               A S     
Sbjct: 198 EQLRLMYLKV--------RDDMVLSPTPAELNYVEKDL----GRIWDAVGTDARSGNFAP 245

Query: 223 VNDDSCRFCRAKVRCPA 239
                C +C  +  CPA
Sbjct: 246 KTSKLCGWCSFQKICPA 262


>gi|15609256|ref|NP_216635.1| hypothetical protein Rv2119 [Mycobacterium tuberculosis H37Rv]
 gi|15841611|ref|NP_336648.1| hypothetical protein MT2179 [Mycobacterium tuberculosis CDC1551]
 gi|31793299|ref|NP_855792.1| hypothetical protein Mb2143 [Mycobacterium bovis AF2122/97]
 gi|121638001|ref|YP_978225.1| hypothetical protein BCG_2136 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148661934|ref|YP_001283457.1| hypothetical protein MRA_2134 [Mycobacterium tuberculosis H37Ra]
 gi|148823330|ref|YP_001288084.1| hypothetical protein TBFG_12151 [Mycobacterium tuberculosis F11]
 gi|167967471|ref|ZP_02549748.1| hypothetical protein MtubH3_05317 [Mycobacterium tuberculosis
           H37Ra]
 gi|215403503|ref|ZP_03415684.1| hypothetical protein Mtub0_07428 [Mycobacterium tuberculosis
           02_1987]
 gi|215411823|ref|ZP_03420615.1| hypothetical protein Mtub9_10924 [Mycobacterium tuberculosis
           94_M4241A]
 gi|215431043|ref|ZP_03428962.1| hypothetical protein MtubE_10285 [Mycobacterium tuberculosis
           EAS054]
 gi|215446344|ref|ZP_03433096.1| hypothetical protein MtubT_10528 [Mycobacterium tuberculosis T85]
 gi|218753841|ref|ZP_03532637.1| hypothetical protein MtubG1_10544 [Mycobacterium tuberculosis GM
           1503]
 gi|219558092|ref|ZP_03537168.1| hypothetical protein MtubT1_12642 [Mycobacterium tuberculosis T17]
 gi|224990495|ref|YP_002645182.1| hypothetical protein JTY_2130 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253798819|ref|YP_003031820.1| hypothetical protein TBMG_01861 [Mycobacterium tuberculosis KZN
           1435]
 gi|254232279|ref|ZP_04925606.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|254364926|ref|ZP_04980972.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254551151|ref|ZP_05141598.1| hypothetical protein Mtube_11916 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260187107|ref|ZP_05764581.1| hypothetical protein MtubCP_13883 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260201228|ref|ZP_05768719.1| hypothetical protein MtubT4_14214 [Mycobacterium tuberculosis T46]
 gi|289443622|ref|ZP_06433366.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289447739|ref|ZP_06437483.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A]
 gi|289554095|ref|ZP_06443305.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289570232|ref|ZP_06450459.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289745392|ref|ZP_06504770.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289754227|ref|ZP_06513605.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gi|289758237|ref|ZP_06517615.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|289762281|ref|ZP_06521659.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|294993528|ref|ZP_06799219.1| RecB family exonuclease [Mycobacterium tuberculosis 210]
 gi|297634704|ref|ZP_06952484.1| RecB family exonuclease [Mycobacterium tuberculosis KZN 4207]
 gi|297731692|ref|ZP_06960810.1| RecB family exonuclease [Mycobacterium tuberculosis KZN R506]
 gi|298525615|ref|ZP_07013024.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306776366|ref|ZP_07414703.1| hypothetical protein TMAG_00304 [Mycobacterium tuberculosis
           SUMu001]
 gi|306780145|ref|ZP_07418482.1| hypothetical protein TMBG_00665 [Mycobacterium tuberculosis
           SUMu002]
 gi|306784889|ref|ZP_07423211.1| hypothetical protein TMCG_00212 [Mycobacterium tuberculosis
           SUMu003]
 gi|306789256|ref|ZP_07427578.1| hypothetical protein TMDG_00596 [Mycobacterium tuberculosis
           SUMu004]
 gi|306793585|ref|ZP_07431887.1| hypothetical protein TMEG_02484 [Mycobacterium tuberculosis
           SUMu005]
 gi|306797974|ref|ZP_07436276.1| hypothetical protein TMFG_01078 [Mycobacterium tuberculosis
           SUMu006]
 gi|306803854|ref|ZP_07440522.1| hypothetical protein TMHG_01306 [Mycobacterium tuberculosis
           SUMu008]
 gi|306808426|ref|ZP_07445094.1| hypothetical protein TMGG_00674 [Mycobacterium tuberculosis
           SUMu007]
 gi|306968249|ref|ZP_07480910.1| hypothetical protein TMIG_00784 [Mycobacterium tuberculosis
           SUMu009]
 gi|306972477|ref|ZP_07485138.1| hypothetical protein TMJG_00379 [Mycobacterium tuberculosis
           SUMu010]
 gi|307080187|ref|ZP_07489357.1| hypothetical protein TMKG_00379 [Mycobacterium tuberculosis
           SUMu011]
 gi|307084767|ref|ZP_07493880.1| hypothetical protein TMLG_03740 [Mycobacterium tuberculosis
           SUMu012]
 gi|313659027|ref|ZP_07815907.1| RecB family exonuclease [Mycobacterium tuberculosis KZN V2475]
 gi|2253059|emb|CAB10709.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv]
 gi|13881861|gb|AAK46462.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551]
 gi|31618891|emb|CAD96996.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97]
 gi|121493649|emb|CAL72124.1| Conserved hypothetical protein [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|124601338|gb|EAY60348.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|134150440|gb|EBA42485.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148506086|gb|ABQ73895.1| hypothetical protein MRA_2134 [Mycobacterium tuberculosis H37Ra]
 gi|148721857|gb|ABR06482.1| conserved hypothetical protein [Mycobacterium tuberculosis F11]
 gi|224773608|dbj|BAH26414.1| hypothetical protein JTY_2130 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253320322|gb|ACT24925.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           1435]
 gi|289416541|gb|EFD13781.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289420697|gb|EFD17898.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A]
 gi|289438727|gb|EFD21220.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289543986|gb|EFD47634.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289685920|gb|EFD53408.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289694814|gb|EFD62243.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gi|289709787|gb|EFD73803.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|289713801|gb|EFD77813.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|298495409|gb|EFI30703.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308215212|gb|EFO74611.1| hypothetical protein TMAG_00304 [Mycobacterium tuberculosis
           SUMu001]
 gi|308326972|gb|EFP15823.1| hypothetical protein TMBG_00665 [Mycobacterium tuberculosis
           SUMu002]
 gi|308330406|gb|EFP19257.1| hypothetical protein TMCG_00212 [Mycobacterium tuberculosis
           SUMu003]
 gi|308334241|gb|EFP23092.1| hypothetical protein TMDG_00596 [Mycobacterium tuberculosis
           SUMu004]
 gi|308338042|gb|EFP26893.1| hypothetical protein TMEG_02484 [Mycobacterium tuberculosis
           SUMu005]
 gi|308341727|gb|EFP30578.1| hypothetical protein TMFG_01078 [Mycobacterium tuberculosis
           SUMu006]
 gi|308345217|gb|EFP34068.1| hypothetical protein TMGG_00674 [Mycobacterium tuberculosis
           SUMu007]
 gi|308349520|gb|EFP38371.1| hypothetical protein TMHG_01306 [Mycobacterium tuberculosis
           SUMu008]
 gi|308354150|gb|EFP43001.1| hypothetical protein TMIG_00784 [Mycobacterium tuberculosis
           SUMu009]
 gi|308358088|gb|EFP46939.1| hypothetical protein TMJG_00379 [Mycobacterium tuberculosis
           SUMu010]
 gi|308362022|gb|EFP50873.1| hypothetical protein TMKG_00379 [Mycobacterium tuberculosis
           SUMu011]
 gi|308365670|gb|EFP54521.1| hypothetical protein TMLG_03740 [Mycobacterium tuberculosis
           SUMu012]
 gi|323719332|gb|EGB28473.1| hypothetical protein TMMG_01396 [Mycobacterium tuberculosis
           CDC1551A]
 gi|326903734|gb|EGE50667.1| hypothetical protein TBPG_01616 [Mycobacterium tuberculosis W-148]
 gi|328458580|gb|AEB04003.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           4207]
          Length = 278

 Score =  153 bits (386), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 40/261 (15%), Positives = 72/261 (27%), Gaps = 41/261 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+ TS     G+  H  L           +    + 
Sbjct: 14  LSPSRATDFKQCPLLYRFRAIDRLPEATSAAQLRGSVVHAALEQLYGLPAGLRSPDTARS 73

Query: 65  TFENDTRIVDTEMASSV--------SMVLAYVRTFS------------GPFLSETEVPLE 104
             +     +                + +L   R                P   E  V +E
Sbjct: 74  LVQRAWDQMVAAEPELAGELDPGQPTQLLEDARALVSGYYRLEDPTRFDPQCCEQRVEVE 133

Query: 105 PFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVP-----VKAENNTQLMLYACGALHQY 158
                    G  D +   +  +  +VD+K G   P      + +   Q+  YA       
Sbjct: 134 L-ADGTLLRGYIDRIDVAATGELRVVDYKTGKAPPAARALAEFKAMFQMKFYAVALFRSR 192

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G    R   + L            + ++    D+LL   K                  + 
Sbjct: 193 GVPPTRLRLIYLA--------DGQLLDYSPDRDELLRFEKTLM----AIWRAIQSAGETG 240

Query: 219 EHYGVNDDSCRFCRAKVRCPA 239
           +        C +C  + RCPA
Sbjct: 241 DFRPNPSRLCDWCPHQQRCPA 261


>gi|227542073|ref|ZP_03972122.1| RecB family exonuclease [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227182124|gb|EEI63096.1| RecB family exonuclease [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 280

 Score =  153 bits (386), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 47/257 (18%), Positives = 77/257 (29%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTL--ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S   ++ KCP++       KIP  T  Y  +GT  H +L H +    +  T      
Sbjct: 21  LSPSRVSQYKKCPLSFRFGAIDKIPTETKDYQLKGTLVHAVLEHLMGLPPEERTYPTAVK 80

Query: 65  TFENDTRIVDTEMA---------SSVSMVLAYVRTFSGPFLSETEVPLEPF--------- 106
                   +  E             +   +       G F+ E    LE           
Sbjct: 81  LIVPTWEKMKAEDPGNAEVVPEHKEMDFFVQARGLIKGYFMMENPQGLETDRMEEFVSTT 140

Query: 107 -TTEPGATGTADILIF-NSTQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
              +    G  D +         IVD+K G     +  ++   Q+  YA      YG I 
Sbjct: 141 LRDDVPLRGFIDRVDVNADGMVRIVDYKTGKKPSPRFADDAMAQMKFYALVWWCLYGVIP 200

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L +           ++  +S D+     +EF             +    E   
Sbjct: 201 AQLRLMYLAVG----------DDLTLSPDE--ATLEEFAGELVQTWDEIKHKGARGEFEP 248

Query: 223 VNDDSCRFCRAKVRCPA 239
                C +C  +  CPA
Sbjct: 249 RTSKLCGWCDYQSICPA 265


>gi|317500270|ref|ZP_07958497.1| phage-associated protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331087497|ref|ZP_08336433.1| hypothetical protein HMPREF1025_00016 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|316898313|gb|EFV20357.1| phage-associated protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330410477|gb|EGG89908.1| hypothetical protein HMPREF1025_00016 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 160

 Score =  152 bits (385), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 46/143 (32%), Positives = 64/143 (44%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            HA LSAS SHRWL C  +  LE +   TTS  A EGT AH L  H L++ +   +    
Sbjct: 18  GHAVLSASGSHRWLNCTPSARLELEFENTTSEAAREGTAAHALCEHKLKKFLKKRSKRPV 77

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
                ++        A  V       +      +   E  L+     P   GT D +I +
Sbjct: 78  SDYNSDEMEECTDAYAEFVMEQYEEAKKSCKDPVILIEQKLDFSCYVPEGFGTGDCIIIS 137

Query: 123 STQWIIVDFKYGAGVPVKAENNT 145
             +  I+DFKYG G+ V+AE+N 
Sbjct: 138 DDKLHIIDFKYGQGIFVEAEHNP 160


>gi|227488933|ref|ZP_03919249.1| RecB family exonuclease [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227091117|gb|EEI26429.1| RecB family exonuclease [Corynebacterium glucuronolyticum ATCC
           51867]
          Length = 280

 Score =  152 bits (385), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 47/257 (18%), Positives = 77/257 (29%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTL--ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S   ++ KCP++       KIP  T  Y  +GT  H +L H +    +  T      
Sbjct: 21  LSPSRVSQYKKCPLSFRFGAIDKIPTETKDYQLKGTLVHAVLEHLMGLPPEERTYPTAVK 80

Query: 65  TFENDTRIVDTEMA---------SSVSMVLAYVRTFSGPFLSETEVPLEPF--------- 106
                   +  E             +   +       G F+ E    LE           
Sbjct: 81  LIVPTWEKMKAEDPGNAEVVPEHKEMDFFVQARGLIKGYFMMENPQGLETDRMEEFVSTT 140

Query: 107 -TTEPGATGTADILIF-NSTQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
              +    G  D +         IVD+K G     +  ++   Q+  YA      YG I 
Sbjct: 141 LRDDVPLRGFIDRVDVNADGMVRIVDYKTGKKPSPRFADDAMAQMKFYALVWWCLYGVIP 200

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L +           ++  +S D+     +EF             +    E   
Sbjct: 201 AQLRLMYLAVG----------DDLTLSPDE--ATLEEFAAELVQTWDEIKHKGARGEFEP 248

Query: 223 VNDDSCRFCRAKVRCPA 239
                C +C  +  CPA
Sbjct: 249 RTSKLCGWCDYQSICPA 265


>gi|238064528|ref|ZP_04609237.1| hypothetical protein MCAG_05494 [Micromonospora sp. ATCC 39149]
 gi|237886339|gb|EEP75167.1| hypothetical protein MCAG_05494 [Micromonospora sp. ATCC 39149]
          Length = 305

 Score =  152 bits (385), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 43/261 (16%), Positives = 72/261 (27%), Gaps = 39/261 (14%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +  CP+        ++P+  S+    GT  H +L    +      T    
Sbjct: 24  ASLSPSRAADFKTCPLLYRFRSIDRLPERPSVEQVRGTLVHAVLERLFDLPAAGRTPEAA 83

Query: 63  KLTFENDTRIVDTEMASSVSMV--------LAYVRT----FSGPFLSETEVPLEP----- 105
                     +  E     ++           ++R+      G F  E    LEP     
Sbjct: 84  GDLVAPQWDRLVAEQPELAALFDAGDPDGTAEFLRSAAGLLEGYFAVEDPRRLEPAEREA 143

Query: 106 -----FTTEPGATGTADILIFN-STQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQ 157
                   E    G  D L         +VD+K G       +A    QL  YA      
Sbjct: 144 LISAVVDDELLIRGYLDRLDVAPDGALRVVDYKTGGAPREAFEARALFQLKFYALVLWRT 203

Query: 158 YGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVS 217
            G +      L L          + + ++   A++L    +                   
Sbjct: 204 RGVVPRVLRLLYL--------KDAEVCDYTPDAEELARFERTV----VALWQAIEAATAR 251

Query: 218 LEHYGVNDDSCRFCRAKVRCP 238
            +        C +C  +  CP
Sbjct: 252 QDFRPRPSRLCDWCNHRALCP 272


>gi|254781191|ref|YP_003065604.1| hypothetical protein CLIBASIA_05490 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040868|gb|ACT57664.1| hypothetical protein CLIBASIA_05490 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|317120753|gb|ADV02574.1| hypothetical protein UF506_005 [Candidatus Liberibacter asiaticus]
          Length = 165

 Score =  152 bits (384), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 67/164 (40%), Positives = 107/164 (65%), Gaps = 2/164 (1%)

Query: 224 NDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFK 283
           ++++CRFCRAK RC AL+   L   ++     +  +LS+  + + LI++++K  ++E   
Sbjct: 2   DENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALN 61

Query: 284 RLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQK 343
            L++G+++  Y+L EGRKG+R++ + N+ ++LL   LG+EA+ R L +P E EQL K +K
Sbjct: 62  VLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRKK 121

Query: 344 VSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387
           VS+  WE+LQ+ ITR DGK VI P D+P N       +SEF VL
Sbjct: 122 VSETTWEQLQKFITRKDGKQVIVPCDLPVNHLKAN--ISEFSVL 163


>gi|237785507|ref|YP_002906212.1| putative RecB family exonuclease [Corynebacterium kroppenstedtii
           DSM 44385]
 gi|237758419|gb|ACR17669.1| putative RecB family exonuclease [Corynebacterium kroppenstedtii
           DSM 44385]
          Length = 270

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 38/272 (13%), Positives = 79/272 (29%), Gaps = 36/272 (13%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  +I   +GT  H +L +   Q     T      
Sbjct: 9   LSPSRAGDYRQCPLLYRYRAIDRLPEPKTIAQVKGTLVHAVLENMYGQPRPERTYPKATK 68

Query: 65  TFENDTRIV---DTEMASSVSM------VLAYVRTFSGPFLSETEVPLEPFT-------- 107
             +    ++   D ++   V        ++       G F  E     +           
Sbjct: 69  MLKPQWALMVEKDPDLRELVPEDKLLPFLVECRSLLKGYFAMENPENFDADECEMLVDTT 128

Query: 108 --TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
                   G  D +      +  +VD+K G     +       Q+  YA      +  I 
Sbjct: 129 LPNGVPVRGFIDRVDVAPTGEIRVVDYKTGKKPIPRFSQQAVFQMRFYALVYWRLFNIIP 188

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L ++       S +        +L    ++  +      S  ++   +     
Sbjct: 189 TQLRLMYLKVMDSMYLAPSQV--------ELEYFERDVGD----LWSKITRDGKTGRFLP 236

Query: 223 VNDDSCRFCRAKVRCPALSRHVLLEATKDPST 254
                C +C  +  CPA     L       + 
Sbjct: 237 KESKLCDWCSFQSLCPAKGGTELPYPGWPDNA 268


>gi|118469031|ref|YP_888197.1| RecB family protein exonuclease [Mycobacterium smegmatis str. MC2
           155]
 gi|118170318|gb|ABK71214.1| RecB family protein exonuclease [Mycobacterium smegmatis str. MC2
           155]
          Length = 291

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/257 (16%), Positives = 72/257 (28%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  S     GT  H  L                  
Sbjct: 17  LSPSRASDFKQCPLLYRFRAIDRLPEPRSTAQLRGTLVHAALEDLYGLPAQERVPDTALS 76

Query: 65  TFENDTRIV---DTEMASSVSM--VLAYVRT-FSGPFLSETEVPLEP----------FTT 108
             E     V   D E+AS      +L   R   +G +  E     +P             
Sbjct: 77  LVEPAWDRVVAADPELASLAERDVLLREARALLTGYYRLEDPTRFDPQCCEQLIEVELAD 136

Query: 109 EPGATGTADILIFNS-TQWIIVDFKYGAGVP-----VKAENNTQLMLYACGALHQYGDIF 162
                G  D +      +  +VD+K G          + +   Q+  YA   L     + 
Sbjct: 137 GTLLRGYVDRIDVAPTGEVRVVDYKTGKAPAAARELAEFKALFQMKFYAVALLRSREVMP 196

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            R   L L            + ++  + D+LL   +                    +   
Sbjct: 197 SRLRLLYLA--------DKQVLDYSPAHDELLRFERTLI----AIWKAIQAAGAGGDFRP 244

Query: 223 VNDDSCRFCRAKVRCPA 239
                C +C  +  CPA
Sbjct: 245 NPSRLCSWCAHQSLCPA 261


>gi|172040717|ref|YP_001800431.1| RecB family exonuclease [Corynebacterium urealyticum DSM 7109]
 gi|171852021|emb|CAQ04997.1| putative RecB family exonuclease [Corynebacterium urealyticum DSM
           7109]
          Length = 275

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 42/257 (16%), Positives = 79/257 (30%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        K+P+  +I   +GT  H +L        +  T      
Sbjct: 19  LSPSRAGDYQQCPLLYRFRSIDKLPEPKTIAQVKGTLVHAVLEELHALPREQRTYPVAVK 78

Query: 65  TFENDTRIV---DTEMASSV------SMVLAYVRTFSGPFLSETEVPLEPFT-------- 107
             +     +   D ++   V        ++       G F  E     +           
Sbjct: 79  MLKPAWAKMVDKDADLNELVPDEQLYDFLVEARLLVKGYFQMENPQGFDAHEVEEFVEAT 138

Query: 108 --TEPGATGTADILIF-NSTQWIIVDFKYGAGVPVK--AENNTQLMLYACGALHQYGDIF 162
                   G  D +    + Q  +VD+K G   P +  A+   Q+  YA      Y  I 
Sbjct: 139 LPNGVPVRGFIDRVDVAANGQVRVVDYKTGKKPPPRFAAQALFQMKFYALVYWRLYDLIP 198

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L +        +       +  +L    ++ +E     L+       S +   
Sbjct: 199 AQLRLMYLKV--------ADDLVLQPTPAELQYFERDLRELWDSILADIQ----SGDFQP 246

Query: 223 VNDDSCRFCRAKVRCPA 239
                C +C  +  CPA
Sbjct: 247 KTSKLCDWCAFQELCPA 263


>gi|227496042|ref|ZP_03926353.1| RecB family exonuclease [Actinomyces urogenitalis DSM 15434]
 gi|226834435|gb|EEH66818.1| RecB family exonuclease [Actinomyces urogenitalis DSM 15434]
          Length = 271

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 40/256 (15%), Positives = 69/256 (26%), Gaps = 37/256 (14%)

Query: 8   SASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           S S +  +++CP+   L    ++P+  S+   +GT  H +L    +      T+      
Sbjct: 2   SPSRAKDFMQCPLMFRLRTVDRLPEPGSLATHKGTLVHAVLERLYDLPAPERTLEAAVGM 61

Query: 66  FENDTRIVDT---------EMASSVSMVLAYVRT-FSGPFLSETEVPLEPFTT------- 108
                              +    V+  L   R      F  E    LEP          
Sbjct: 62  LPGQWEAHREKNPVVMDLFDSPQDVAPWLEEARALLRTYFQMENPTRLEPSERELFVQTE 121

Query: 109 ---EPGATGTADILIF-NSTQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
                   G  D L         +VD+K G     + +++   Q+  Y        G   
Sbjct: 122 TRSGLLLRGFVDRLDVAADGAMRVVDYKTGKSPAPRFQHDALFQMRFYGLVLWRLRGQAP 181

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            R + + L            I        +L    +  + R           A       
Sbjct: 182 RRLQLVYL--------KDGRILTHDPVLAEL----EGMETRLEHLWDEVEDCATQGRFAP 229

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  +  CP
Sbjct: 230 RRSRLCDWCAFQAACP 245


>gi|297571477|ref|YP_003697251.1| hypothetical protein Arch_0907 [Arcanobacterium haemolyticum DSM
           20595]
 gi|296931824|gb|ADH92632.1| conserved hypothetical protein [Arcanobacterium haemolyticum DSM
           20595]
          Length = 283

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 44/261 (16%), Positives = 73/261 (27%), Gaps = 37/261 (14%)

Query: 4   HAFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH 61
           HA LS S    +  CP+        ++ +  S+ A  GT  H++L    +        + 
Sbjct: 5   HAALSPSRVSDFRSCPLKFRFRVIDRLTEPPSLEALRGTIVHSVLERLYDVPASERGEAL 64

Query: 62  QKLTFENDTRIVDTEMASSVSMVLAYVRTFSG----------PFLSETEVPLEPFTT--- 108
            + + EN       +  +   +        +            F  E    LEP      
Sbjct: 65  AQESLENIWEQHAEKSPADAELFTDSESFTTWLESARPLISSYFTLENPQYLEPHGRERF 124

Query: 109 -------EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQY 158
                       G  D L         IVD+K G     + ++    Q+  YA    ++ 
Sbjct: 125 VNATLPSGLAIRGIIDRLDKAPNGALRIVDYKTGKSPAPRFQDGAIFQMRFYATALFYEE 184

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G +  R + L L            +  +     D+     E         S    R    
Sbjct: 185 GTLPLRTQLLYL--------KDKRVLTYDPVPADVEATTNEL----NHVWSAIRGRIDDA 232

Query: 219 EHYGVNDDSCRFCRAKVRCPA 239
                    C +C     CPA
Sbjct: 233 HFEAKKGPLCNWCHFSSICPA 253


>gi|240171393|ref|ZP_04750052.1| hypothetical protein MkanA1_18921 [Mycobacterium kansasii ATCC
           12478]
          Length = 289

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 41/257 (15%), Positives = 71/257 (27%), Gaps = 36/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  S     G+  H  L                + 
Sbjct: 17  LSPSRATDFKQCPLLYRFRAIDRLPEAPSAPQLRGSVVHAALEQLYALPAVQRGPETARS 76

Query: 65  TFENDTRIVDTEMASSVSM-----VLAYVRT-FSGPFLSETEVPLEP----------FTT 108
             E     V     +         +L   R   SG +  E     +P             
Sbjct: 77  LVEAAWEQVIAGEPALADELQPQALLDEARALLSGYYRLEDPTRFDPQCCEHRVEVELAD 136

Query: 109 EPGATGTADILIFNS-TQWIIVDFKYGAGVP-----VKAENNTQLMLYACGALHQYGDIF 162
                G  D +   +  +  +VD+K G   P      + +   Q+  Y        G + 
Sbjct: 137 GTLLRGYIDRIDVAATGELRVVDYKTGKAPPAARALAEFKALFQMKFYGVALFRSRGVLP 196

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            R   + L          S + ++    D+LL   K                  S +   
Sbjct: 197 TRLRLIYLA--------DSQVLDYSPDRDELLRFEKTLM----AIWRAIQSAGRSGDFRP 244

Query: 223 VNDDSCRFCRAKVRCPA 239
                C +C  +  CPA
Sbjct: 245 NPSRLCDWCPHQAHCPA 261


>gi|134098811|ref|YP_001104472.1| RecB family exonuclease [Saccharopolyspora erythraea NRRL 2338]
 gi|291005834|ref|ZP_06563807.1| RecB family exonuclease [Saccharopolyspora erythraea NRRL 2338]
 gi|133911434|emb|CAM01547.1| putative RecB family exonuclease [Saccharopolyspora erythraea NRRL
           2338]
          Length = 293

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/260 (15%), Positives = 75/260 (28%), Gaps = 39/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+T +     GT  H++L                + 
Sbjct: 20  LSPSRAGDFKQCPLLYRFRAVDRLPETPTRAQVRGTVVHSVLERLFSLPTAERGPERARA 79

Query: 65  TFENDTRIV---------------DTEMASSVS---MVLAYVRTFSGPFLSE---TEVPL 103
                   +               D E+A  +     +L        P   E    E+ +
Sbjct: 80  LLAPAWEDLLAAEPGLGELFDGAGDPELARWLDSANALLDSYFELEDPRRLEPEACELRV 139

Query: 104 EPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYG 159
           E          G  D +      +  +VD+K GA      +A+   Q+  YA       G
Sbjct: 140 ETELESGVLLRGFIDRVDVAPTGEIRLVDYKTGAAPREIGEAKAMFQMKFYALVLWRTRG 199

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
           +I  +   + L+              +     +L    +              K   + +
Sbjct: 200 EIPRQLLLMYLS--------DKQSLAYTPDEAELRRFERTL----EAIWQAILKAGRTGD 247

Query: 220 HYGVNDDSCRFCRAKVRCPA 239
                   C +C  K  CPA
Sbjct: 248 FRPNPSRLCDYCDHKPLCPA 267


>gi|41407941|ref|NP_960777.1| hypothetical protein MAP1843 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41396295|gb|AAS04160.1| hypothetical protein MAP_1843 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 301

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 38/260 (14%), Positives = 67/260 (25%), Gaps = 41/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  S     G+  H  L    E             
Sbjct: 23  LSPSRAADFKQCPLLYRFRAIDRLPEAPSPAQLRGSLVHAALQQLYELPAAQRGPETALA 82

Query: 65  TFENDTRIVDTEMASSVSM--------------------VLAYVRTFSGPFLSETEVPLE 104
             +     +        +                           T   P   E  V +E
Sbjct: 83  LVDPAWEQLLAATPELTADLDPTQHGQLLAEAQALLAGYYRLEDPTRFDPQCCEERVEVE 142

Query: 105 PFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVP-----VKAENNTQLMLYACGALHQY 158
                    G  D +   +  +  +VD+K G   P      + +   Q+  YA   L   
Sbjct: 143 L-ADGTLLRGFIDRIDVAATGELRVVDYKTGKAPPAARALAEFKAMFQMKFYAVALLRSR 201

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G    R   + L            + ++    D+LL   K                  + 
Sbjct: 202 GVPPTRLRLIYLA--------DGQVLDYSPEYDELLRFEKTLM----AIWRAIQTAGRTG 249

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
           +        C +C  +  CP
Sbjct: 250 DFRPTQSRLCDWCPHQQLCP 269


>gi|256825225|ref|YP_003149185.1| RecB family exonuclease [Kytococcus sedentarius DSM 20547]
 gi|256688618|gb|ACV06420.1| RecB family exonuclease [Kytococcus sedentarius DSM 20547]
          Length = 313

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 45/293 (15%), Positives = 81/293 (27%), Gaps = 70/293 (23%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +++CP+        ++P+  S  A  GTF H++L +  +           
Sbjct: 4   AALSPSRAGDFMQCPLLYRFRVVDRLPEPPSAAAVRGTFVHSVLENVFDLPAHRRRPDDA 63

Query: 63  KLTFENDTRIVDTEMAS------------------------------------------- 79
               E     +  E                                              
Sbjct: 64  VGLMEQTWADLVAERPEVLEVLRADGSGATALDAVDGDADRASTGAAVQPTPEELAAWMA 123

Query: 80  SVSMVLAYVRTFSGPFLSE-------TEVPLE--PFTTEPGATGTADILIFN--STQWII 128
               ++    T   P + E        EVP++      E    G  D L          +
Sbjct: 124 DAEALVRRWFTLEDPSVLEPAERELYVEVPVDRGGERGELVLRGYVDRLDVAPADGALRV 183

Query: 129 VDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEW 186
           VD+K G       +A+   Q+  YA       G +    + + L            +   
Sbjct: 184 VDYKTGRAPSELFQAKALFQMKFYALAIWRLRGRVPALLQLVYL--------KDGTVLRH 235

Query: 187 VISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA 239
           V + ++LL   ++             + A   +        C +C  +  CPA
Sbjct: 236 VPTQEELLATERKV----VALYDAIERAAELGDWRPNRSRLCDWCSFQSICPA 284


>gi|213965620|ref|ZP_03393814.1| RecB family exonuclease [Corynebacterium amycolatum SK46]
 gi|213951779|gb|EEB63167.1| RecB family exonuclease [Corynebacterium amycolatum SK46]
          Length = 292

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 42/265 (15%), Positives = 81/265 (30%), Gaps = 44/265 (16%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S ++ + +CP+        KIP+ +++   +GT  H +L        +  T      
Sbjct: 3   LSPSRANDYRQCPLKYRFRAIDKIPEPSTVAQVKGTLVHAVLEQMHAWPREERTYPAAVK 62

Query: 65  TFENDTRIV---DTEMASSV------SMVLAYVRTFSGPFLSETEVPLEPFTTE------ 109
             +     +   D E+   V        ++       G F+ E  +  +    E      
Sbjct: 63  RLKPTWEDMRAKDEELIELVPEDDYYDFLVECRGLLKGYFMMENPMGFDAAEMEKFVQLV 122

Query: 110 ------------PGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGA 154
                           G  D +      +  IVD+K G     + ++    Q+  YA   
Sbjct: 123 IDPDADQTVPLSVPLRGFIDRVDIAPTGEVRIVDYKTGKKPSPRFQDEALFQMRFYALVW 182

Query: 155 LHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKR 214
               G I  +   + L +        +       +A +L     E  +      S   + 
Sbjct: 183 WRLTGRIPEQLRLMYLKV--------ADDLVLSPNATELEAFQAEIAD----LWSAIVRD 230

Query: 215 AVSLEHYGVNDDSCRFCRAKVRCPA 239
             + +        C +C  +  CPA
Sbjct: 231 GETGDFVPKKSKLCGWCSFQELCPA 255


>gi|159037949|ref|YP_001537202.1| hypothetical protein Sare_2353 [Salinispora arenicola CNS-205]
 gi|157916784|gb|ABV98211.1| conserved hypothetical protein [Salinispora arenicola CNS-205]
          Length = 303

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 43/260 (16%), Positives = 73/260 (28%), Gaps = 38/260 (14%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +  CP+        ++P+  S+  + GT  H +L    +      T +  
Sbjct: 23  ASLSPSRAADFKTCPLLYRFRSIDRLPEQPSVEQARGTLVHAVLERLFDLPPAGRTPTAA 82

Query: 63  KLTFENDTRIVDTE-----------MASSVSMVLAYVRTFSGPFLSETEVPLEP------ 105
                     +  E             +    + +      G F  E    LEP      
Sbjct: 83  GDLVAPQWERLVAEQPELAALFAADAEARAEFLRSATGLLRGYFAVEDPRRLEPAERESL 142

Query: 106 ----FTTEPGATGTADILIFN-STQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQY 158
                  E    G  D L         +VD+K G       +A    QL  YA       
Sbjct: 143 ISAVVDEELLIRGYLDRLDVAPDGALRVVDYKTGGAPREAFEARALFQLKFYALVLWRTR 202

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G +      L L          + + ++   AD+L+   +                  + 
Sbjct: 203 GVVPRVLRLLYL--------KDAEVCDYAPDADELVRFERTV----VALWRAIEAATAAQ 250

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
           +        C +C  +  CP
Sbjct: 251 DFRPRPSRLCDWCSHQRLCP 270


>gi|182439644|ref|YP_001827363.1| hypothetical protein SGR_5851 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178468160|dbj|BAG22680.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 303

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 35/253 (13%), Positives = 68/253 (26%), Gaps = 40/253 (15%)

Query: 14  RWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTR 71
            +++CP+        K+P+  S  A+ GT  H +L    +      T    +        
Sbjct: 21  DFMQCPLLYRFRVIDKLPEKPSEAATRGTLVHAVLERLFDAPAADRTAPRARALIPGQWD 80

Query: 72  IVDT-------------------EMASSVSMVLAYVRTFSGPFLS---ETEVPLEPFTT- 108
            +                             ++    +   P      E E+ +E     
Sbjct: 81  RLLESKPELSDLFAGDTEGERLTRWLGEAERLVDRWFSLEDPTRLEPAERELFVETELES 140

Query: 109 EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENNT--QLMLYACGALHQYGDIFGRP 165
                G  D +      +  IVD+K G     +  +    Q+  YA       G +  R 
Sbjct: 141 GLRLRGVIDRVDVAPSGEVRIVDYKTGKAPRPEYSDGPLFQMTFYALVIWRLKGVVPRRL 200

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
           + + L            +  +     DL    ++            S    + +      
Sbjct: 201 QLVYL--------GSGDVLTYDPVVADLERVERKLL----ALWDAISLATETGDWRPRPT 248

Query: 226 DSCRFCRAKVRCP 238
             C +C  +  CP
Sbjct: 249 KLCGWCDHQAVCP 261


>gi|118617851|ref|YP_906183.1| hypothetical protein MUL_2341 [Mycobacterium ulcerans Agy99]
 gi|118569961|gb|ABL04712.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99]
          Length = 293

 Score =  150 bits (379), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 38/261 (14%), Positives = 70/261 (26%), Gaps = 41/261 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++ +  S     G+  H  L                + 
Sbjct: 17  LSPSRAADFKQCPLLYRFRAIDRLSEKPSTAQLRGSVVHAALEQLYALPAVQRGPDTARS 76

Query: 65  TFENDTRIV---------------DTEMASSVSMVLAYVRTFSGPFL-----SETEVPLE 104
             E+    V                 ++      +L+       P        E  V +E
Sbjct: 77  LVESAWEQVIAGELDLAGELAADQQAQLLEDARALLSGYYRLEDPRRFDPQSCEQRVEVE 136

Query: 105 PFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVP-----VKAENNTQLMLYACGALHQY 158
                    G  D +   +  +  +VD+K G   P      + +   Q+  Y        
Sbjct: 137 L-ADGTLLRGYIDRIDVAATGELRVVDYKTGKAPPAARALAEFKAMFQMKFYGVALFRSR 195

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G +  R   + L            + ++    D+LL   K                  S 
Sbjct: 196 GVLPSRLRLIYLA--------DGQVLDYSPDRDELLRFEKTLM----AIWRAIQSAGQSG 243

Query: 219 EHYGVNDDSCRFCRAKVRCPA 239
           +        C +C  +  CPA
Sbjct: 244 DFRPNASRLCNWCPHQQHCPA 264


>gi|289643896|ref|ZP_06476000.1| RecB family exonuclease-like protein [Frankia symbiont of Datisca
           glomerata]
 gi|289506282|gb|EFD27277.1| RecB family exonuclease-like protein [Frankia symbiont of Datisca
           glomerata]
          Length = 332

 Score =  150 bits (378), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 47/276 (17%), Positives = 74/276 (26%), Gaps = 40/276 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+        ++P+  S  A  GT  H +L    +      T++  + 
Sbjct: 24  LSPSRAGDFMNCPLRYRFRVIDRLPEPPSSAAVRGTVVHTVLERLFDHPPPGRTIAAAEA 83

Query: 65  TFENDTRIVDTEMASSV---------SMVLAYVRT-FSGPFLSETEVPLEPFTT------ 108
             E     +                 +  L   R+  +G F  E    L P         
Sbjct: 84  LLEPAWHDLLAREPELATLFADEAERAAWLESARSLLTGYFSLENPAGLTPAARELYVEH 143

Query: 109 ----EPGATGTADILI----FNSTQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQY 158
                    G  D L      +     +VD+K G       E     Q+  YA       
Sbjct: 144 VLDSGVRLRGYIDRLDEAATRDGPALRVVDYKTGRSPGPAFEGQALFQMKFYAYLLWRIR 203

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G I        L                     DL    ++         S  S+   + 
Sbjct: 204 GVIPRELRLYYLA--------DRTWIRVQPDESDLRATERKI----DAVWSAISRARRTG 251

Query: 219 EHYGVNDDSCRFCRAKVRCPALSRHVLLEATKDPST 254
           +        C +C  K+RCPA           D   
Sbjct: 252 DWRATPSKLCDWCDHKIRCPAFGGTPPPLPAADRPA 287


>gi|317500271|ref|ZP_07958498.1| phage-associated protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|316898314|gb|EFV20358.1| phage-associated protein [Lachnospiraceae bacterium 8_1_57FAA]
          Length = 145

 Score =  150 bits (378), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 29/141 (20%), Positives = 56/141 (39%), Gaps = 6/141 (4%)

Query: 246 LEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKRL-NAGDEIQGYQLVEGRKGNR 304
               K P   T  E+ +    +  +  +         +   + G E  G+++VEGR  NR
Sbjct: 5   RLEFKMPPLLTDAEIEEVLDVLPDLTKWANEITAYATEAAIHHGKEWNGFKVVEGR-SNR 63

Query: 305 SFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPV 364
            ++D     E        + +++ L    E+++L  +      F E L +LI +  GKP+
Sbjct: 64  KYRDELLVAEAAREHGYTDIYRQTLIPMTEMQKLMGKSA----FEEILGDLIYKPPGKPI 119

Query: 365 IAPRDIPTNKQTQKSQLSEFE 385
           + P           +  +EF+
Sbjct: 120 LVPNTDKRPAMNVTNAENEFD 140


>gi|315506179|ref|YP_004085066.1| hypothetical protein ML5_5448 [Micromonospora sp. L5]
 gi|315412798|gb|ADU10915.1| hypothetical protein ML5_5448 [Micromonospora sp. L5]
          Length = 300

 Score =  150 bits (378), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 45/261 (17%), Positives = 77/261 (29%), Gaps = 39/261 (14%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +  CP+        ++P+  ++  + GT  H +L    +    A T    
Sbjct: 19  ASLSPSRAADFKTCPLLYRFRSIDRLPERPTVEQARGTLVHAVLERLFDLPAAARTPESA 78

Query: 63  KLTFENDTRIVDTEMASSVSMVLA--------YVRT----FSGPFLSETEVPLEP----- 105
                     + TE     ++           ++R+      G F  E    LEP     
Sbjct: 79  GDLVAPQWDRLVTEEPELATLFADGDAVGPQEFLRSATALLDGYFAVEDPRRLEPAEREA 138

Query: 106 -----FTTEPGATGTADILIFN-STQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQ 157
                   E    G  D L         +VD+K G       +A    QL  YA      
Sbjct: 139 LISAVVDDELLIRGYLDRLDVAPDGALRVVDYKTGGAPREAFEARALFQLKFYALVLWRT 198

Query: 158 YGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVS 217
            G +      L L          + + ++   AD+L+   +              +    
Sbjct: 199 RGVVPRVLRLLYL--------KDAEVCDYAPDADELVRFERTV----VALWRAIEQATAR 246

Query: 218 LEHYGVNDDSCRFCRAKVRCP 238
            +        C +C  +  CP
Sbjct: 247 QDFRPRPSRLCDWCNHQALCP 267


>gi|262202382|ref|YP_003273590.1| RecB family exonuclease-like protein [Gordonia bronchialis DSM
           43247]
 gi|262085729|gb|ACY21697.1| RecB family exonuclease-like protein [Gordonia bronchialis DSM
           43247]
          Length = 295

 Score =  150 bits (378), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 41/255 (16%), Positives = 73/255 (28%), Gaps = 35/255 (13%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        +  +T +   + GT  H  L +  +   +  T     L
Sbjct: 34  LSPSRAADFKQCPLLYRYRAIDRFAETPTPAQTRGTVVHAALENLFDMPAELRTQESADL 93

Query: 65  TFENDTRIVDTEMASSVS---------------MVLAYVRTFSGPFLSE---TEVPLEPF 106
             E     +                         ++A   T   P   E    E  +E  
Sbjct: 94  LVEGAWGALCEADPDLARVVADVGESQFLADAHKLIATYYTMENPTAFEADAVEHHVELE 153

Query: 107 TTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIFG 163
           + +    G  D +      +  +VD+K G       E+    Q+  YA   L   G +  
Sbjct: 154 SEQVRLRGFIDRIDVAPTGELRVVDYKTGRAPGEAFESRALFQMKFYALAILRTRGVVPH 213

Query: 164 RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
           R + + L               +    D+L    +              +   + +    
Sbjct: 214 RLQLMYLA--------DGQQLTYTPDRDELERFERTLI----AIWRAIREAVATGDFRPK 261

Query: 224 NDDSCRFCRAKVRCP 238
               C  C  K RCP
Sbjct: 262 RSRLCSLCEHKTRCP 276


>gi|302867411|ref|YP_003836048.1| hypothetical protein Micau_2940 [Micromonospora aurantiaca ATCC
           27029]
 gi|302570270|gb|ADL46472.1| hypothetical protein Micau_2940 [Micromonospora aurantiaca ATCC
           27029]
          Length = 300

 Score =  150 bits (378), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 45/261 (17%), Positives = 77/261 (29%), Gaps = 39/261 (14%)

Query: 5   AFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A LS S +  +  CP+        ++P+  ++  + GT  H +L    +    A T    
Sbjct: 19  ASLSPSRAADFKTCPLLYRFRSIDRLPERPTVEQARGTLVHAVLERLFDLPAAARTPESA 78

Query: 63  KLTFENDTRIVDTEMASSVSMVLA--------YVRT----FSGPFLSETEVPLEP----- 105
                     + TE     ++           ++R+      G F  E    LEP     
Sbjct: 79  GDLVVPQWDRLVTEEPELATLFADGDAVGPQEFLRSATALLDGYFAVEDPRRLEPAEREA 138

Query: 106 -----FTTEPGATGTADILIFN-STQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQ 157
                   E    G  D L         +VD+K G       +A    QL  YA      
Sbjct: 139 LISAVVDDELLIRGYLDRLDVAPDGALRVVDYKTGGAPREAFEARALFQLKFYALVLWRT 198

Query: 158 YGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVS 217
            G +      L L          + + ++   AD+L+   +              +    
Sbjct: 199 RGVVPRVLRLLYL--------KDAEVCDYAPDADELVRFERTV----VALWRAIEQATAR 246

Query: 218 LEHYGVNDDSCRFCRAKVRCP 238
            +        C +C  +  CP
Sbjct: 247 QDFRPRPSRLCDWCNHQALCP 267


>gi|159146278|gb|ABW90602.1| conserved hypothetical protein [Bacteriophage APSE-2]
          Length = 271

 Score =  150 bits (378), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 70/259 (27%), Positives = 112/259 (43%), Gaps = 31/259 (11%)

Query: 53  GVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP--FLSETEVPLEPFTTEP 110
           G DA+         + ++  VD EM   V   +  V   +       E  V         
Sbjct: 17  GFDAKEYIGTYPLLKANSPQVDEEMIEHVQTYIDTVWQLANGKMLQVEERVDFSAVIGVD 76

Query: 111 GATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTL 170
            + GTAD +I +S +  I D KYG GV V A+NN QLMLYA GAL Q+  ++    ++ L
Sbjct: 77  NSFGTADAIIVSSDELQIHDLKYGKGVKVDAQNNEQLMLYALGALQQFDLVYDF-NSVRL 135

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLK------SKRAVSLEHYGVN 224
            I QPR+     ++EW +S +DL +     + R   A+ +          A+    +   
Sbjct: 136 FIHQPRLN---HLSEWAVSVEDLKDFGDLARLRAQKAMEMTSLAERNGLDALPDSAFSPG 192

Query: 225 DDSCRFCRAK-VRCPALSRHV------------------LLEATKDPSTNTTVELSKAYS 265
              C+FC+AK   C A ++ V                  L +A K  +  T  +++K Y 
Sbjct: 193 VKQCQFCKAKGGLCFAQAQFVHNEVKGDFVDLTQPLASQLSDAPKRITLLTPEQMAKLYP 252

Query: 266 SISLIKSYVKACEDEMFKR 284
            + LI+S+ KA  + + + 
Sbjct: 253 HVDLIESFCKALRNRVAEA 271


>gi|254775065|ref|ZP_05216581.1| RecB family protein exonuclease [Mycobacterium avium subsp. avium
           ATCC 25291]
          Length = 301

 Score =  149 bits (377), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 38/260 (14%), Positives = 66/260 (25%), Gaps = 41/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  S     G+  H  L    E             
Sbjct: 23  LSPSRAADFKQCPLLYRFRAIDRLPEAPSPAQLRGSLVHAALQQLYELPAAQRGPETALA 82

Query: 65  TFENDTRIVDTEMASSVSM--------------------VLAYVRTFSGPFLSETEVPLE 104
                   +        +                           T   P   E  V +E
Sbjct: 83  LVGPAWEQLLAASPELTADLDPTQHGQLLAEAQALLAGYYRLEDPTRFDPQCCEERVEVE 142

Query: 105 PFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVP-----VKAENNTQLMLYACGALHQY 158
                    G  D +   +  +  +VD+K G   P      + +   Q+  YA   L   
Sbjct: 143 L-ADGTLLRGFIDRIDVAATGELRVVDYKTGKAPPAARALAEFKAMFQMKFYAVALLRSR 201

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G    R   + L            + ++    D+LL   K                  + 
Sbjct: 202 GVPPTRLRLIYLA--------DGQVLDYSPEYDELLRFEKTLM----AIWRAIQSAGRTG 249

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
           +        C +C  +  CP
Sbjct: 250 DFRPTQSRLCDWCPHQQLCP 269


>gi|239978583|ref|ZP_04701107.1| hypothetical protein SalbJ_04062 [Streptomyces albus J1074]
          Length = 272

 Score =  149 bits (377), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 35/255 (13%), Positives = 67/255 (26%), Gaps = 44/255 (17%)

Query: 16  LKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           ++CP+        ++P+  S  A+ GT  H +L    +      T          +   +
Sbjct: 1   MQCPLLYRFRVIDRLPEKPSPAATRGTLVHAVLERLFDAPAAERTAPRATGLLPGEWERL 60

Query: 74  DTEMASSVSMV-----------------------LAYVRTFSGPFLS---ETEVPLEPFT 107
             E      +                        +    T   P      E E+ +E   
Sbjct: 61  LAERPELAELFSGEEGESTPGERLERWLGEAERLVERWFTLEDPTRLEPAERELFVEAEL 120

Query: 108 T-EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIFG 163
                  G  D +      +  IVD+K G     +       Q+  YA       G +  
Sbjct: 121 ESGLRLRGIIDRVDVAPTGEVRIVDYKTGKAPRPQYAEGALFQMTFYALVVWRLKGVLPR 180

Query: 164 RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
           R + + L            +  +     DL    ++             +   + +    
Sbjct: 181 RLQLVYL--------GSGEVRSYDPVMADLERVERKLL----ALWEAIQEATRTGDWRPK 228

Query: 224 NDDSCRFCRAKVRCP 238
               C +C  +  CP
Sbjct: 229 PSKLCGWCDHQAVCP 243


>gi|158316649|ref|YP_001509157.1| hypothetical protein Franean1_4886 [Frankia sp. EAN1pec]
 gi|158112054|gb|ABW14251.1| conserved hypothetical protein [Frankia sp. EAN1pec]
          Length = 334

 Score =  149 bits (376), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 44/261 (16%), Positives = 73/261 (27%), Gaps = 40/261 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+        ++P+  S  A+ GT  H +L    +    + T      
Sbjct: 57  LSPSRAADFVNCPLRYRFRVVDRLPEAPSEAATRGTVVHGVLERLFDLPARSRTQPAATE 116

Query: 65  TFENDTRIVDTEMAS---------SVSMVLAYVRT-FSGPFLSETEVPLEPFTT------ 108
             E     +     +         ++   L   R   +G F  E    L P         
Sbjct: 117 LVEPVWADLLARDPALGGLFDDDGALRSWLDSARDLLAGYFTLEDPTRLAPAARELYVEH 176

Query: 109 ----EPGATGTADILIFNS----TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQY 158
                    G  D L        T   ++D+K G       E     Q+  YA       
Sbjct: 177 VLASGLRLRGYVDRLDSAETPQGTALRVIDYKTGRSPGPAFEGAAMFQMRFYALVLWRSR 236

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G I        L+                    +L    +    R     +  ++   + 
Sbjct: 237 GVIPRELRLYYLS--------DRTWLRATPEESELRATER----RIEALWAAIARAHRTG 284

Query: 219 EHYGVNDDSCRFCRAKVRCPA 239
           +        C +C  K RCPA
Sbjct: 285 DWRATPGRLCDWCDHKPRCPA 305


>gi|19552714|ref|NP_600716.1| endonuclease [Corynebacterium glutamicum ATCC 13032]
 gi|62390382|ref|YP_225784.1| endonuclease [Corynebacterium glutamicum ATCC 13032]
 gi|21324268|dbj|BAB98893.1| RecB family exonuclease [Corynebacterium glutamicum ATCC 13032]
 gi|41325719|emb|CAF21508.1| RecB family exonuclease [Corynebacterium glutamicum ATCC 13032]
          Length = 278

 Score =  149 bits (376), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 32/256 (12%), Positives = 71/256 (27%), Gaps = 36/256 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  ++   +GT  H +L +  +   +         
Sbjct: 17  LSPSRAGDYQQCPLLYRFRAIDRLPEPKTVAQVKGTLVHAVLEYMHKLPREEREYPAMVK 76

Query: 65  TFENDTRIVDTEMASSVS---------MVLAYVRTFSGPFLSETEVPLEPFT-------- 107
             +     +  E A              ++       G F  E     +           
Sbjct: 77  QLKPTWAQMCEEDAELKELVPEDELYDFLVDSRTLLRGYFEMENPQGFDATECEMYVDTV 136

Query: 108 --TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIF 162
                   G  D +      Q  ++D+K G     +       Q++ YA      + +I 
Sbjct: 137 LPNGVPVRGFIDRVDTAPTGQVRVIDYKTGKKPKPQWSQQAQFQMLFYALVYWRMFNEIP 196

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L +                S + L    ++  +      +       +     
Sbjct: 197 AQLRLMYLKVNDSMFLN--------PSREQLEFFERDLGD----LWAKIEMDGKAGHFRT 244

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  +  CP
Sbjct: 245 KTSKLCGWCPHQSLCP 260


>gi|145295633|ref|YP_001138454.1| RecB family exonuclease [Corynebacterium glutamicum R]
 gi|140845553|dbj|BAF54552.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 278

 Score =  149 bits (376), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 32/256 (12%), Positives = 71/256 (27%), Gaps = 36/256 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  ++   +GT  H +L +  +   +         
Sbjct: 17  LSPSRAGDYQQCPLLYRFRAIDRLPEPKTVAQVKGTLVHAVLEYMHKLPREEREYPAMVK 76

Query: 65  TFENDTRIVDTEMASSVS---------MVLAYVRTFSGPFLSETEVPLEPFT-------- 107
             +     +  E A              ++       G F  E     +           
Sbjct: 77  QLKPTWAQMCEEDAELKELVPEDELYDFLVDSRTLLRGYFEMENPQGFDATECEMYLDTV 136

Query: 108 --TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIF 162
                   G  D +      Q  ++D+K G     +       Q++ YA      + +I 
Sbjct: 137 LPNGVPVRGFIDRVDTAPTGQVRVIDYKTGKKPKPQWSQQAQFQMLFYALVYWRMFNEIP 196

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L +                S + L    ++  +      +       +     
Sbjct: 197 AQLRLMYLKVNDSMFLN--------PSREQLEFFERDLGD----LWAKIEMDGKAGHFRT 244

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  +  CP
Sbjct: 245 KTSKLCGWCPHQSLCP 260


>gi|117928387|ref|YP_872938.1| RecB family exonuclease [Acidothermus cellulolyticus 11B]
 gi|117648850|gb|ABK52952.1| putative RecB family exonuclease [Acidothermus cellulolyticus 11B]
          Length = 266

 Score =  149 bits (375), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 37/261 (14%), Positives = 68/261 (26%), Gaps = 41/261 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  ++ CP+   L    ++P+     +  GT  H +L    +       +     
Sbjct: 3   LSPSRAADFMTCPLLYRLRCIDRLPEPPDPVSVRGTLVHAVLDQLFDLPPAERVLEKALA 62

Query: 65  TFENDTRIVDTEMASSVSMVLA--------------YVRTFSGPFLSETEVPLEPFT--- 107
                 + +         +                         F  E    ++P     
Sbjct: 63  LVSRSWQELCAARPELADLFADPEMPPSSCDDWLASAADLLRRYFTIENPTRIQPTEREL 122

Query: 108 -------TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQ 157
                        G  D L      +  IVD+K G   P   E     QL  YA      
Sbjct: 123 LVETQLADGIRLRGFVDRLDVAPTGEVRIVDYKTGVAPPESFEEKALFQLKFYALAWWRV 182

Query: 158 YGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVS 217
            G +    + + L            +  +     DLL   ++ +       +   +   +
Sbjct: 183 NGVVPALLQLIYL--------GDGQVLRYAPEEADLLAVERKIR----ALWAAIDRALRT 230

Query: 218 LEHYGVNDDSCRFCRAKVRCP 238
                     C +C  +  CP
Sbjct: 231 RHFPPRRSRGCEWCAFRAVCP 251


>gi|118466570|ref|YP_881596.1| RecB family protein exonuclease [Mycobacterium avium 104]
 gi|118167857|gb|ABK68754.1| RecB family protein exonuclease [Mycobacterium avium 104]
          Length = 301

 Score =  149 bits (375), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 38/260 (14%), Positives = 66/260 (25%), Gaps = 41/260 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  S     G+  H  L    E             
Sbjct: 23  LSPSRAADFKQCPLLYRFRAIDRLPEAPSPAQLRGSLVHAALQQLYELPAAQRGPETALA 82

Query: 65  TFENDTRIVDTEMASSVSM--------------------VLAYVRTFSGPFLSETEVPLE 104
                   +        +                           T   P   E  V +E
Sbjct: 83  LVGPAWEQLLAATPELTADLDPTQHGQLLAEAQALLAGYYRLEDPTRFDPQCCEERVEVE 142

Query: 105 PFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVP-----VKAENNTQLMLYACGALHQY 158
                    G  D +   +  +  +VD+K G   P      + +   Q+  YA   L   
Sbjct: 143 L-ADGTLLRGFIDRIDVAATGELRVVDYKTGKAPPAARALAEFKAMFQMKFYAVALLRSR 201

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G    R   + L            + ++    D+LL   K                  + 
Sbjct: 202 GVPPTRLRLIYLA--------DGQVLDYSPEYDELLRFEKTLM----AIWRAIQSAGRTG 249

Query: 219 EHYGVNDDSCRFCRAKVRCP 238
           +        C +C  +  CP
Sbjct: 250 DFRPTQSRLCDWCPHQQLCP 269


>gi|296165191|ref|ZP_06847738.1| RecB family exonuclease [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295899380|gb|EFG78839.1| RecB family exonuclease [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 313

 Score =  149 bits (375), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 39/259 (15%), Positives = 66/259 (25%), Gaps = 39/259 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  S     G+  H  L                  
Sbjct: 38  LSPSRAADFKQCPLLYRFRAIDRLPEAPSAAQLRGSVVHAALQQLYALPAAQRGPDTALA 97

Query: 65  TFENDTRIVDTEMASSVSMVLAYVRT---------FSGPFLSETEVPLEP---------- 105
             E     V               R           SG +  E     +P          
Sbjct: 98  LLEPAWDQVVAAAPELAGEFEPAQRGQLLAEARALLSGYYRLEDPTRFDPQCCEERVEVE 157

Query: 106 FTTEPGATGTADILIFNS-TQWIIVDFKYGAGVP-----VKAENNTQLMLYACGALHQYG 159
                   G  D +   +  +  +VD+K G   P      + +   Q+  YA   L   G
Sbjct: 158 LADGTLLRGFIDRIDVAATGELRVVDYKTGKAPPAARALAEFKAMFQMKFYAVALLRTRG 217

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
               R   + L            + ++    D+LL   K                  + +
Sbjct: 218 VPPTRLRLIYLA--------DGQVLDYSPDHDELLRFEKTLT----AIWRAIQTAGRTGD 265

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  +  CP
Sbjct: 266 FRPSQSRLCDWCPHQQHCP 284


>gi|159146276|gb|ABW90601.1| conserved hypothetical protein [Bacteriophage APSE-2]
          Length = 271

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 71/259 (27%), Positives = 113/259 (43%), Gaps = 31/259 (11%)

Query: 53  GVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP--FLSETEVPLEPFTTEP 110
           G DA+         + ++  VD EM   V   +  V   +       E  V         
Sbjct: 17  GFDAKEYIGTYPLLKANSPQVDEEMIEHVQTYIDTVWQLANGKMLQVEERVDFSAVIGVD 76

Query: 111 GATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTL 170
            + GTAD +I +S +  I D KYG GV V A+NN QLMLYA GALHQ+  ++   + + L
Sbjct: 77  NSFGTADAIIVSSDELQIHDLKYGKGVKVDAQNNEQLMLYALGALHQFDLVYDF-KTVRL 135

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLK------SKRAVSLEHYGVN 224
            I QPR+     ++EW +S D+L +  ++ K     A+ +          A+    +   
Sbjct: 136 FIHQPRLN---HLSEWALSVDELKDFGEQAKSGAQKAMKMATLAERSGLDALPDSAFSPG 192

Query: 225 DDSCRFCRAK-VRCPALSRHV------------------LLEATKDPSTNTTVELSKAYS 265
              C FC+AK   C A ++ V                  L +A K  +  T  +++K Y 
Sbjct: 193 AKQCLFCKAKGGLCFAQAQFVHNEVKGDFVDLTQPLASQLSDAPKRITLLTPEQMAKLYP 252

Query: 266 SISLIKSYVKACEDEMFKR 284
            + LI+S+ KA  + + + 
Sbjct: 253 HVDLIESFCKALRNRVAEA 271


>gi|256832430|ref|YP_003161157.1| RecB family exonuclease-like protein [Jonesia denitrificans DSM
           20603]
 gi|256685961|gb|ACV08854.1| RecB family exonuclease-like protein [Jonesia denitrificans DSM
           20603]
          Length = 298

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 43/256 (16%), Positives = 73/256 (28%), Gaps = 35/256 (13%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET------ 58
           LS S +  + +CP+   L    ++P+  S+ A  GT  H++L    +   D         
Sbjct: 14  LSPSRALDFRQCPLLFRLRTIDRLPERESVAAVRGTVVHSVLERLFDVAPDERDVGFATS 73

Query: 59  -VSHQKLTFENDTRIVDTEMASS--------VSMVLAYVRTFSGPFLS---ETEVPLEPF 106
            V             V  E   +           ++A       P +      EV L  +
Sbjct: 74  LVDGVVQELVESRPAVKAEFDVATIEGVVTDARALVARYFELENPQMLHPAAREVTLSSY 133

Query: 107 TTEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIFG 163
                 TG  D +         +VD+K G     +   N   Q+  YA       G +  
Sbjct: 134 VGRRSVTGVVDRVDVAPDGAIRLVDYKSGRAPAPQYSGNAAFQMRFYALLVARVKGRLPA 193

Query: 164 RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
               + L            I E   +  D+    +              +   +      
Sbjct: 194 MLRLVYL--------GDGKIMESAPTNGDV-SWVE---ASIARVWDGIERAIDTDGFVPR 241

Query: 224 NDDSCRFCRAKVRCPA 239
               C +C  +  CPA
Sbjct: 242 RSKLCGWCSFQQVCPA 257


>gi|239986596|ref|ZP_04707260.1| hypothetical protein SrosN1_04740 [Streptomyces roseosporus NRRL
           11379]
          Length = 281

 Score =  148 bits (373), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 34/251 (13%), Positives = 66/251 (26%), Gaps = 40/251 (15%)

Query: 16  LKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           ++CP+        K+P+  S  A+ GT  H +L    +      T    +         +
Sbjct: 1   MQCPLLYRFRVIDKLPEKPSEAATRGTLVHAVLERLFDVPAADRTAPRARALIPGQWDRL 60

Query: 74  DT-------------------EMASSVSMVLAYVRTFSGPFLS---ETEVPLEPFTT-EP 110
                                        ++    +   P      E E+ +E       
Sbjct: 61  LESKPELSDLFAGDSEGERLTRWLGEAERLVDRWFSLEDPTRLEPAEREMFVETELESGL 120

Query: 111 GATGTADILIFNS-TQWIIVDFKYGAGVPVKAENNT--QLMLYACGALHQYGDIFGRPEA 167
              G  D +      +  IVD+K G     +  +    Q+  YA       G +  R + 
Sbjct: 121 RLRGVIDRVDIAPSGEVRIVDYKTGKAPRPEYSDGPLFQMTFYALVIWRLKGVVPRRLQL 180

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + L            +  +     DL    ++                 + +        
Sbjct: 181 VYL--------GSGDVMTYDPVVADLERVERKLL----ALWDAIRLATETGDWRPRPTKL 228

Query: 228 CRFCRAKVRCP 238
           C +C  +  CP
Sbjct: 229 CGWCDHQAVCP 239


>gi|300786788|ref|YP_003767079.1| RecB family exonuclease [Amycolatopsis mediterranei U32]
 gi|299796302|gb|ADJ46677.1| putative RecB family exonuclease [Amycolatopsis mediterranei U32]
          Length = 299

 Score =  147 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 37/259 (14%), Positives = 71/259 (27%), Gaps = 39/259 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  +     GT  H++L             +  + 
Sbjct: 26  LSPSRASDFKQCPLLYRFRAVDRLPEVPTKAQLRGTLVHSVLERLFALPAAERVPAQARE 85

Query: 65  TFENDTRIVDTEMASS------------------VSMVLAYVRTFSGPFLSE---TEVPL 103
                   +  +                         +L        P   E    E+ +
Sbjct: 86  LLGPAWTDLSADRPEWTELFDGEKPDDHADWLRSAEKLLDAYFELEDPRRLEPEACELHV 145

Query: 104 EPFTT-EPGATGTADILIFNS-TQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYG 159
           E          G  D L      +  +VD+K GA      +A+   Q+  YA       G
Sbjct: 146 EIELGSGVLLRGYIDRLDVAPTGEIRVVDYKTGAAPREIGEAKAMFQMKFYAVVLWRLRG 205

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +  + + + LT              +     +LL   +              K   + +
Sbjct: 206 IVPRQLKLMYLT--------DGQSLAYTPDEAELLRFERTL----EAIWQAILKAGKTGD 253

Query: 220 HYGVNDDSCRFCRAKVRCP 238
                   C +C  +  CP
Sbjct: 254 FRANKSKLCNWCDHQAHCP 272


>gi|305680768|ref|ZP_07403575.1| conserved hypothetical protein [Corynebacterium matruchotii ATCC
           14266]
 gi|305658973|gb|EFM48473.1| conserved hypothetical protein [Corynebacterium matruchotii ATCC
           14266]
          Length = 264

 Score =  147 bits (371), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 37/256 (14%), Positives = 71/256 (27%), Gaps = 36/256 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S ++ +++CP+        K+P+  ++    GT  H  L           T      
Sbjct: 8   LSPSRANDYMQCPLLYRFRAIDKLPEPKTVAQVRGTLVHACLEDMHLWERPERTYPAVVK 67

Query: 65  TFENDTRIV---DTEMASSV------SMVLAYVRTFSGPFLSETEVPLEPFT-------- 107
               +   +   D  +   V        ++       G FL E     +           
Sbjct: 68  RLRPNWADMCGEDPSLLELVPEGEVYEFLVGCRSLLKGYFLMENPQGFDALACEKFVDAV 127

Query: 108 --TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKA--ENNTQLMLYACGALHQYGDIF 162
                   G  D +      +  +VD+K G     +   +   Q+  YA       G I 
Sbjct: 128 LPNGVPVRGFIDRVDVAPTGEVRVVDYKTGKKPLPRYSGQAKFQMRFYALVWWRTQGVIP 187

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            +   + L +                S ++L    ++  +     L        +     
Sbjct: 188 HQLRLMYLKVADSLY--------LAPSREELEFFERDLGDLWGKILGDI----SAGVFRA 235

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  +  CP
Sbjct: 236 KTSKLCGWCPHQRLCP 251


>gi|326780309|ref|ZP_08239574.1| hypothetical protein SACT1_6184 [Streptomyces cf. griseus
           XylebKG-1]
 gi|326660642|gb|EGE45488.1| hypothetical protein SACT1_6184 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 281

 Score =  147 bits (371), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 35/251 (13%), Positives = 67/251 (26%), Gaps = 40/251 (15%)

Query: 16  LKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           ++CP+        K+P+  S  A+ GT  H +L    +      T    +         +
Sbjct: 1   MQCPLLYRFRVIDKLPEKPSEAATRGTLVHAVLERLFDAPAADRTAPRARALIPGQWDRL 60

Query: 74  DT-------------------EMASSVSMVLAYVRTFSGPFLS---ETEVPLEPFTT-EP 110
                                        ++    +   P      E E+ +E       
Sbjct: 61  LESKPELSDLFAGDTEGERLTRWLGEAERLVDRWFSLEDPTRLEPAERELFVETELESGL 120

Query: 111 GATGTADILIFNS-TQWIIVDFKYGAGVPVKAENNT--QLMLYACGALHQYGDIFGRPEA 167
              G  D +      +  IVD+K G     +  +    Q+  YA       G +  R + 
Sbjct: 121 RLRGVIDRVDVAPSGEVRIVDYKTGKAPRPEYSDGPLFQMTFYALVIWRLKGVVPRRLQL 180

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + L            +  +     DL    ++            S    + +        
Sbjct: 181 VYL--------GSGDVLTYDPVVADLERVERKLL----ALWDAISLATETGDWRPRPTKL 228

Query: 228 CRFCRAKVRCP 238
           C +C  +  CP
Sbjct: 229 CGWCDHQAVCP 239


>gi|159146272|gb|ABW90599.1| conserved hypothetical protein [Bacteriophage APSE-2]
          Length = 271

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 71/259 (27%), Positives = 112/259 (43%), Gaps = 31/259 (11%)

Query: 53  GVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP--FLSETEVPLEPFTTEP 110
           G DA+         + ++  VD EM   V   +  V   +       E  V         
Sbjct: 17  GFDAKEYIGTYPLLKVNSPQVDEEMIEHVQTYIDTVWQLANGKMLQVEERVDFSAVIGVD 76

Query: 111 GATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTL 170
            + GTAD +I +S +  I D KYG GV V A+NN QLMLYA GALHQ+  ++   + + L
Sbjct: 77  NSFGTADAIIVSSDELQIHDLKYGKGVKVDAQNNEQLMLYALGALHQFDLVYDF-KTVRL 135

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLK------SKRAVSLEHYGVN 224
            I QPR+     ++EW +S +DL +     + R   A+ +          A+    +   
Sbjct: 136 FIHQPRLN---HLSEWAVSVEDLKDFGDLARLRAQKAMEMTSLAERNGLDALPDSAFSPG 192

Query: 225 DDSCRFCRAK-VRCPALSRHV------------------LLEATKDPSTNTTVELSKAYS 265
              C FC+AK   C A ++ V                  L +A K  +  T  +++K Y 
Sbjct: 193 VKQCLFCKAKGGLCFAQAQFVHNEVKGDFVDLTQPLASQLSDAPKRITLLTPEQMAKLYP 252

Query: 266 SISLIKSYVKACEDEMFKR 284
            + LI+S+ KA  + + + 
Sbjct: 253 HVDLIESFCKALRNRVAEA 271


>gi|295395902|ref|ZP_06806087.1| exodeoxyribonuclease V beta subunit [Brevibacterium mcbrellneri
           ATCC 49030]
 gi|294971175|gb|EFG47065.1| exodeoxyribonuclease V beta subunit [Brevibacterium mcbrellneri
           ATCC 49030]
          Length = 278

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 46/258 (17%), Positives = 77/258 (29%), Gaps = 37/258 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S ++ ++ CP+        KIP+  S  A +GT  H +L    +      T+ H   
Sbjct: 7   LSPSRANDFVSCPLKFRFRSVDKIPEPPSAAAFKGTLVHAVLEQLFDVPSRERTLDHATT 66

Query: 65  TFENDTRIVDTE---MASSVSMVLAYVRTFSG-------PFLSETEVPLEPFT------- 107
             +     +  E   +           R FS         F  E    LEP         
Sbjct: 67  LIKPTYASLAQENSDVPDLFPEQTDRDRLFSESQALVRAYFALELPQNLEPDAREKFVQT 126

Query: 108 ---TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDI 161
                    G  D +      +  +VD+K G     +     + Q+  YA       G+ 
Sbjct: 127 VLPGGLKLRGFIDRVDRAPGGEVRLVDYKTGKAPKPQYSGDADFQMRFYALVHYLLTGET 186

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
               + + L            + E   +  D+     +  +      +  +  A S    
Sbjct: 187 VHTLQLMYL--------GSGNVKELQPTMQDIQRTFFQVAD----VWNDITGCAESGNWR 234

Query: 222 GVNDDSCRFCRAKVRCPA 239
                 C +C  K  CPA
Sbjct: 235 PKKSPLCNWCYFKNLCPA 252


>gi|159146266|gb|ABW90596.1| conserved hypothetical protein [Bacteriophage APSE-2]
 gi|159146268|gb|ABW90597.1| conserved hypothetical protein [Bacteriophage APSE-2]
 gi|159146270|gb|ABW90598.1| conserved hypothetical protein [Bacteriophage APSE-2]
          Length = 271

 Score =  147 bits (370), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 70/259 (27%), Positives = 111/259 (42%), Gaps = 31/259 (11%)

Query: 53  GVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGP--FLSETEVPLEPFTTEP 110
           G DA+         + ++  VD EM   V   +  V   +       E  V         
Sbjct: 17  GFDAKEYIGTYPLLKANSPQVDEEMIEHVQTYIDTVWQLANGKMLQVEERVDFSAVIGVD 76

Query: 111 GATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTL 170
            + GTAD +I +S +  I D KYG GV V A+NN QLMLYA GAL Q+  ++    ++ L
Sbjct: 77  NSFGTADAIIVSSDELQIHDLKYGKGVKVDAQNNEQLMLYALGALQQFDLVYDF-NSVRL 135

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLK------SKRAVSLEHYGVN 224
            I QPR+     ++EW +S +DL +     + R   A+ +          A+    +   
Sbjct: 136 FIHQPRLN---HLSEWAVSVEDLKDFGDLARLRAQKAMEMTSLAERSGLDALPDSAFSPG 192

Query: 225 DDSCRFCRAK-VRCPALSRHV------------------LLEATKDPSTNTTVELSKAYS 265
              C FC+AK   C A ++ V                  L +A K  +  T  +++K Y 
Sbjct: 193 AKQCLFCKAKGGLCFAQAQFVHNEVKGDFVDLTQPLAPQLSDAPKRITLLTPEQMAKLYP 252

Query: 266 SISLIKSYVKACEDEMFKR 284
            + LI+S+ KA  + + + 
Sbjct: 253 HVDLIESFCKALRNRVAEA 271


>gi|319949274|ref|ZP_08023354.1| RecB family exonuclease [Dietzia cinnamea P4]
 gi|319437064|gb|EFV92104.1| RecB family exonuclease [Dietzia cinnamea P4]
          Length = 303

 Score =  146 bits (369), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 34/256 (13%), Positives = 66/256 (25%), Gaps = 35/256 (13%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LSAS +  + +CP+   L    ++P+  +     GT  H++L                  
Sbjct: 26  LSASRASDYRQCPLLYRLRAVDRVPEPKTRAQVLGTVVHSVLEELYGLEQSERAPQRAAD 85

Query: 65  TFENDTRIVDTEMA--------SSVSMVLAYVRTFSGPFLSETEVPLEP----------F 106
                      E                       +  +  E      P           
Sbjct: 86  LVPAAVERFYAEEDGATVVPLSDRADFQAQVAALVAALYGVEDPQRFSPASCEQYLVTAT 145

Query: 107 TTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIFG 163
                  G  D +      +  +VD+K G     + ++    Q+  YA      +G +  
Sbjct: 146 AAGTPLHGFLDRVDVAPTGEVRVVDYKTGKPPHPRFQDQAMFQMRFYALMYQRIHGVLPA 205

Query: 164 RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
           + + + L               +      L+E             S   +   + +    
Sbjct: 206 QLKLIYL--------KNGSWLTFTPDHASLVETEASL----DALWSEIERAGQTGDFRPR 253

Query: 224 NDDSCRFCRAKVRCPA 239
               C +C  +  CPA
Sbjct: 254 TSRLCDWCNHQALCPA 269


>gi|320011732|gb|ADW06582.1| hypothetical protein Sfla_5183 [Streptomyces flavogriseus ATCC
           33331]
          Length = 279

 Score =  145 bits (366), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/251 (13%), Positives = 65/251 (25%), Gaps = 40/251 (15%)

Query: 16  LKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           ++CP+        ++P+  S  A+ GT  H +L    +      TV   K         +
Sbjct: 1   MQCPLLYRFRVIDRLPEKPSEAATRGTLVHAVLERLFDAPAADRTVPGAKALIPGQWDRL 60

Query: 74  DTEMASS-------------------VSMVLAYVRTFSGPFLS---ETEVPLEPFTT-EP 110
                                        ++    +   P      E E+ +E       
Sbjct: 61  LESKPELTELFDGDPEGERLAGWLGEAERLVERWFSLEDPTRLEPAERELFVETELDSGL 120

Query: 111 GATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIFGRPEA 167
              G  D +      +  IVD+K G     +       Q+  YA         +  R + 
Sbjct: 121 RLRGVIDRVDVAPTGEVRIVDYKTGKAPRPEYAEGALFQMKFYALVVWRLKNVVPRRLQL 180

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + L            +  +     DL    ++                 + E        
Sbjct: 181 VYL--------GSGDVLTYDPVPADLERVERKLL----ALWEAIRLATETGEWRPRPTKL 228

Query: 228 CRFCRAKVRCP 238
           C +C  +  CP
Sbjct: 229 CGWCDHRAVCP 239


>gi|297161878|gb|ADI11590.1| RecB family exonuclease [Streptomyces bingchenggensis BCW-1]
          Length = 266

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/254 (14%), Positives = 72/254 (28%), Gaps = 43/254 (16%)

Query: 16  LKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           ++CP+        K+P+  S  A+ GT  H +L    +      T    +     +   +
Sbjct: 1   MQCPLLYRFRVIDKLPEKPSAAATRGTVVHAVLERLFDAPAAERTAPRARSMVPGEWERL 60

Query: 74  ----------------------DTEMASSVSMVLAYVRTFSGPFLS---ETEVPLEPFT- 107
                                   +  +    ++    +   P      E E+ +E    
Sbjct: 61  LKARPELTELFRTEDGAEEPERLEQWLADAERLVEQWFSLEDPTRLEPAERELYVETKLE 120

Query: 108 TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVK--AENNTQLMLYACGALHQYGDIFGR 164
                 G  D +      +  IVD+K G     +  A    Q+  YA       G +  R
Sbjct: 121 GGLTLRGYIDRVDVAPSGEVRIVDYKTGKAPAPQYAAGALFQMKFYALVLWRLRGAVPRR 180

Query: 165 PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVN 224
            + + L            +  +     DLL   ++ +          S+   +       
Sbjct: 181 LQLVYL--------GSGDVLTYDPDESDLLAVERKVR----ALWEAISQAMETGVFLPRR 228

Query: 225 DDSCRFCRAKVRCP 238
              C +C  +  CP
Sbjct: 229 TKLCGWCDHQAHCP 242


>gi|302518122|ref|ZP_07270464.1| RecB family exonuclease [Streptomyces sp. SPB78]
 gi|318059110|ref|ZP_07977833.1| RecB family exonuclease [Streptomyces sp. SA3_actG]
 gi|318079114|ref|ZP_07986446.1| RecB family exonuclease [Streptomyces sp. SA3_actF]
 gi|302427017|gb|EFK98832.1| RecB family exonuclease [Streptomyces sp. SPB78]
          Length = 278

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/264 (13%), Positives = 65/264 (24%), Gaps = 53/264 (20%)

Query: 16  LKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           ++CP+        ++P+  S  A+ GT  H +L    +      T              +
Sbjct: 1   MQCPLLYRFRVIDRLPEKPSEAATRGTLVHAVLERLFDAPAAERTAERATALLPGQWEKL 60

Query: 74  DTEMASS-------------------------------VSMVLAYVRTFSGPFLS---ET 99
                                                    ++    T   P      E 
Sbjct: 61  RAARPELDALFTAVAAADGDGDGAEGTAGERLARWLASAERLVERWFTLEDPTRLEPAER 120

Query: 100 EVPLEPFTT-EPGATGTADILIFNSTQ--WIIVDFKYGAGVPVKAEN--NTQLMLYACGA 154
           E+ +E          G  D +          IVD+K G     +       Q+  YA   
Sbjct: 121 EMFVETSLDSGLRLRGIIDRVDIAPGTGDVRIVDYKTGKAPRPQYAEGALFQMKFYALVV 180

Query: 155 LHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKR 214
               G +  R + + L            +  +     DL    +  + +         + 
Sbjct: 181 WRLKGVVPRRLQLVYL--------GSGDVLAYDPVPGDL----ERVERKLHALWRAIEEA 228

Query: 215 AVSLEHYGVNDDSCRFCRAKVRCP 238
             S +        C +C  +  CP
Sbjct: 229 TASGDWRPRPSKLCGWCDHRAVCP 252


>gi|326440246|ref|ZP_08214980.1| RecB family exonuclease [Streptomyces clavuligerus ATCC 27064]
          Length = 264

 Score =  144 bits (364), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 32/251 (12%), Positives = 66/251 (26%), Gaps = 40/251 (15%)

Query: 16  LKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           ++CP+        ++P+  S  A+ GT  H +L    +      T    +         +
Sbjct: 1   MQCPLLYRFRVIDRLPERPSAAATRGTLVHAVLERLFDAPAAERTAGRARSLVPGQWDRL 60

Query: 74  DTEMASS-------------------VSMVLAYVRTFSGPFLS---ETEVPLEPFTT-EP 110
             +                          ++    +   P      E E+ +E       
Sbjct: 61  LADRPELGGLFEGDTGGERLAGWLAEAEALVERWFSLEDPTRLEPAEREMFVEVGLDSGL 120

Query: 111 GATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIFGRPEA 167
              G  D +      +  IVD+K G     +       Q+  YA         +  R + 
Sbjct: 121 RLRGVIDRVDVAPTGEVRIVDYKTGKAPRPEYSEGALFQMHFYALVIWRLKKVVPRRLQL 180

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + L            +  +     DL    ++             +   + +        
Sbjct: 181 VYL--------GSGDVLTYDPVPADLERVERKLL----ALWDAIRRATETGDWRPRPTKL 228

Query: 228 CRFCRAKVRCP 238
           C +C  +  CP
Sbjct: 229 CGWCDHQAVCP 239


>gi|315655323|ref|ZP_07908223.1| exodeoxyribonuclease V beta subunit [Mobiluncus curtisii ATCC
           51333]
 gi|315656764|ref|ZP_07909651.1| exodeoxyribonuclease V beta subunit [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
 gi|315490263|gb|EFU79888.1| exodeoxyribonuclease V beta subunit [Mobiluncus curtisii ATCC
           51333]
 gi|315492719|gb|EFU82323.1| exodeoxyribonuclease V beta subunit [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
          Length = 285

 Score =  144 bits (364), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/256 (16%), Positives = 81/256 (31%), Gaps = 35/256 (13%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LSASS+ ++ +CP+    +   K+P+  S  A  G+  H +L    +           + 
Sbjct: 15  LSASSAKQFQQCPLKWRFKYVDKLPEPQSPAALRGSLVHKVLEDMFDLPPAERQAPTVRE 74

Query: 65  TFENDTRIVDT---------------EMASSVSMVLAYVRTFSGPFLS---ETEVPLE-P 105
           T +     V                 E+ ++   ++    +   P        E+ +E  
Sbjct: 75  TVDRAWEKVTDGAYKLSEVLAQTSEQELKAAARQLIDAYFSLEDPRRLHPSGRELGVETV 134

Query: 106 FTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
            ++     G  D +         I+D+K G    ++       Q+ LYA     QY    
Sbjct: 135 LSSGLRLRGFIDRVEQAGNGDVRIIDYKTGKAPDMRFTGEYVFQMRLYALLYREQYRVTP 194

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            R + L L            +  +  +  ++ +   E         S  +    +     
Sbjct: 195 KRTQLLFL-------GGNPQVLTFDPTDANVDDFTAEI----NALWSDIAAHLQANHFET 243

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  +  CP
Sbjct: 244 RKSRLCDWCYFQNLCP 259


>gi|304389518|ref|ZP_07371481.1| RecB family exonuclease [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|304327328|gb|EFL94563.1| RecB family exonuclease [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
          Length = 285

 Score =  144 bits (363), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 42/256 (16%), Positives = 82/256 (32%), Gaps = 35/256 (13%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LSASS+ ++ +CP+    +   K+P+  S  A  G+  H +L    +           + 
Sbjct: 15  LSASSAKQFQQCPLKWRFKYVDKLPEPQSPAALRGSLVHKVLEDMFDLPPAERQAPTVRE 74

Query: 65  TFENDTRIVDT---------------EMASSVSMVLAYVRTFSGPFLS---ETEVPLE-P 105
           T +     V                 E+ ++   ++    +   P        E+ +E  
Sbjct: 75  TVDRAWEKVTDGAYKLSEVLAQTSEQELKAAARQLIDAYFSLEDPRRLHPSGRELGVETV 134

Query: 106 FTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIF 162
            ++     G  D +         I+D+K G    ++       Q+ +YA     QY    
Sbjct: 135 LSSGLRLRGFIDRVEQAGNGDVRIIDYKTGKAPDMRFTGEYVFQMRMYALLYREQYRVTP 194

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            R + L L            +  +  +  ++ E A E         S  +    +     
Sbjct: 195 KRTQLLFL-------GGNPQVLTFDPTDANVDEFAAEI----NALWSDIAAHLHANRFET 243

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  +  CP
Sbjct: 244 RKSRLCDWCYFQNLCP 259


>gi|15827680|ref|NP_301943.1| hypothetical protein ML1312 [Mycobacterium leprae TN]
 gi|221230157|ref|YP_002503573.1| hypothetical protein MLBr_01312 [Mycobacterium leprae Br4923]
 gi|4200265|emb|CAA22922.1| hypothetical protein MLCB2533.08c [Mycobacterium leprae]
 gi|13093231|emb|CAC31693.1| conserved hypothetical protein [Mycobacterium leprae]
 gi|219933264|emb|CAR71407.1| conserved hypothetical protein [Mycobacterium leprae Br4923]
          Length = 294

 Score =  144 bits (363), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 42/261 (16%), Positives = 76/261 (29%), Gaps = 41/261 (15%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  + +CP+        ++P+  S     G+  H  L                + 
Sbjct: 19  LSPSRAADFKQCPLLYRFRAIDRLPEAPSAAQLLGSVVHTTLQRLYGLPALRRCSDTARS 78

Query: 65  TFENDTRIV---------------DTEMASSVSMVLAYVRTFSGPFL-----SETEVPLE 104
             E+    +                T++      +L+       P        E  V +E
Sbjct: 79  LVESVWNQMIAAERDLDGELDAKQRTQLLDEARTLLSGYYRLEDPTRFNPQSCEQRVEVE 138

Query: 105 PFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVP-----VKAENNTQLMLYACGALHQY 158
                    G  D +   +  +  +VD+K G   P      + +   Q+  YA   LH  
Sbjct: 139 L-ADGLLLRGFIDRIDVAATGELRVVDYKTGKAPPAAQALAEFKAMFQMKFYALTLLHSR 197

Query: 159 GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
           G +  R   + L          S + ++    D+LL   K                  + 
Sbjct: 198 GVLPARLRLIYLA--------DSQLLDYAPDRDELLRFGKTLM----AIWRTIQFSGETG 245

Query: 219 EHYGVNDDSCRFCRAKVRCPA 239
           +        C +C  +  CPA
Sbjct: 246 DFRPNPSRLCGWCPHQEHCPA 266


>gi|256788739|ref|ZP_05527170.1| hypothetical protein SlivT_29982 [Streptomyces lividans TK24]
 gi|289772633|ref|ZP_06532011.1| conserved hypothetical protein [Streptomyces lividans TK24]
 gi|289702832|gb|EFD70261.1| conserved hypothetical protein [Streptomyces lividans TK24]
          Length = 268

 Score =  143 bits (361), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 32/251 (12%), Positives = 66/251 (26%), Gaps = 40/251 (15%)

Query: 16  LKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           ++CP+        ++P+  S  A+ GT  H +L    +      T    +         +
Sbjct: 1   MQCPLLYRFRVIDRLPEKPSEAATRGTLVHAVLERLFDAPAAERTAPTARALVPGQWDRL 60

Query: 74  DT-------------------EMASSVSMVLAYVRTFSGPFLS---ETEVPLEPFTT-EP 110
                                +  +    ++    +   P      E E+ +E       
Sbjct: 61  RESRPEVGELFADDPEGERLAQWLAEAERLVERWFSLEDPSRLEPAERELFVEAELDSGL 120

Query: 111 GATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIFGRPEA 167
              G  D +      +  IVD+K G     +       Q+  YA         +  R + 
Sbjct: 121 RLRGIIDRVDVAPTGEVRIVDYKTGKAPRPQYAEGALFQMKFYALVVWRLKKVVPRRLQL 180

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + L            +  +     DL    ++                 + +        
Sbjct: 181 VYL--------GSGDVLTYDPVLADLERVERKLL----ALWEAIRLATETGDWRPRPTKL 228

Query: 228 CRFCRAKVRCP 238
           C +C  +  CP
Sbjct: 229 CGWCDHQAHCP 239


>gi|282864346|ref|ZP_06273402.1| RecB family exonuclease-like protein [Streptomyces sp. ACTE]
 gi|282560833|gb|EFB66379.1| RecB family exonuclease-like protein [Streptomyces sp. ACTE]
          Length = 281

 Score =  143 bits (361), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 34/251 (13%), Positives = 65/251 (25%), Gaps = 40/251 (15%)

Query: 16  LKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           ++CP+        ++P+  S  A+ GT  H +L    +      T    K         +
Sbjct: 1   MQCPLLYRFRVIDRLPEKPSEAATRGTLVHAVLERLFDAPAAERTAPRAKALIPGQWDRL 60

Query: 74  DTEMASS-------------------VSMVLAYVRTFSGPFLS---ETEVPLEPFTT-EP 110
                                        ++    +   P      E E+ +E       
Sbjct: 61  LESKPELTELFAGDPEGERLAGWLGEAERLVERWFSLEDPTRLEPAEREMFVETELDSGL 120

Query: 111 GATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIFGRPEA 167
              G  D +      +  IVD+K G     +       Q+  YA   +     +  R + 
Sbjct: 121 RLRGVIDRVDVAPTGEVRIVDYKTGKAPRPEYAEGALFQMKFYALVIMRLRKVVPRRLQL 180

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + L            +  +     DL    ++                 + E        
Sbjct: 181 VYL--------GSGDVLTYDPVPADLERVERKLL----ALWDAIRLATETGEWRPRPTKL 228

Query: 228 CRFCRAKVRCP 238
           C +C  +  CP
Sbjct: 229 CGWCDHQSVCP 239


>gi|48697543|ref|YP_024901.1| gp67 [Burkholderia phage BcepB1A]
 gi|47717513|gb|AAT37759.1| gp67 [Burkholderia phage BcepB1A]
          Length = 370

 Score =  143 bits (360), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 81/383 (21%), Positives = 133/383 (34%), Gaps = 39/383 (10%)

Query: 6   FLSASSSHRWLKCPIAPTLESKIPQTTSIYAS-EGTFAHNLLAHCLEQGVDAETVSHQKL 64
            L AS +HRW+KC     +    P  +      EGT  H      L   +       Q++
Sbjct: 4   LLRASQAHRWVKCTAWSLMSRGQPDISDPTVRDEGTAFHWCA---LMIWLGHVINVGQRV 60

Query: 65  TFENDTRI--VDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
             +       V  EM   V   L  +R+  G  + E EV        P   GT D   F 
Sbjct: 61  QLDGMASAVVVTDEMLDHVDEYLDRIRSRGGRPMLEYEV--AAPRIHPECGGTTDSWNFV 118

Query: 123 ST--QWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR-VRT 179
                  + D KYG    V    N QL++Y CG L   G +  R   + +++ QPR  R 
Sbjct: 119 PEKMTLYVDDAKYGY-RWVDPYQNWQLLVYVCGLLDHIGVVDDRHIKVEMSVFQPRAYRR 177

Query: 180 GSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA 239
             P   W  +A DL              LS  +K         +  + C  C A+  C A
Sbjct: 178 DGPWFVWHANAADLRTYFNVLSNAAHTVLSPFAK--------CITGEWCTNCDARANCDA 229

Query: 240 --LSRHVLLEATKDPSTNT------TVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEI 291
              +    L+ + +P  N         EL +   ++ ++++   A        +  G ++
Sbjct: 230 YDQAVENALDVSFEPINNDLSPIRADTELLRIERAMQILEARQSALMARAEMFMRDGQQL 289

Query: 292 QGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEE 351
           + Y++  GR     +K     +  L  +     FK    TP +   +   + +  +  + 
Sbjct: 290 RHYEMKPGR-SRPIWK--PGIEASLKQMGV--PFKERPITPTQ---VRDRKLLDPKVIDA 341

Query: 352 LQELITRGDGKPVIAPRDIPTNK 374
           L +   R      +A  D     
Sbjct: 342 LSD---RPPAGLKVARVDEERAA 361


>gi|284991128|ref|YP_003409682.1| hypothetical protein Gobs_2676 [Geodermatophilus obscurus DSM
           43160]
 gi|284064373|gb|ADB75311.1| conserved hypothetical protein [Geodermatophilus obscurus DSM
           43160]
          Length = 320

 Score =  142 bits (359), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 37/267 (13%), Positives = 71/267 (26%), Gaps = 47/267 (17%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LS S +  +  CP+        ++P+  S+ A  GT  H++L    +      T    + 
Sbjct: 38  LSPSRAADFKTCPLLYRFRTIDRLPERKSLAAVRGTLVHSVLERLYDLPARRRTAEAARE 97

Query: 65  TFENDTRIVD--------------------------TEMASSVSMVLAYVRTFSGPFLSE 98
                   +                               +S   ++    +   P   E
Sbjct: 98  LVAPAWEELRANPEVAALFTEGGTGDDAAAEQPPSLEAWLASAGELVETYFSLEDPSRIE 157

Query: 99  ---TEVPLEPFT-TEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYA 151
               E  +E          G  D L         +VD+K G+      E     Q+  YA
Sbjct: 158 PHGREELVEVTLPDGLLLRGYVDRLDVAPNGALRVVDYKTGSMPREAFEGKALFQMKFYA 217

Query: 152 CGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLK 211
                  G +  + + L L               +     +L+   +          +  
Sbjct: 218 LVLWRTRGVVASQLKLLYL--------GNGDALTYAPEEAELVRFERTL----QAIWAAI 265

Query: 212 SKRAVSLEHYGVNDDSCRFCRAKVRCP 238
            +   + +        C +C  +  CP
Sbjct: 266 ERAVATGDFRPNRTRLCDWCDHQALCP 292


>gi|320532645|ref|ZP_08033442.1| hypothetical protein HMPREF9057_01317 [Actinomyces sp. oral taxon
           171 str. F0337]
 gi|320135139|gb|EFW27290.1| hypothetical protein HMPREF9057_01317 [Actinomyces sp. oral taxon
           171 str. F0337]
          Length = 261

 Score =  139 bits (351), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 40/248 (16%), Positives = 63/248 (25%), Gaps = 37/248 (14%)

Query: 16  LKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           ++CP+   L    ++P+  S+   +GT  H +L    +                      
Sbjct: 1   MQCPLMFRLRTVDRLPEPGSLATHKGTVVHGVLERLYDLPASDRRPEAALDLLPEQWASH 60

Query: 74  DT---------EMASSVSMVLAYVRTF-SGPFLSETEVPLEP----------FTTEPGAT 113
                      E AS V   L   R      F  E    LEP                  
Sbjct: 61  REKNPEVMDLFEDASRVETWLEEARGLIRTYFTLENPQRLEPADRELFVQTETGDGLLLR 120

Query: 114 GTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIFGRPEALTL 170
           G  D L         +VD+K G     +   +   Q+  YA       G    R + + L
Sbjct: 121 GFVDRLDVAPDGAMRVVDYKTGRSPGTRFMEDALFQMRFYALVLWRLRGRAPARLQLVYL 180

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRF 230
                       +        +L         R           A +          C +
Sbjct: 181 --------KDGRVLTHDPRLPELERTE----TRLMHLWDEVEDCARTGFFRPRRSRLCDW 228

Query: 231 CRAKVRCP 238
           C  + +CP
Sbjct: 229 CAFQAQCP 236


>gi|329946807|ref|ZP_08294219.1| hypothetical protein HMPREF9056_02122 [Actinomyces sp. oral taxon
           170 str. F0386]
 gi|328526618|gb|EGF53631.1| hypothetical protein HMPREF9056_02122 [Actinomyces sp. oral taxon
           170 str. F0386]
          Length = 261

 Score =  139 bits (349), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/248 (16%), Positives = 64/248 (25%), Gaps = 37/248 (14%)

Query: 16  LKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           ++CP+   L    ++P+  S+   +GT  H +L    +  V    V              
Sbjct: 1   MQCPLMFRLRTVDRLPEPGSLATHKGTVVHGVLERLYDLPVSERRVEVALELLPGQWESH 60

Query: 74  DT---------EMASSVSMVLAYVRTF-SGPFLSETEVPLEP----------FTTEPGAT 113
                      E  + V   L   R      F  E    LEP           +      
Sbjct: 61  REKSPEVMGLFEDPTQVETWLEEARGLIRTYFTLENPQRLEPAERELFVQAETSDGLLLR 120

Query: 114 GTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIFGRPEALTL 170
           G  D L         +VD+K G     +       Q+  YA       G    R + + L
Sbjct: 121 GFVDRLDVAPDGAMRVVDYKTGRSPGTRFVEEALFQMRFYALVLWRLRGRAPTRLQLVYL 180

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRF 230
                       +        +L         R T         A +          C +
Sbjct: 181 --------KDGRVLTHDPRLAELERTE----TRLTHLWDEVEDCARTGSFRPQRSRLCDW 228

Query: 231 CRAKVRCP 238
           C    +CP
Sbjct: 229 CAFHAQCP 236


>gi|239940108|ref|ZP_04692045.1| hypothetical protein SrosN15_03853 [Streptomyces roseosporus NRRL
           15998]
          Length = 277

 Score =  138 bits (348), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 32/244 (13%), Positives = 62/244 (25%), Gaps = 38/244 (15%)

Query: 21  APTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDT----- 75
              +  K+P+  S  A+ GT  H +L    +      T    +         +       
Sbjct: 4   RFRVIDKLPEKPSEAATRGTLVHAVLERLFDVPAADRTAPRARALIPGQWDRLLESKPEL 63

Query: 76  --------------EMASSVSMVLAYVRTFSGPFLS---ETEVPLEPFTT-EPGATGTAD 117
                                 ++    +   P      E E+ +E          G  D
Sbjct: 64  SDLFAGDSEGERLTRWLGEAERLVDRWFSLEDPTRLEPAEREMFVETELESGLRLRGVID 123

Query: 118 ILIFNS-TQWIIVDFKYGAGVPVKAENNT--QLMLYACGALHQYGDIFGRPEALTLTIIQ 174
            +      +  IVD+K G     +  +    Q+  YA       G +  R + + L    
Sbjct: 124 RVDIAPSGEVRIVDYKTGKAPRPEYSDGPLFQMTFYALVIWRLKGVVPRRLQLVYL---- 179

Query: 175 PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
                   +  +     DL    ++                 + +        C +C  +
Sbjct: 180 ----GSGDVMTYDPVVADLERVERKLL----ALWDAIRLATETGDWRPRPTKLCGWCDHQ 231

Query: 235 VRCP 238
             CP
Sbjct: 232 AVCP 235


>gi|294628485|ref|ZP_06707045.1| RecB family exonuclease [Streptomyces sp. e14]
 gi|292831818|gb|EFF90167.1| RecB family exonuclease [Streptomyces sp. e14]
          Length = 262

 Score =  136 bits (342), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 33/244 (13%), Positives = 62/244 (25%), Gaps = 38/244 (15%)

Query: 21  APTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASS 80
              +  ++P+  S  A+ GT  H +L    +      T    K         +       
Sbjct: 4   RFRVIDRLPEKPSEAATRGTLVHAVLERLFDAPAAERTPPRAKALIPGQWDRLRASRPEL 63

Query: 81  VSMV-------------------LAYVRTFSGPFLS---ETEVPLEPFTT-EPGATGTAD 117
           V +                    +    T   P      E E+ +E          G  D
Sbjct: 64  VELFADDADGERLARWLSEAERLVERWFTLEDPSRLEPAERELFVEAELASGLRLRGIID 123

Query: 118 ILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIFGRPEALTLTIIQ 174
            +      +  IVD+K G     +       Q+  YA         +  R + + L    
Sbjct: 124 RVDVAPTGEVRIVDYKTGKAPRPEYAEGALFQMKFYALVVWRLKKVVPRRLQLVYL---- 179

Query: 175 PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
                   +  +     DL    +  + +             + +        C +C  +
Sbjct: 180 ----GSGDVLTYDPVPADL----ERIERKLHALWEAIRLATETGDWRPRPTKLCGWCDHR 231

Query: 235 VRCP 238
             CP
Sbjct: 232 AHCP 235


>gi|315604158|ref|ZP_07879224.1| RecB family exonuclease [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315313864|gb|EFU61915.1| RecB family exonuclease [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 294

 Score =  135 bits (340), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/257 (14%), Positives = 72/257 (28%), Gaps = 38/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LSAS +  + +CP+   L       +  S   + GT  H +L         + T    + 
Sbjct: 28  LSASRAKEYERCPLQYRLHVVDGYREPESRAKALGTLVHAVLEDLFSLPPRSRTRDAARA 87

Query: 65  TFENDTRIVDTEMASSV---------SMVLAYVRT-FSGPFLSETEVPLEP--------- 105
                   +  +                 L   R+   G F  E    + P         
Sbjct: 88  QLAPAFEALTQKNPEVAALFGDEADREAWLEDARSVVDGYFAIEQPQWIAPAAREARVTA 147

Query: 106 -FTTEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDI 161
                    G  D +      +  +VD+K G     +  +    Q+  YA   L +   +
Sbjct: 148 TTKGGVRLLGFIDRVDRAPDGRLRVVDYKTGKAPSPRYVDEALFQMRFYAL-LLARTQVL 206

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
             R + + L   Q        +  +     D+ +  +    R         +   +    
Sbjct: 207 PSRMQLVYLRAGQ--------VITFDPDPTDVADFER----RIDQLWGRIEEDLANDSFQ 254

Query: 222 GVNDDSCRFCRAKVRCP 238
              +  C +C  +  CP
Sbjct: 255 PRKNPLCNWCGVRSLCP 271


>gi|296392993|ref|YP_003657877.1| UvrD/REP helicase [Segniliparus rotundus DSM 44985]
 gi|296180140|gb|ADG97046.1| UvrD/REP helicase [Segniliparus rotundus DSM 44985]
          Length = 1025

 Score =  135 bits (339), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/247 (17%), Positives = 80/247 (32%), Gaps = 22/247 (8%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLL-------AHCLEQGVDAETV 59
            LS S   + L CP+    E  +P      A+ GT  H L           L+  +DA   
Sbjct: 772  LSPSRVQQLLDCPLRWLFERAMPAAPGEAAAIGTAVHLLASVADRFPEDELQAALDAAAR 831

Query: 60   SHQKLTFENDT--RIVDTEMASSVSMVLAYVRTFSGPFL-SETEVPLEPFTTEPGATGTA 116
            +  + +       +    ++A   +  +A+     G       E+P+E   +     G  
Sbjct: 832  AADERSARPPWAAQRRREQLARLFAAFMAWRNASRGELTQVGVEIPVEMSVSGVTLRGRI 891

Query: 117  DILIF-NSTQWIIVDFKYGAGVPVKA--ENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
            D L      + +IVD K  A     A    + QL  Y         +     + + L   
Sbjct: 892  DRLERTARGELVIVDLKTAATPRSAASVREDPQLACYQLVVRMARDEPVAGGKLVYLGA- 950

Query: 174  QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
              +    +   +  ++ ++  +     +E         +  A   +     +  C  C  
Sbjct: 951  LRQETGAAEREQPALTEEEAAQWNSTIREA--------AAAAAGPQFRARPNQHCGSCPG 1002

Query: 234  KVRCPAL 240
            +  CPAL
Sbjct: 1003 RRCCPAL 1009


>gi|320093577|ref|ZP_08025467.1| RecB family exonuclease [Actinomyces sp. oral taxon 178 str. F0338]
 gi|319979475|gb|EFW10947.1| RecB family exonuclease [Actinomyces sp. oral taxon 178 str. F0338]
          Length = 285

 Score =  134 bits (336), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/257 (15%), Positives = 69/257 (26%), Gaps = 38/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTL--ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LSAS +  + +CP+   L       +  +   + GT  H +L           T    + 
Sbjct: 18  LSASRAKEYERCPLQYRLHVIDGYREPATRATAMGTLIHAVLEDLYGLEAPGRTEEAAQE 77

Query: 65  TFENDTRIV----------------DTEMASSVSMVLAYVRTFSGPFLS---ETEVPLEP 105
              +    +                       V  VL        P        E  +E 
Sbjct: 78  MVGDRFEALLRRDPTVGALFDDDGDRQRWLGEVRAVLGQYFAIEDPKWIAPWAREKNVEA 137

Query: 106 FTT-EPGATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDI 161
            T       G  D +      +  +VD+K G     +       Q+  YA   +     +
Sbjct: 138 STRAGVRLRGFIDRIDRAPDGRLRVVDYKTGKAPSPRFTEEALFQMRFYALLLMRTA-VL 196

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
             R + + L             +  V++ D      + F+ER                  
Sbjct: 197 PARMQLVYLK------------SGRVLTLDPFPGDIERFEERVEELWGRIEADVRGDGFA 244

Query: 222 GVNDDSCRFCRAKVRCP 238
              +  C +C  +  CP
Sbjct: 245 PRKNPLCNWCGVRSLCP 261


>gi|293192899|ref|ZP_06609743.1| RecB family exonuclease [Actinomyces odontolyticus F0309]
 gi|292819955|gb|EFF78954.1| RecB family exonuclease [Actinomyces odontolyticus F0309]
          Length = 294

 Score =  133 bits (334), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/257 (14%), Positives = 72/257 (28%), Gaps = 38/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LSAS +  + +CP+   L       +  +   + GT  H +L           T    + 
Sbjct: 28  LSASRAKEYERCPLQYRLHVLDGYREPETRAKALGTIVHAVLEKLFALPAQQRTPEAARG 87

Query: 65  TFENDTRIVDT---------EMASSVSMVLAYVRT-FSGPFLSETEVPLEP--------- 105
                   + +            +     L   R    G F  E    + P         
Sbjct: 88  QVWPQYEALASKNPEVPALFSDDADRDAWLDEARAVVDGYFAIEQPQWIAPAALEQRVTT 147

Query: 106 -FTTEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAENNT--QLMLYACGALHQYGDI 161
             +      G  D +      +  +VD+K G     +  +    QL  YA   L +   +
Sbjct: 148 TTSGGVRLLGFIDRVDRAPDGRLRVVDYKTGKAPGPRYVDEALYQLRFYAL-LLARTQVL 206

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
             R + + L   Q        +  +   A D+    +             ++   +    
Sbjct: 207 PSRMQLVYLKAGQ--------VITFDPEAGDIASFERHI----DQLWDSIARDIENDSFA 254

Query: 222 GVNDDSCRFCRAKVRCP 238
              +  C +C  +  CP
Sbjct: 255 PRKNPLCNWCGVRSLCP 271


>gi|293189191|ref|ZP_06607915.1| putative ATP-dependent DNA helicase [Actinomyces odontolyticus F0309]
 gi|292821863|gb|EFF80798.1| putative ATP-dependent DNA helicase [Actinomyces odontolyticus F0309]
          Length = 1078

 Score =  132 bits (332), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/247 (17%), Positives = 69/247 (27%), Gaps = 25/247 (10%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYAS-EGTFAHNLLAHC-------LEQGVDAE 57
             LS S   R L CP+   L +      S  A+  GT  H +           L + ++A 
Sbjct: 841  VLSPSQFERALACPLRWFLTTIGADAPSNAAASLGTLVHAVAEEHPHGTPEELTEALEAR 900

Query: 58   TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTAD 117
                         R+ D      V+ + +YV    G      E  +          G  D
Sbjct: 901  IEELGYNLDTWAGRVADRHAREIVNNLASYVVGVPGEVTV--EQTVSAEVEGVTIRGRMD 958

Query: 118  ILIFNSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
             L        + D K G           N QL  Y    L          +     I   
Sbjct: 959  RLEQVDEGVRVTDLKTGKSGYTKASVAENPQLAAYQMAMLAS------GEKVAGARIALL 1012

Query: 176  RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV 235
                    ++  +  ++L    +  +E    A     +          + + CR+C    
Sbjct: 1013 GGSKPQIYDQPALQGEELERWRESVREVALSARGPYFEAR-------PSQEVCRYCSFDR 1065

Query: 236  RCPALSR 242
             CPA  R
Sbjct: 1066 LCPARER 1072


>gi|154508756|ref|ZP_02044398.1| hypothetical protein ACTODO_01265 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798390|gb|EDN80810.1| hypothetical protein ACTODO_01265 [Actinomyces odontolyticus ATCC
           17982]
          Length = 284

 Score =  132 bits (331), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/257 (14%), Positives = 72/257 (28%), Gaps = 38/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LSAS +  + +CP+   L       +  +   + GT  H +L           T    + 
Sbjct: 18  LSASRAKEYERCPLQYRLHVLDGYREPETRAKALGTIVHAVLEKLFALPAQQRTPEAARG 77

Query: 65  TFENDTRIVDT---------EMASSVSMVLAYVRT-FSGPFLSETEVPL----------E 104
                   + +            +     L   R   +G F  E    +           
Sbjct: 78  QVWPQYEALASKNPEVPALFSDDADRDAWLDEARAVVNGYFAIEQPQWIAPAALEQRVTT 137

Query: 105 PFTTEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAENNT--QLMLYACGALHQYGDI 161
             +      G  D +      +  +VD+K G     +  +    QL  YA   L +   +
Sbjct: 138 MTSGGVRLLGFIDRVDRAPDGRLRVVDYKTGKAPGPRYVDEALYQLRFYAL-LLARTQVL 196

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
             R + + L   Q        +  +   A D+    +             ++   +    
Sbjct: 197 PSRMQLVYLKAGQ--------VITFDPKAGDIASFERHI----DQLWDSIARDIENDSFV 244

Query: 222 GVNDDSCRFCRAKVRCP 238
              +  C +C  +  CP
Sbjct: 245 PRKNPLCNWCGVRSLCP 261


>gi|154509555|ref|ZP_02045197.1| hypothetical protein ACTODO_02087 [Actinomyces odontolyticus ATCC
            17982]
 gi|153799189|gb|EDN81609.1| hypothetical protein ACTODO_02087 [Actinomyces odontolyticus ATCC
            17982]
          Length = 1078

 Score =  131 bits (329), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 44/247 (17%), Positives = 70/247 (28%), Gaps = 25/247 (10%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYAS-EGTFAHNLLAHC-------LEQGVDAE 57
             LS S   R L CP+   L +      S  A+  GT  H +           L + ++A 
Sbjct: 841  VLSPSQFERALACPLRWFLTTIGADAPSNAAASLGTLVHAVAEEHPHGTPEELTEALEAR 900

Query: 58   TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTAD 117
                         R+ D      V+ + +YV    G      E  +          G  D
Sbjct: 901  IEELGYNLDTWAGRVSDRHAREIVNNLASYVVGVPGEVTV--EQTVSSEVEGVTIRGRMD 958

Query: 118  ILIFNSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
             L        + D K G           N QL  Y    L          +     I   
Sbjct: 959  RLEQVDEGVRVTDLKTGKSGYTKASVAENPQLAAYQMAMLAS------GEKVAGARIALL 1012

Query: 176  RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV 235
                    ++  +  ++L    +  +E    A     +          + ++CR+C    
Sbjct: 1013 GGSKPQIYDQPALQGEELERWRESVREVALSARGPYFEAR-------PSQEACRYCSFDR 1065

Query: 236  RCPALSR 242
             CPA  R
Sbjct: 1066 LCPARER 1072


>gi|227495237|ref|ZP_03925553.1| RecB family exonuclease [Actinomyces coleocanis DSM 15436]
 gi|226831689|gb|EEH64072.1| RecB family exonuclease [Actinomyces coleocanis DSM 15436]
          Length = 281

 Score =  131 bits (329), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/257 (14%), Positives = 70/257 (27%), Gaps = 37/257 (14%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LSA+S+  W +C +   L       +  +   + GT  H +L H  +       +   K 
Sbjct: 12  LSATSTSTWKQCQLKFRLIYLDGFREPPNPVTTRGTLVHAVLEHIYDYQAGMRNLETAKS 71

Query: 65  TFENDTRIVDTEMASS---------VSMVLAYVRTF-SGPFLSETEVPLEPFTT------ 108
                 + +  +             ++  LA V +     F  E    LEP+        
Sbjct: 72  LTAAQYQEMFAKDPEFQAMFTEESALNQWLAEVNSLVESYFQMENPQRLEPYARELLVDA 131

Query: 109 ----EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAENNT--QLMLYACGALHQYGDI 161
                    G  D +         IVD+K G     +   +   Q+  Y+         +
Sbjct: 132 ETSSGIAIRGFIDRIDKAPNGAIRIVDYKTGKSPRPQYMEDKLHQMRFYSLLMRQAGRGV 191

Query: 162 FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
             R + + L               +    + +        +              +   Y
Sbjct: 192 PARTQLVFL--------GDGKTLTFDPQPEQVDAFEHYLTQ----IWQQIEHACNTGNFY 239

Query: 222 GVNDDSCRFCRAKVRCP 238
                 C +C  K  CP
Sbjct: 240 PRKQPLCNWCGVKEMCP 256


>gi|84662668|ref|YP_453632.1| hypothetical protein OP2_ORF15 [Xanthomonas phage OP2]
 gi|84570717|dbj|BAE72779.1| conserved hypothetical protein [Xanthomonas oryzae phage OP2]
          Length = 438

 Score =  130 bits (327), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 68/366 (18%), Positives = 122/366 (33%), Gaps = 42/366 (11%)

Query: 10  SSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFEND 69
           SS +RW KCP +  L  ++   +   A+EGT AH L    +      +         +  
Sbjct: 46  SSRYRWSKCPASALL-PQLRTPSGPAAAEGTEAHKLAEWAMRGEFGEDLPRPAVEPPQGF 104

Query: 70  TRIVDTEMASSVSMVLAYVRT---------------FSGPFLSETEVPLE-PFTTEPGAT 113
               D       S   A VR+                +GP    TE  +E          
Sbjct: 105 DDP-DLYTPEGSSTWQARVRSYAATYAAHAANLFADATGPTKCLTEYKIEGVELYGVKVF 163

Query: 114 GTADILIFNST--QWIIVDFKYGA---GVPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
             AD+ ++N    + +I D+K+G    GV   AE N Q    A    H++         +
Sbjct: 164 TVADVALYNPGIGRLVIGDYKFGRSPVGVGTAAEPNPQCAGAAVLLAHRFPAPPSD---V 220

Query: 169 TLTIIQPRVRTGSPINEWV-ISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
            L + QPR   G P      +S   + E+  +         S  +  A       V  + 
Sbjct: 221 QLFVYQPRTMVGEPFQALTGLSERWVAEEMNKLDSELATIASEAASMARGGVPKAVPGEH 280

Query: 228 CRFCRAKVRCPALSRHVLLEATKD-----PSTNTTVELSKAYSSISLIKSYVKACEDEMF 282
           C +C +   CPA +         +      +  +  E+   ++  S   ++ +  ++ + 
Sbjct: 281 CTYCPSARWCPAAAEFGAKALQAESNPRTVADLSPDEVMALWAQRSAFSAFEEDLKERV- 339

Query: 283 KRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFK-------RILKTPKEL 335
            R+    +      V  RKG+  +     A E +      +  K         +  P ++
Sbjct: 340 -RILHEHKHPAVS-VRYRKGSPKWLSDAAAVEAIMLADRMDLLKPPAISKVEGVIPPDQM 397

Query: 336 EQLYKE 341
            +L   
Sbjct: 398 AELTGR 403


>gi|262194252|ref|YP_003265461.1| hypothetical protein Hoch_0965 [Haliangium ochraceum DSM 14365]
 gi|262077599|gb|ACY13568.1| conserved hypothetical protein [Haliangium ochraceum DSM 14365]
          Length = 387

 Score =  129 bits (325), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 50/313 (15%), Positives = 94/313 (30%), Gaps = 35/313 (11%)

Query: 6   FLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETV---- 59
            LS S   R+  CP++  L    +     S+  + G+  H  L H + + +  E V    
Sbjct: 3   RLSYSRLSRFETCPLSYRLHYLDQREAGDSVPLAFGSAVHAALEHLVREHLAEERVGPLC 62

Query: 60  -SHQKLTFENDTRI-------VDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPG 111
                  +++           +  E  + V   +          +   E           
Sbjct: 63  AERAASLWQSAWTESGLVGLPLFREGLALVHRFVREQGVLDHLDVLAVEQEFRITVGGFE 122

Query: 112 ATGTADILIF-NSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
             G  D +   +     IVD+K         + + + Q+ LY   A   +       + +
Sbjct: 123 VLGYLDRVDRVDDETVDIVDYKTNRQLFTRDELDGSLQMSLYQLAAQSLWPW----AKKV 178

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
            LT    R            +++DL    +     G+           + E     + +C
Sbjct: 179 RLTFWMLRHGVQQRT---ERTSEDLEATKRYVATLGSAI-------DRATEFPARLNSNC 228

Query: 229 RFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEM--FKRLN 286
            +C  K  CPA +    LE  +D       +L         + S  K         +R+ 
Sbjct: 229 TWCDHKQHCPAYA--AALEGKRDVVCEDEGDLEAVAREREEVASLAKILYSRKSELERVL 286

Query: 287 AGDEIQGYQLVEG 299
                +  +LV G
Sbjct: 287 KAHLAEQDELVLG 299


>gi|325068693|ref|ZP_08127366.1| RecB family exonuclease [Actinomyces oris K20]
          Length = 255

 Score =  129 bits (323), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/242 (15%), Positives = 57/242 (23%), Gaps = 37/242 (15%)

Query: 22  PTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDT---- 75
             L    ++P+  S+   +GT  H +L    +                            
Sbjct: 1   FRLRTVDRLPEPGSLATHKGTVVHGVLERLYDLPASERLPQAALELLPGQWASHREKNPE 60

Query: 76  -----EMASSVSMVLAYVRTF-SGPFLSETEVPLEP----------FTTEPGATGTADIL 119
                E A  V   L   R      F  E    LEP                  G  D L
Sbjct: 61  VMDLFEDADQVETWLEEARGLIRTYFTLENPQRLEPAERELFVQTETGDGLLLRGFVDRL 120

Query: 120 IFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIFGRPEALTLTIIQPR 176
                    +VD+K G     +       Q+  YA       G    R + + L      
Sbjct: 121 DVAPDGAMRVVDYKTGRSPGTRFMEEALFQMRFYALVLWRLRGRAPARLQLVYL------ 174

Query: 177 VRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
                 +        +L         R           A +   +      C +C  + +
Sbjct: 175 --KDGRVLTHDPRLAELERTE----TRLAHLWDEVEDCARNGSFHPRRSRLCDWCAFQAQ 228

Query: 237 CP 238
           CP
Sbjct: 229 CP 230


>gi|318064430|gb|ADV36446.1| hypothetical protein [Edwardsiella phage eiAU]
          Length = 182

 Score =  128 bits (322), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/172 (26%), Positives = 79/172 (45%), Gaps = 12/172 (6%)

Query: 210 LKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEATKDPST-----NTTVELSKAY 264
              K A+    +  + D+C++CR + +C A  +     A  D         T  EL++AY
Sbjct: 5   AAGKAALKPGDFRPSADACQWCRFREKCNAARKFNEQIAADDLRDESGDEMTPEELAEAY 64

Query: 265 SSISLIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLG--E 322
           + +  ++ ++K  E   +K L AG ++ G +LV G+ GNR++ D    Q  L       +
Sbjct: 65  AKLPALRQHIKNIESATYKALLAGTKLPGLKLVAGKDGNRTWSDEALVQLRLEQGGVTPD 124

Query: 323 EAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNK 374
             + + L TP + E+            E ++ELITR  G+P IA  D    +
Sbjct: 125 AMYTQKLLTPTQAEKALPAGAF-----EWVEELITRKPGEPSIASADDKRPE 171


>gi|225021452|ref|ZP_03710644.1| hypothetical protein CORMATOL_01472 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945834|gb|EEG27043.1| hypothetical protein CORMATOL_01472 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 248

 Score =  128 bits (322), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/247 (13%), Positives = 65/247 (26%), Gaps = 36/247 (14%)

Query: 16  LKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           ++CP+        K+P+  ++    GT  H  L           T          +   +
Sbjct: 1   MQCPLLYRFRAIDKLPEPKTVAQVRGTLVHACLEDMHLWERPERTYPAVVKRLRPNWADM 60

Query: 74  ---DTEMASSV------SMVLAYVRTFSGPFLSETEVPLEPFT----------TEPGATG 114
              D  +   V        ++       G FL E     +                   G
Sbjct: 61  CGEDPSLLELVPEGEVYEFLVGCRSLLKGYFLMENPQGFDALACEKFVDAVLPNGVPVRG 120

Query: 115 TADILIFNS-TQWIIVDFKYGAGVPVKA--ENNTQLMLYACGALHQYGDIFGRPEALTLT 171
             D +      +  +VD+K G     +   +   Q+  YA       G I  +   + L 
Sbjct: 121 FIDRVDVAPTGEVRVVDYKTGKKPLPRYSGQAKFQMRFYALVWWRTQGVIPHQLRLMYLK 180

Query: 172 IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
           +                S ++L    ++  +     L        +          C +C
Sbjct: 181 VADSLY--------LAPSREELEFFERDLGDLWGKILGDI----SAGVFRAKTSKLCGWC 228

Query: 232 RAKVRCP 238
             +  CP
Sbjct: 229 PHQRLCP 235


>gi|227494917|ref|ZP_03925233.1| ATP-dependent DNA helicase [Actinomyces coleocanis DSM 15436]
 gi|226831369|gb|EEH63752.1| ATP-dependent DNA helicase [Actinomyces coleocanis DSM 15436]
          Length = 1088

 Score =  128 bits (321), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/247 (17%), Positives = 68/247 (27%), Gaps = 20/247 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
             LS S+    L CP    L      + ++  A  GT  H +         +      +  
Sbjct: 846  VLSPSAIESLLNCPAQWFLSRHGGSRKSTGAAGLGTLIHTIAEKYPHGDAEQMLADLEIF 905

Query: 65   TFEND--------TRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTA 116
              + +         R         V   LA      G    E E  +          G  
Sbjct: 906  WDDGEYNRETELGRRAYTDAREKIVK--LAQCFADFGNGEVEVEKRISVDVGIATIMGVI 963

Query: 117  DILIFNSTQWIIVDFKYGAGVPV-KAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
            D L        + D K G    V + + + QL  Y    +          E +   ++  
Sbjct: 964  DRLEHIDGAVRVTDIKTGYVPSVKETQKHKQLAFYQYALMK------AGYEVMGARLLGL 1017

Query: 176  RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV 235
            R +  +   +  I  D   E +KE        L L  +R     +  +    C  C  + 
Sbjct: 1018 REKDPAKYIQSSIMGD--TEISKELLANTEADLQLAVERVRGPFYQPIAGSHCDRCAVQA 1075

Query: 236  RCPALSR 242
             CP    
Sbjct: 1076 MCPLKDE 1082


>gi|307354471|ref|YP_003895522.1| UvrD/REP helicase [Methanoplanus petrolearius DSM 11571]
 gi|307157704|gb|ADN37084.1| UvrD/REP helicase [Methanoplanus petrolearius DSM 11571]
          Length = 1004

 Score =  127 bits (319), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 46/250 (18%), Positives = 84/250 (33%), Gaps = 35/250 (14%)

Query: 6    FLSASSSHRWLKCPIAPTLES--KIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
             LSAS+   +  CP+    E   +IP     Y S GT AH ++ H  +  +  ET S +K
Sbjct: 770  RLSASALKLYDDCPLRFKFEKILRIPTEPRTYFSLGTTAHLIIEHLTKMKMGGETPSMEK 829

Query: 64   LT-------------FENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP 110
                            +   R   T + + ++  L +    +     ETE+  E      
Sbjct: 830  AEDLLERFWSPDAYSSQKHEREDRTRLIAHLNNYLEWEMN-NPNIPVETEMEFEIRVLGT 888

Query: 111  GATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEA 167
              TG  D L       + +VD+K          A+ + QL LYA     + G +  +   
Sbjct: 889  PFTGYIDRLERTESGGYAVVDYKTSKTPMSKNDAKEDIQLNLYALCVKEKTGSLPEKVSL 948

Query: 168  LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
              L            + +++   + +    +               R  + +       +
Sbjct: 949  FYL--------DKGKMVDYIPDYESISAFLENA--------EPVIDRIFAGDFEPKESRN 992

Query: 228  CRFCRAKVRC 237
            C +C  ++ C
Sbjct: 993  CLYCDYRILC 1002


>gi|300779591|ref|ZP_07089447.1| probable helicase [Corynebacterium genitalium ATCC 33030]
 gi|300533701|gb|EFK54760.1| probable helicase [Corynebacterium genitalium ATCC 33030]
          Length = 1040

 Score =  127 bits (318), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 48/261 (18%), Positives = 75/261 (28%), Gaps = 21/261 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHC-----LEQGVDAETVS 60
             LS S     L+CP+   LE  +   +S   + GT AH           +E        +
Sbjct: 780  RLSPSRIEGLLECPMRNVLERDVAPASSDAMTRGTLAHYFFEAVGNGADVELAQADTLEA 839

Query: 61   HQKLTFENDTRIVDT-----EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGT 115
            ++ L      + V        +    +  +   R       +E  V +E         G 
Sbjct: 840  YRALFTVPSWKEVSDLGEFTRLLGRAAQWVEETRGTFELVDTEVPVDVEV-APGLRIGGR 898

Query: 116  ADILIFNS-TQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQY------GDIFGRPE 166
             D L         IVD K G   P   +AE N QL  Y                +    E
Sbjct: 899  IDRLEREESGAVHIVDLKTGKNHPSAAEAEENPQLFAYQLALSRGALREGTDASVATAGE 958

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
              +L +    +         V +A    + A++ +E      +             V   
Sbjct: 959  TDSLDVGGGTLIYPGSDQVKVTAAHQAPKDAEQLEEFAARI-ATLPAEMTGPRLRAVTGK 1017

Query: 227  SCRFCRAKVRCPALSRHVLLE 247
             C FC  K  CP      +  
Sbjct: 1018 HCDFCHVKAICPVQPEGEVTT 1038


>gi|318064428|gb|ADV36445.1| gp43 [Edwardsiella phage eiAU]
          Length = 214

 Score =  126 bits (316), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 52/198 (26%), Positives = 71/198 (35%), Gaps = 21/198 (10%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            HA LS SS+ +WL CP A T E  IP  ++  A  GT  H +        +        
Sbjct: 19  EHALLSPSSAKKWLGCPAALTAEIGIPNPSNPAAEAGTAMHAVAEIMANNLIRDGESKAA 78

Query: 63  KL----------TFENDTRIVDTEMASSVSMVLAYVRT----FSGPFLSETEVPLEPFTT 108
                       T ++       EMA  V   +                E+ V L     
Sbjct: 79  SEFVGGYPLHTPTKKSKGPKFTDEMAKMVQGYIDTCVAPLVDAGAEVYIESRVDLSRPLG 138

Query: 109 EPGATGTADILIFNS-----TQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFG 163
            P   GTAD++            I+ D K G   PV A+ N Q+M+YA G L++Y     
Sbjct: 139 APNTFGTADLVAVTELTDGSNMLIVGDLKTGRH-PVDAKENRQMMIYALGLLNKYRFS-H 196

Query: 164 RPEALTLTIIQPRVRTGS 181
               + L I QP     S
Sbjct: 197 DITKVRLMIYQPFCGGVS 214


>gi|296117889|ref|ZP_06836472.1| RecB family exonuclease [Corynebacterium ammoniagenes DSM 20306]
 gi|295969120|gb|EFG82362.1| RecB family exonuclease [Corynebacterium ammoniagenes DSM 20306]
          Length = 249

 Score =  126 bits (316), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 35/244 (14%), Positives = 68/244 (27%), Gaps = 36/244 (14%)

Query: 20  IAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV---D 74
           +   L    ++P+  +I   +GT  H  L    E      T        + +   +   D
Sbjct: 1   MLYRLRAIDRLPEPKTIAQVKGTLVHAALEKTHELPRAERTYPRAVKFLKPEWEKMCADD 60

Query: 75  TEMASSV------SMVLAYVRTFSGPFLSETEVPLEPFTTE----------PGATGTADI 118
            E+   V        ++       G F  E     +    E              G  D 
Sbjct: 61  AELVELVPHDQTLDFLIEARDLVKGYFQMENPQGFDAKAVEMYVDTVLPNQVPVRGFIDR 120

Query: 119 LIFNS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
           +      +  +VD+K G     +  ++   Q+  YA      +G I  +   + L +   
Sbjct: 121 VDEAPTGEVRVVDYKTGKKPRPQYAHDAQFQMRFYALVYWRIHGVIPAQLRLMYLKVFDS 180

Query: 176 RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV 235
                      + S ++L    ++         +                  C +C  + 
Sbjct: 181 M--------FLMPSREELEYFERDL----GTLWAKIEGDGKEGIFRPKKSKLCGWCSFQE 228

Query: 236 RCPA 239
            CPA
Sbjct: 229 LCPA 232


>gi|227504336|ref|ZP_03934385.1| RecB family exonuclease [Corynebacterium striatum ATCC 6940]
 gi|227198984|gb|EEI79032.1| RecB family exonuclease [Corynebacterium striatum ATCC 6940]
          Length = 251

 Score =  125 bits (315), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 29/240 (12%), Positives = 67/240 (27%), Gaps = 34/240 (14%)

Query: 21  APTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV---DTEM 77
                 K+P+  ++   +GT  H +L +  +   +           + +   +   D+E+
Sbjct: 4   RFRAIDKLPEPKTLAQVKGTLVHAVLENTHKLPREQRDYPTAVKMIKPEWEKMVAADSEL 63

Query: 78  ASSV------SMVLAYVRTFSGPFLSETEVPLEPFT----------TEPGATGTADILIF 121
              V         ++      G F  E     +                   G  D +  
Sbjct: 64  KELVPDDATLDFFVSARDLVKGYFQMENPQGFDAQECEMYVDTVLPNGVPVRGFIDRVDV 123

Query: 122 NS-TQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVR 178
               +  +VD+K G     +  ++   Q+  YA       G I  +   + L ++     
Sbjct: 124 APTGEVRVVDYKTGKKPLPRYSHDAQFQMRFYALVYWRILGTIPAQLRLMYLKVLDSM-- 181

Query: 179 TGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
                     + ++L    ++  +      +                  C +C  +  CP
Sbjct: 182 ------FLAPTREELEYFERDLGD----LWAKIEGDGKEGVFRPKTSKLCGWCSFQKLCP 231


>gi|256371554|ref|YP_003109378.1| hypothetical protein Afer_0757 [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256008138|gb|ACU53705.1| conserved hypothetical protein [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 259

 Score =  124 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/260 (15%), Positives = 73/260 (28%), Gaps = 37/260 (14%)

Query: 5   AFLSASSSHRWLKCPIAPT--LESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           A L+ + +  +  CP A    +   +    +   + GT  H  L     +  D  + +  
Sbjct: 7   ATLTPTKATAFSDCPFAFRRSVIDGVRTPPTRPLAVGTLVHAALEDFYRREPDRRSEAAL 66

Query: 63  KLTFEN--DTRIVDTEMASSVSMVLAYVRTF------------------SGPFLSETEVP 102
               +        D E+ + V+ +    R                    +      TE+ 
Sbjct: 67  NEAVDTAVRAAACDDELGAYVAELDDRERAALYRSITTLSRTILDLEDPARVRAIGTELR 126

Query: 103 LEPFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYG 159
           LE         G  D L  +     ++VD+K G   P   ++     ++ YA      +G
Sbjct: 127 LEATIEGVHVRGVIDRLDLDDEGDLVVVDYKTGRTPPPSHQDARLGGVLTYALLVSVLFG 186

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            +      + L            + E   SA  L         R         +     +
Sbjct: 187 RVPRLVRLVYL--------GDGSVIERAPSAQMLRG----VATRLRALWHAIERACDRED 234

Query: 220 HYGVNDDSCRFCRAKVRCPA 239
                   C  C  +  CPA
Sbjct: 235 FPPRPSRLCGSCPHRDVCPA 254


>gi|37626132|gb|AAQ96508.1| hypothetical protein [Vibrio phage VP16T]
          Length = 350

 Score =  123 bits (309), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 70/365 (19%), Positives = 130/365 (35%), Gaps = 41/365 (11%)

Query: 27  KIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVSMVLA 86
           K     +     GT +H + +  + + +DAE    Q    + D  IVD  MA     ++ 
Sbjct: 3   KAGDFDTDATRAGTASHWVFSESIIEHLDAEDFIGQA---DPDGTIVDQGMADGAQAMID 59

Query: 87  YVRTFSGPF---LSETEVPLEPFTTEPGATGTADILIFNSTQWIIV--DFKYGAGVPVKA 141
            VR         +   E  +      P   GT D         +++  D+K+G  + V  
Sbjct: 60  MVRADLDRHPGGVLYIEQRVHMQDIHPDNWGTFDYAYIVPAIKLVILGDYKHGH-LEVSP 118

Query: 142 ENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR-VRTGSPINEWVISADDLLEKAKEF 200
           E N QL+ Y  G  +  G  F     + L I QP       P+  W  +  D++    + 
Sbjct: 119 ERNLQLVDYLKGLENFVGHTFDGWR-IDLKICQPYAYSPHGPVKVWQANRADIVPLWVQL 177

Query: 201 KERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA--LSRHVLLEATKDPSTNTTV 258
            E+               E +      C++C    RC A   + + ++   ++P    T+
Sbjct: 178 SEQAHS------------EPHMTVGAHCKYCPIVGRCSAARKAGYSVISYVQEPFEVDTM 225

Query: 259 ELSKAYSSISLI-------KSYVKACEDEMFKRLNAGDEIQGYQL--VEGRKGNRSFKDI 309
             +   +   L+       ++ ++  E+++F RL  G+   G  +    GR     +K+ 
Sbjct: 226 SGADLEAERDLLAVGKRLLEARMEDIEEQIFNRLRKGETGMGLTIRTTAGRA---KWKEK 282

Query: 310 NRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRD 369
                     +G +  K    TP +     K++  +D   E ++ L  R  GK  +    
Sbjct: 283 ESVVIAALKSVGLDVSKEAAITPTQA----KDKAKTDAQREAVKGLQHRPGGKAELVKLK 338

Query: 370 IPTNK 374
                
Sbjct: 339 DSPAH 343


>gi|312140618|ref|YP_004007954.1| uvrd/rep family ATP-dependent DNA helicase [Rhodococcus equi 103S]
 gi|311889957|emb|CBH49274.1| putative UvrD/Rep family ATP-dependent DNA helicase [Rhodococcus equi
            103S]
          Length = 1105

 Score =  123 bits (308), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 43/256 (16%), Positives = 69/256 (26%), Gaps = 23/256 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHC----------LEQGV 54
             LS S+      CP+   LE        + +A  GT  H L+                  
Sbjct: 847  PLSPSTIELIANCPLRWMLERHGGSDGDNTHAIAGTLVHTLVQALAGHIPPDQVDHALET 906

Query: 55   DAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVP--LEPFTTE--- 109
              ++V      F          M  + +  L   R+       E  V   LEP T     
Sbjct: 907  AWDSVDLGSEWFSRRELERTRGMLDNFADWLRGTRSELTEIGVEVAVDGVLEPRTEGEAT 966

Query: 110  PGATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
                G  D L  +   + +++D K         +AE + QL  Y   A     D     +
Sbjct: 967  VRIRGRIDRLERDSDGRPVVIDVKTAKAAVTKEQAEQHAQLAAYQVAAARGLIDGVPASQ 1026

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                 ++          +   I +        +        +   +            +D
Sbjct: 1027 PGGARLVFVAKPHKKEGSTQRIQS----ALDDDGVALWENVIHDAAAATRGPTFLARIND 1082

Query: 227  SCRFCRAKVRCPALSR 242
             CR C     CPA   
Sbjct: 1083 GCRHCPVLSSCPAHDE 1098


>gi|325675755|ref|ZP_08155439.1| UvrD/Rep family helicase [Rhodococcus equi ATCC 33707]
 gi|325553726|gb|EGD23404.1| UvrD/Rep family helicase [Rhodococcus equi ATCC 33707]
          Length = 1094

 Score =  123 bits (308), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 43/256 (16%), Positives = 69/256 (26%), Gaps = 23/256 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHC----------LEQGV 54
             LS S+      CP+   LE        + +A  GT  H L+                  
Sbjct: 836  PLSPSTIELIANCPLRWMLERHGGSDGDNTHAIAGTLVHTLVQALAGHIPPDQVDHALET 895

Query: 55   DAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVP--LEPFTTE--- 109
              ++V      F          M  + +  L   R+       E  V   LEP T     
Sbjct: 896  AWDSVDLGSEWFSRRELERTRGMLDNFADWLRGTRSELTEIGVEVAVDGVLEPRTEGEAT 955

Query: 110  PGATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
                G  D L  +   + +++D K         +AE + QL  Y   A     D     +
Sbjct: 956  VRIRGRIDRLERDSDGRPVVIDVKTAKAAVTKEQAEQHAQLAAYQVAAARGLIDGVPASQ 1015

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                 ++          +   I +        +        +   +            +D
Sbjct: 1016 PGGARLVFVAKPHKKEGSTQRIQS----ALDDDGVALWENVIHDAAAATRGPTFLARIND 1071

Query: 227  SCRFCRAKVRCPALSR 242
             CR C     CPA   
Sbjct: 1072 GCRHCPVLSSCPAHDE 1087


>gi|320095789|ref|ZP_08027433.1| UvrD/REP helicase [Actinomyces sp. oral taxon 178 str. F0338]
 gi|319977273|gb|EFW08972.1| UvrD/REP helicase [Actinomyces sp. oral taxon 178 str. F0338]
          Length = 267

 Score =  123 bits (308), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 38/250 (15%), Positives = 65/250 (26%), Gaps = 31/250 (12%)

Query: 6   FLSASSSHRWLKCPIAPTLESKIPQTTSIYAS-EGTFAHNLLAHC-------LEQGVDAE 57
            LS S     L+CP+   L +         A   GT  H++           L   +D  
Sbjct: 30  VLSPSQFESALQCPLRWFLTTIGADGPGTAAQSLGTLVHDIAERHPNGTREQLRAALDER 89

Query: 58  TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSG--PFLSETEVPLEPFTTEPGATGT 115
               +                +    V+  + ++    P   + E  +          G 
Sbjct: 90  --IGELGYDLGTWAGRRDHAHAYA--VIDNLASYMAGVPGAVDVEGTVAANVEGVTIRGR 145

Query: 116 ADILIFNSTQWIIVDFKYGA--GVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
            D +        + D K G          +N QL  Y    +            +   I 
Sbjct: 146 MDRVEHVDGGVRVTDIKTGRYGYTAKSVPDNPQLAAYQMALIAL------EQPVVGGRIA 199

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD-SCRFCR 232
                     ++  +  + L E           A+    + A          + +CRFC 
Sbjct: 200 LVGGDKERVFDQPALHGEALDEW--------RAAVRRVGEAARGPSFRATPSEAACRFCS 251

Query: 233 AKVRCPALSR 242
               CPA  R
Sbjct: 252 FDRLCPARDR 261


>gi|317507956|ref|ZP_07965650.1| hypothetical protein HMPREF9336_02022 [Segniliparus rugosus ATCC
           BAA-974]
 gi|316253744|gb|EFV13120.1| hypothetical protein HMPREF9336_02022 [Segniliparus rugosus ATCC
           BAA-974]
          Length = 273

 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/273 (17%), Positives = 74/273 (27%), Gaps = 44/273 (16%)

Query: 7   LSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLL-------AHCLEQGVDA--- 56
           LS S   + L CP+    E  +P      A+ GT  H L           L   +D    
Sbjct: 9   LSPSRVEQLLVCPLRWLFERAVPSAPGEAAAVGTAVHLLASVSGRFSEEELASALDEAVS 68

Query: 57  --ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEP--------- 105
             +  S +        R     + ++ S  LA  R        E  V +           
Sbjct: 69  QADARSARPPWAAQRRREQLGRLLATFSGWLAASRGELTEVGVEVPVEMTLPALGGRSGS 128

Query: 106 -----------FTTEPGATGTADILIFN-STQWIIVDFKYGAGVPVKA--ENNTQLMLYA 151
                         E    G  D L      + +IVD K        A    + QL  Y 
Sbjct: 129 LPRASRAPIADVELEVRIKGRIDRLEKTRDGELVIVDLKTAKTPRSVASVHEDAQLACYQ 188

Query: 152 CGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLK 211
                   +       + L         G+P  +   +  +      E     + A+   
Sbjct: 189 LVVGAAREEPVAGGRLVFL---------GAPRKDAGAAEREQPGLDDEAARAWSDAVREA 239

Query: 212 SKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHV 244
              AV  +     +  C  C  +  CPAL R  
Sbjct: 240 GALAVGPQFPARPNAGCASCPGRRCCPALRRAA 272


>gi|295394600|ref|ZP_06804819.1| superfamily I DNA and RNA helicase [Brevibacterium mcbrellneri ATCC
            49030]
 gi|294972493|gb|EFG48349.1| superfamily I DNA and RNA helicase [Brevibacterium mcbrellneri ATCC
            49030]
          Length = 1041

 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 47/257 (18%), Positives = 78/257 (30%), Gaps = 21/257 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIY-ASEGTFAHNLLAHCLEQGVDAE----TVS 60
             +S S    + +CP+         QT   Y  + G   H +       G+          
Sbjct: 778  RISPSQVETYDQCPLKWFFNQNSSQTVDTYPQAFGNLIHEIAQTYPRGGLADMLNHFDEK 837

Query: 61   HQKLTFENDTRIVDTEMA--SSVSMVLAYVRTFSGPFLSETEV----PLEPFTTEPGATG 114
             ++ TFE++           ++V  +  Y++          EV     L+        +G
Sbjct: 838  FEEFTFESEWERQREYADGRATVENLNEYLKNRGDKTFVAAEVVVRSDLDVPLGPARVSG 897

Query: 115  TADILIFN-STQWIIVDFKYGAGVPVKA--ENNTQLMLYACGALHQYGDIFGRPEALTLT 171
              D L         IVDFK G  +P K   + N QL  Y               E +   
Sbjct: 898  RIDRLEKTSDGAAYIVDFKTGNNLPSKPSVQENPQLATYQVAIEAGQATFINDVELIRGI 957

Query: 172  -------IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVN 224
                   ++ PR   G       +     ++    + +      SL             +
Sbjct: 958  TECAGGELVYPRKAAGQRKPPSNVREQGPIKDTDVYTKTIATIESLVRSARTHTFTATPS 1017

Query: 225  DDSCRFCRAKVRCPALS 241
            DD+CR C     CPA +
Sbjct: 1018 DDACRTCAFTQSCPAFA 1034


>gi|260903704|ref|ZP_05912026.1| hypothetical protein BlinB_00115 [Brevibacterium linens BL2]
          Length = 250

 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 37/245 (15%), Positives = 62/245 (25%), Gaps = 37/245 (15%)

Query: 20  IAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEM 77
           +        K+P+  S  A  GT  H++L    E      T    +         +  + 
Sbjct: 1   MKFRFRSIDKLPEPPSQAAFRGTVVHSVLEKLFELPAARRTQDVAESLLRPSWDELVDKD 60

Query: 78  ASSVSMVLAY----------VRTFSGPFLSETEVPLEPF----------TTEPGATGTAD 117
              + +                     F  E    LEP                  G  D
Sbjct: 61  PEVLEIFGDEGEKETFFTTAANLLRAYFSLEFPEHLEPEQTEKYVRTQLDNGLELRGFID 120

Query: 118 ILIFNSTQW-IIVDFKYGAGVPVKA--ENNTQLMLYACGALHQYGDIFGRPEALTLTIIQ 174
            +         +VD+K G     +   E + Q+  YA       G++    + + L    
Sbjct: 121 RVDVAPGGEKRLVDYKTGKQPKPQYGREAHFQMGFYALVEYRLTGELVHTLQLMYL---- 176

Query: 175 PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
                   I +   +  D+     E               A +          C +C  K
Sbjct: 177 ----GSQSILKSHPTMSDIERTQFEI----ESIWKDIIASAEADRWRPKKSPLCNWCTFK 228

Query: 235 VRCPA 239
             CPA
Sbjct: 229 PLCPA 233


>gi|300783059|ref|YP_003763350.1| ATP-dependent DNA helicase [Amycolatopsis mediterranei U32]
 gi|299792573|gb|ADJ42948.1| ATP-dependent DNA helicase [Amycolatopsis mediterranei U32]
          Length = 1057

 Score =  120 bits (300), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 42/256 (16%), Positives = 73/256 (28%), Gaps = 25/256 (9%)

Query: 6    FLSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHC--------LEQGVDA 56
             +S S+     KCP+   +E         + A  GT  H L            L+  +D 
Sbjct: 801  RISPSTVEILTKCPLRWMIERHGGSDPAQLAAVTGTLVHGLAQAVASGSTDAELQAALDE 860

Query: 57   E--TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT-----E 109
                V      F    R    +M  + +  L   R        E ++ +E          
Sbjct: 861  AWVRVDAGAPWFSRRERRRVEQMLRNFTTWLEQSRKELKEAGVEQDIEVELPAGSEDEVR 920

Query: 110  PGATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
                G  D +  +   + +IVD K G       +AE + QL  Y    L    +      
Sbjct: 921  VLLRGRVDRVELDAEGRPVIVDIKTGKVPVSGAEAEAHPQLAAYQLAVLLGAIEGRTEAG 980

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
               L  +                 D++        ++    +   +  A   ++    + 
Sbjct: 981  GARLVYVAKANNKTGATERSQPPLDEV------GGKQWLELVQKAAASAAGPDYQAQENP 1034

Query: 227  SCRFCRAKVRCPALSR 242
             C  C A+  CP    
Sbjct: 1035 DCDRCPARGCCPLRPE 1050


>gi|115375892|ref|ZP_01463141.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310819817|ref|YP_003952175.1| hypothetical protein STAUR_2544 [Stigmatella aurantiaca DW4/3-1]
 gi|115367070|gb|EAU66056.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309392889|gb|ADO70348.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 391

 Score =  118 bits (297), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 41/295 (13%), Positives = 84/295 (28%), Gaps = 35/295 (11%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAE--- 57
            H  LS S   R+  CP++  L    K      +  S G   H +L   L++ +D E   
Sbjct: 7   QH--LSYSRLSRFEACPLSYRLHYLDKHTAEPGVPLSFGKALHAVLERLLQEVIDTEYAG 64

Query: 58  --TVSHQKLTFENDTRI-------VDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT 108
             +       +  +          +  +    +   +          +   E        
Sbjct: 65  PLSEERALQLYREEWAASGLSGLDLFQQGLGILQDFVRQQGRVDSRDILAVEKEFRLPVG 124

Query: 109 EPGATGTADILI-FNSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRP 165
                G  D +   +     ++D+K         + +++ QL LYA  A   +       
Sbjct: 125 PFTVLGFIDRVDWVDDETVHVMDYKSNHQLFTREELDSSLQLSLYALAARRMWPW----A 180

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
           + + L++   R              D  L   +   ++   A                 +
Sbjct: 181 KKVRLSMWMLRHGVRQETTRTEEQLDAALAYVETLGQQMEKA----------ESFPARLN 230

Query: 226 DSCRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDE 280
            +C +C  +  CP  ++   LE  ++     T +L         +    K     
Sbjct: 231 PNCVYCDHRRNCPTYAQA--LEGRREVVCEDTSDLESVARERQEVAHIAKILNAR 283


>gi|118470846|ref|YP_886307.1| helicase, UvrD/Rep family protein [Mycobacterium smegmatis str. MC2
            155]
 gi|118172133|gb|ABK73029.1| helicase, UvrD/Rep family protein [Mycobacterium smegmatis str. MC2
            155]
          Length = 1045

 Score =  118 bits (297), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/255 (17%), Positives = 75/255 (29%), Gaps = 28/255 (10%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIY-ASEGTFAHNLL------AHCLEQGVD---A 56
            LS S+      CP+   LE           ++ G+  H L+         L   ++    
Sbjct: 796  LSPSTLQMLTDCPLRWLLERHGGDDGRDVRSTVGSLVHALVSEPGKTESQLVNELEKVWD 855

Query: 57   ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVP---LEPFT--TEPG 111
            +     K   +N+       M  + +      R       +E  V    +EP        
Sbjct: 856  DLPYDAKWYSDNELARHRA-MLETFTRWREDTRRQLTEVATEIPVEGIVVEPGENTPGVR 914

Query: 112  ATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              G  D L  +   + ++VD K G        A+N+ QL +Y         D    P   
Sbjct: 915  VRGRLDRLERDEAGRLVVVDLKTGKSPVTKDDAQNHAQLAMYQLAVAAGLLDDGDEPGGG 974

Query: 169  TLTIIQPRVRTGSPINEWVI-SADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
             L  +      G+   E    + D   E  +   E         +            ++ 
Sbjct: 975  KLVYLGKAGAAGATEREQDPLTPDKRAEWLETVGE--------AAAATAGPRFVARVNNG 1026

Query: 228  CRFCRAKVRCPALSR 242
            C  C  +  CPA + 
Sbjct: 1027 CANCPVRSSCPAQAN 1041


>gi|54026512|ref|YP_120754.1| putative helicase [Nocardia farcinica IFM 10152]
 gi|54018020|dbj|BAD59390.1| putative helicase [Nocardia farcinica IFM 10152]
          Length = 1255

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/256 (16%), Positives = 70/256 (27%), Gaps = 29/256 (11%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHCLEQGVDA--------- 56
            LS S+  +   CP+   LE        + +A +G+  H L+     +  +A         
Sbjct: 1000 LSPSTVEQLRTCPLRWALERHGGTDGDNPHAVKGSLVHTLVQALAGRVPEAQVRAALDKA 1059

Query: 57   -ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPL-----EPFTTEP 110
               +           R     M  +    +   R        E  V              
Sbjct: 1060 WRAIDPGDGWHSRQERRRTEAMLETFLAWVRNTRGELTQAGVEVPVDCVLPARSEDERPV 1119

Query: 111  GATGTADILIFNS-TQWIIVDFKYGAGVPVK--AENNTQLMLYACGALHQYGDIFGRPEA 167
               G  D L  +   +++IVD K G     K  A ++ QL  Y   A     D  G P  
Sbjct: 1120 RIRGRIDRLERDEFGRFVIVDVKTGKNPISKQAAADHAQLATYQVAAASGALDPEGEPGG 1179

Query: 168  LTLTIIQ--PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
              L  +         +   +  + A  L                  +       +  + +
Sbjct: 1180 ARLVYVAKPHTKEGATQRMQDPLDAAALDSWRDTIH--------QAAAATRGPSYLAMRN 1231

Query: 226  DSCRFCRAKVRCPALS 241
            D CR C     CP   
Sbjct: 1232 DGCRHCAVAGCCPVQD 1247


>gi|260577891|ref|ZP_05845822.1| ATP-dependent DNA helicase II [Corynebacterium jeikeium ATCC 43734]
 gi|258603985|gb|EEW17231.1| ATP-dependent DNA helicase II [Corynebacterium jeikeium ATCC 43734]
          Length = 1136

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/262 (15%), Positives = 69/262 (26%), Gaps = 31/262 (11%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIP-QTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
             LS S    W  C +   L+S      ++     G F H +    ++     E     + 
Sbjct: 880  RLSPSKLESWNTCALRAFLDSNGGVSESTEAMRVGIFIHAIAEQIVQGMELDEAQLAVRE 939

Query: 65   TFE--------------NDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP 110
                                     ++   ++                  V   P   E 
Sbjct: 940  ILPHVLDGPAWKNTQTVERWEGGVNKLHGFIAGYRDKEFELETERTLRARVGQTPDGVEV 999

Query: 111  GATGTADILIFN--STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
              +G AD+L  N       ++DFK G        A  + QL  Y          +    E
Sbjct: 1000 TLSGRADLLATNPEDGLTKVIDFKTGKTAVTKNAAAESPQLSAYQ--------FLLPLNE 1051

Query: 167  ALTLTIIQPRVRTGSPI----NEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
                +  + R    + +        I+  +  E  +E        L   +       +  
Sbjct: 1052 RSGGSAQKYRPGGAALVYPGTQTKTITERNQAELTEEQLSGVHDQLMEIAPVTAGPTYLA 1111

Query: 223  VNDDSCRFCRAKVRCPALSRHV 244
              +D CR C  K  CPA     
Sbjct: 1112 TPNDGCRHCDFKTICPAQDEGN 1133


>gi|72160927|ref|YP_288584.1| ATP-dependent DNA helicase [Thermobifida fusca YX]
 gi|71914659|gb|AAZ54561.1| putative ATP-dependent DNA helicase [Thermobifida fusca YX]
          Length = 1044

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/247 (17%), Positives = 72/247 (29%), Gaps = 17/247 (6%)

Query: 6    FLSASSSHRWLKCPIAPTLE-SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
             +S S   ++  C +   LE +   +     +  G+  H L     E     E +     
Sbjct: 801  RISPSQVEKFTTCELRWLLETAAGAEKRRAASGIGSIVHALARIAAENPDLPELLRRMDQ 860

Query: 65   TFEN-------DTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTAD 117
             + +                   +   L + +      L  TE            +G  D
Sbjct: 861  IWSDLDFGGPWYAEKQRERAEEMLQRFLDWQKENPRE-LVATEKKFRVEVGNIEISGQVD 919

Query: 118  ILIFN-STQWIIVDFKYGAGVPVK-AENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
             L  +   + +IVD K G  VP +    + QL +Y    L    + +G  E     ++Q 
Sbjct: 920  RLERDAEGRGVIVDIKTGTAVPDREISRHPQLGVYQLALLMAAFEHYGLVEPGGAALLQI 979

Query: 176  RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV 235
              R  +        ADD         E     +   +              SCR C  + 
Sbjct: 980  GDRKTAKEQTQPALADDAD------PEWPQRLVQKVAAGMAGARFRAKATPSCRHCSVRA 1033

Query: 236  RCPALSR 242
             CP  S 
Sbjct: 1034 SCPVQSE 1040


>gi|302524414|ref|ZP_07276756.1| ATP-dependent DNA helicase [Streptomyces sp. AA4]
 gi|302433309|gb|EFL05125.1| ATP-dependent DNA helicase [Streptomyces sp. AA4]
          Length = 1057

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/255 (18%), Positives = 75/255 (29%), Gaps = 24/255 (9%)

Query: 6    FLSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLL--------AHCLEQGVDA 56
             +S S+    +KCP+   +E         + A  GT  H L            ++  +D 
Sbjct: 802  RISPSTVEILVKCPLRWLIERHGGSDPAQLAAVTGTLVHGLAQAIAGGSTEEQIQAALDE 861

Query: 57   E--TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT- 113
                V      F    R    +M  +    L   R        E ++ +E    +     
Sbjct: 862  AWVRVDAGAPWFSRRERSRVEQMLRNFVSWLEKSRQELIEAGVEQDIEVELPMGDEEVRV 921

Query: 114  ---GTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEA 167
               G  D +  +   + +IVD K G        AE + QL  Y    L    +    P  
Sbjct: 922  LLRGRVDRVEMDKDGRPVIVDIKTGKVPVSGADAEKHPQLAAYQLAVLLGAVEGKNTPGG 981

Query: 168  LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
              L  +                 D+        +E   L  S  +  AV  ++    +  
Sbjct: 982  AKLVYVAKGNNKTGATQRDQPPMDE-----DNGREWLELVRSAAA-AAVGPDYQAHENAD 1035

Query: 228  CRFCRAKVRCPALSR 242
            C  C A+  CP    
Sbjct: 1036 CDRCPARGCCPLRPE 1050


>gi|68536699|ref|YP_251404.1| putative ATP-dependent DNA helicase II [Corynebacterium jeikeium
            K411]
 gi|68264298|emb|CAI37786.1| putative ATP-dependent DNA helicase II [Corynebacterium jeikeium
            K411]
          Length = 1104

 Score =  117 bits (294), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 41/262 (15%), Positives = 69/262 (26%), Gaps = 31/262 (11%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIP-QTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
             LS S    W  C +   L+S      ++     G F H +    ++     E     + 
Sbjct: 848  RLSPSKLESWNTCALRAFLDSNGGVSESTEAMRVGIFIHAIAEQIVQGMELDEAQLAVRE 907

Query: 65   TFE--------------NDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP 110
                                     ++   ++                  V   P   E 
Sbjct: 908  ILPHVLDGPAWKNTQTVERWEGGVNKLHGFIAGYRDKEFELETERTLRARVGQTPDGVEV 967

Query: 111  GATGTADILIFN--STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
              +G AD+L  N       ++DFK G        A  + QL  Y          +    E
Sbjct: 968  TLSGRADLLATNPEDGLTKVIDFKTGKTAVTKNAAAESPQLSAYQ--------FLLPLNE 1019

Query: 167  ALTLTIIQPRVRTGSPI----NEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
                +  + R    + +        I+  +  E  +E        L   +       +  
Sbjct: 1020 RSGGSAQKYRPGGAALVYPGTQTKTITERNQAELTEEQLSGVHDQLMEIAPVTAGPTYLA 1079

Query: 223  VNDDSCRFCRAKVRCPALSRHV 244
              +D CR C  K  CPA     
Sbjct: 1080 TPNDGCRHCDFKTICPAQDEGN 1101


>gi|271969569|ref|YP_003343765.1| superfamily I DNA and RNA helicase-like protein [Streptosporangium
            roseum DSM 43021]
 gi|270512744|gb|ACZ91022.1| Superfamily I DNA and RNA helicase-like protein [Streptosporangium
            roseum DSM 43021]
          Length = 1051

 Score =  117 bits (294), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 45/250 (18%), Positives = 74/250 (29%), Gaps = 25/250 (10%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYAS-EGTFAHNLL---------AHCLEQGVD 55
             +S S+   + KC +   LE+ +  + +  A   GT  H L             L + +D
Sbjct: 801  RISPSAVENFTKCGLRWLLETSVGASGTDAARGLGTVIHALAVLAATGMPSEDTLGKRLD 860

Query: 56   AE--TVSHQKLTFENDTRIVDTEMA-SSVSMVLAYVRTFSGPFLSETEVPLEPFT-TEPG 111
                 +    + +    R V  +M    V       R          E            
Sbjct: 861  EIWHELDFGGVWYNRKQRKVAEQMISKFVRWHQDNPREL-----VGLEEAFTAMVSEGVQ 915

Query: 112  ATGTADILIFN-STQWIIVDFKYGAGVPVKA--ENNTQLMLYACGALHQYGDIFGRPEAL 168
              G  D +  +   + +I+D K G   P  A  E + QL +Y   AL       G  E  
Sbjct: 916  IKGRVDRVERDAEGRAVIIDIKTGKNGPKDAEIERHPQLGVYQLAALLGAFQRHGMTEPG 975

Query: 169  TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
               ++Q         +    +   L E A          +   +            +D C
Sbjct: 976  GAALVQ-VGDAAGKKDAKEQAQPPLAEDAD--PGWARDMVDTVALGMSGPFFQAKVNDGC 1032

Query: 229  RFCRAKVRCP 238
            R C  +  CP
Sbjct: 1033 RTCAVRASCP 1042


>gi|227550043|ref|ZP_03980092.1| helicase [Corynebacterium lipophiloflavum DSM 44291]
 gi|227077889|gb|EEI15852.1| helicase [Corynebacterium lipophiloflavum DSM 44291]
          Length = 1018

 Score =  117 bits (294), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 47/262 (17%), Positives = 74/262 (28%), Gaps = 35/262 (13%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDA--------- 56
             LS S     L CP+   L+  +   +S++   G+ AH      + +GVD          
Sbjct: 760  RLSPSRIESLLACPMREVLQRMVGLDSSLHMVWGSMAHAYFE-AVGRGVDETFARNAVLE 818

Query: 57   --ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATG 114
               +V                 M       L   R+       E ++ +E         G
Sbjct: 819  ARRSVDDAPQWKVEREIAEFEAMLQRAHRWLQTSRSAFEQVAVEADIDVEIS-PGLRVVG 877

Query: 115  TADILIFNS-TQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQY-----------GD 160
             AD +  +      IVD K G+GVP    AE N QL  Y                   G+
Sbjct: 878  RADRIERDGSGALHIVDLKTGSGVPSKDDAEANPQLEAYQLALSRGAIDGETVRSAAPGE 937

Query: 161  IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
                     L   +      +   +   S + L + A+          +   +R      
Sbjct: 938  TPNTVGGAVLVYPKVDRDAAATREQTAKSEERLAQFAELI--------APLPQRVTGPRL 989

Query: 221  YGVNDDSCRFCRAKVRCPALSR 242
                   C  C  +  CP    
Sbjct: 990  LASTGAHCDRCAVRALCPVQPE 1011


>gi|226365846|ref|YP_002783629.1| ATP-dependent DNA helicase [Rhodococcus opacus B4]
 gi|226244336|dbj|BAH54684.1| putative ATP-dependent DNA helicase [Rhodococcus opacus B4]
          Length = 1108

 Score =  117 bits (293), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 46/255 (18%), Positives = 78/255 (30%), Gaps = 23/255 (9%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHC--------LEQGVD-- 55
            LS S+      CP+   LE        + +A  GT  H L+           +E+ ++  
Sbjct: 851  LSPSTVDLLNTCPLRWLLERHGGRDGDNTHAIAGTLVHTLVQALAGRIPADQVERALENA 910

Query: 56   AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVP--LEPFTTE---P 110
             E++      +         +M ++ +  L   R+       E  V   LEP        
Sbjct: 911  WESIDLGSQWYSRRELDRTRDMLATFTAWLGNTRSELTEVGVEVAVDGVLEPREEGSPTI 970

Query: 111  GATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEA 167
               G  D L  +   + +IVD K          A+ + QL  Y   A     D     + 
Sbjct: 971  RLRGRIDRLERDAEGRPVIVDVKTARSPVTKDNAQQHAQLAAYQVAAAIGAIDGEPASKP 1030

Query: 168  LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
                ++              + A      ++E  E     +   +      E     +D 
Sbjct: 1031 GGARLVFVAKPHQKEGATQRVQAP----LSEEALESWLAVIHAAAAATKGPEFLARVNDG 1086

Query: 228  CRFCRAKVRCPALSR 242
            CR C  +  CPA   
Sbjct: 1087 CRHCPVRTSCPAHDE 1101


>gi|310819921|ref|YP_003952279.1| hypothetical protein STAUR_2648 [Stigmatella aurantiaca DW4/3-1]
 gi|309392993|gb|ADO70452.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 391

 Score =  117 bits (293), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 42/291 (14%), Positives = 83/291 (28%), Gaps = 33/291 (11%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAE-----TV 59
           LS S   R+  CP++  L    K      +  S G   H +L   L++ +D E     + 
Sbjct: 9   LSYSRLSRFEACPLSYRLHYLDKHTAEPGVPLSFGKALHAVLERLLQEVIDTEYAGALSE 68

Query: 60  SHQKLTFENDTRI-------VDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGA 112
                 +             +  +    +   +          +   E            
Sbjct: 69  ERALQLYREAWAASGLSGLDLFQQGLGILQDFVRQQGRVDSRDILAVEKEFRLPVGPFTV 128

Query: 113 TGTADILI-FNSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRPEALT 169
            G  D +   +     ++D+K         + +++ QL LYA  A   +       + + 
Sbjct: 129 LGFIDRVDWVDEETIAVIDYKSNHQLFTREELDSSLQLSLYALAARRMWPW----AKKVR 184

Query: 170 LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
           L++   R              D  L   +   ++   A                 + +C 
Sbjct: 185 LSMWMLRHGVRQETTRTEEQLDAALAYVETLGQQMEKA----------ESFPARLNPNCV 234

Query: 230 FCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDE 280
           +C  +  CPA ++   LE  +D     T +L         +    K     
Sbjct: 235 YCDHRRNCPAYAQA--LEGQRDVVCEDTSDLESVARERQEVAHLAKILGAR 283


>gi|225155628|ref|ZP_03724117.1| hypothetical protein ObacDRAFT_9239 [Opitutaceae bacterium TAV2]
 gi|224803601|gb|EEG21835.1| hypothetical protein ObacDRAFT_9239 [Opitutaceae bacterium TAV2]
          Length = 414

 Score =  117 bits (292), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 63/346 (18%), Positives = 107/346 (30%), Gaps = 40/346 (11%)

Query: 6   FLSASSSHRWLKCPIAPTLESKI-PQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
              ASS  + L CP A  L + + P   S  +  GT+ H   A  L     A   S    
Sbjct: 23  RFRASSVPQLLACPAAAILGAIVKPSPDSAASLLGTWCHWRAARTLADEHGATAPSDGLP 82

Query: 65  TFENDTRIVDTEMASS-VSMVLAYVRTFSG-PFLSETEVPLEPFTTEPGATGTADILIFN 122
             +       +   +  V   L  V T +      E E  +         TG  D     
Sbjct: 83  EPQMPDGWTPSGFENWMVDYYLGTVLTSTDADMAIEVEAEIVADFDRFDLTGHIDAFGIT 142

Query: 123 STQWIIV--DFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
           +     V  D K G+ +  +AE N Q++ Y       Y  +      +T  I+QPR    
Sbjct: 143 ADATEAVGFDLKTGSELVDEAEQNAQVLSYIVLLYRAYPTL----RRITFAIVQPRNNPD 198

Query: 181 ---SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV-R 236
                +    +    L       +      L    +              CR+C A   +
Sbjct: 199 EGMERVTWATVEGPQLDGVTSYLERELNHVLKNPRQLNSDGW------KQCRYCPAAGKK 252

Query: 237 CPALSRHVLLEATKDPSTNTTVELSKA-----YSSISLIKSYVKA---CEDEMFKRLNAG 288
           CPA+ + + ++        T   ++          +  ++   K      +     L   
Sbjct: 253 CPAIDQEIKMKLQ-----LTDEHIAAIAAEPTLEHMLDLEMARKKLVPILERAHDALKTR 307

Query: 289 DEIQGYQLVEG-------RKGNRSFKDINRAQELLTSVLGEEAFKR 327
              +G  +  G       R   R   D  +A E+L+  L ++ + R
Sbjct: 308 VRAEGESIAAGHRIFIETRNSGREITDQAKAAEILSD-LSDDLYHR 352


>gi|294495717|ref|YP_003542210.1| UvrD/REP helicase [Methanohalophilus mahii DSM 5219]
 gi|292666716|gb|ADE36565.1| UvrD/REP helicase [Methanohalophilus mahii DSM 5219]
          Length = 1018

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 36/249 (14%), Positives = 76/249 (30%), Gaps = 31/249 (12%)

Query: 6    FLSASSSHRWLKCPIAPTLES--KIPQTTSIYASEGTFAHNLLAHC---------LEQGV 54
              SAS   ++++CP+     +   IP     +   GT  H++             ++  +
Sbjct: 778  RFSASKVRQYMECPLKFKYSNVLNIPIPQKTFFQTGTDVHSVFEQLSRYRMQGKSIDMEL 837

Query: 55   DAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSE---TEVPLEPFTTEPG 111
                +         D++  + +    V  +L Y   F    ++E    E           
Sbjct: 838  ANRILDETWDGSVFDSQTHEQQELDRVRQMLEYWFEFEKSNVNETIAVEEKFNLKLDGAQ 897

Query: 112  ATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              G  D +      ++I++D+K         K   + QL LY      +YG    +   +
Sbjct: 898  FGGVIDRIDQTPEGEYIVIDYKTSKSPLSKNKMPEDVQLALYCQAVRERYGKYPVKAGLM 957

Query: 169  TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
             +      +R              L++  +         +        + +     + +C
Sbjct: 958  YVNPNIRDLR--------------LMDVNQSQINSVLDGVREIVADIKAEDFEIREEPNC 1003

Query: 229  RFCRAKVRC 237
             FC  K  C
Sbjct: 1004 YFCDYKGIC 1012


>gi|111023338|ref|YP_706310.1| ATP-dependent DNA helicase [Rhodococcus jostii RHA1]
 gi|110822868|gb|ABG98152.1| probable ATP-dependent DNA helicase [Rhodococcus jostii RHA1]
          Length = 1098

 Score =  116 bits (291), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 45/259 (17%), Positives = 79/259 (30%), Gaps = 31/259 (11%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHC--------LEQGVD-- 55
            LS S+      CP+   LE        + +A  GT  H L+           + + ++  
Sbjct: 841  LSPSTIDLLNTCPLRWLLERHGGTDGDNTHAIAGTLVHTLVQALAGRIPPDQVARALENA 900

Query: 56   AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVP--LEPFTTE---P 110
             +++      +         +M ++ +  L   R+       E  V   LEP        
Sbjct: 901  WDSIDLGSQWYSRRELDRTRDMLATFTAWLGNTRSELTEVGVEVAVDGVLEPREEGSPTI 960

Query: 111  GATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEA 167
               G  D L  +   + +IVD K          A+ + QL  Y   A     D     + 
Sbjct: 961  RLRGRIDRLERDAEGRPVIVDVKTARSPVTKDDAQQHAQLAAYQVAAAVGAIDGEPASKP 1020

Query: 168  LTLTIIQ----PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
                ++      R    +   +  +S +DL              +   +      E    
Sbjct: 1021 GGARLVFVAKPHRKEGATQRVQAPLSDEDLETWL--------AVIHAAAAATKGPEFLAR 1072

Query: 224  NDDSCRFCRAKVRCPALSR 242
             +D CR C  +  CPA   
Sbjct: 1073 VNDGCRHCPVRTSCPAHDE 1091


>gi|300934454|ref|ZP_07149710.1| RecB family exonuclease [Corynebacterium resistens DSM 45100]
          Length = 234

 Score =  116 bits (290), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 27/226 (11%), Positives = 56/226 (24%), Gaps = 34/226 (15%)

Query: 35  YASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVS---------MVL 85
              +GT  H +L           T        +     +  +    +           ++
Sbjct: 2   AQVKGTLVHAVLEDLHGLPRAERTYPAAVKMLKPKWAKMVEDDPELLELVPDSETHAYLV 61

Query: 86  AYVRTFSGPFLSETEVPLEPFT----------TEPGATGTADILIFNS-TQWIIVDFKYG 134
                  G F  E     +                   G  D +      +  +VD+K G
Sbjct: 62  ECRSLVKGYFYMENPEGFDAHECEKYINMMLPNGVPVRGFIDRVDIAPTGEVRVVDYKTG 121

Query: 135 AGVPVKAENN--TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADD 192
                +   +   Q++ YA       G+I  +   + L +        +       S  +
Sbjct: 122 KKPLPRYSESAKFQMLFYALVWWRMTGEIPAQLRLMYLKV--------ADDMVLNPSPAE 173

Query: 193 LLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
           L    ++             +   + E        C +C  +  CP
Sbjct: 174 LQYFERDL----ETLWGAIKRDVETGEFTPRETKLCGWCHFQEICP 215


>gi|84494621|ref|ZP_00993740.1| hypothetical protein JNB_07484 [Janibacter sp. HTCC2649]
 gi|84384114|gb|EAP99994.1| hypothetical protein JNB_07484 [Janibacter sp. HTCC2649]
          Length = 297

 Score =  115 bits (289), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 40/251 (15%), Positives = 64/251 (25%), Gaps = 28/251 (11%)

Query: 8   SASSSHRWLKCPIAPT---LESKIPQ--TTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           S S     + CP       L+   P+      + S G   HN L    +   D  T S  
Sbjct: 25  SPSRLLAHVDCPRRYRMQYLDKPRPEQRPQRAHTSFGLAVHNALRDWWDLPRDRRTASAG 84

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRTF---------SGPFLSETEVPLEPFTTEPGAT 113
           +         V         +     +                   E  +   +     T
Sbjct: 85  RELVRTSWIDVGFRDPEQSMVWRKRAQEHVVAYLGGVDPDDPPRGIERTVSFISGALRVT 144

Query: 114 GTADILIFNSTQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQYGDIFGRPEALTLT 171
           G  D L     + ++VD+K          A  +  + LYA      +     R E   + 
Sbjct: 145 GRIDRLDDRDGELVVVDYKTSQKPLSDDDARTSLPMALYAAAVWKMFRRPCLRVELHHV- 203

Query: 172 IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL----EHYGVNDDS 227
                      +     + + L  K  E K     A    +  A           V    
Sbjct: 204 -------PSGEVISHTHTPESLTRKVDEAKSIARDAQRADADFAERGIESTLFPPVVGPI 256

Query: 228 CRFCRAKVRCP 238
           C +C  +  CP
Sbjct: 257 CTWCDYRAHCP 267


>gi|315604923|ref|ZP_07879981.1| conserved hypothetical protein [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|315313462|gb|EFU61521.1| conserved hypothetical protein [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 585

 Score =  115 bits (289), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/247 (18%), Positives = 73/247 (29%), Gaps = 25/247 (10%)

Query: 6   FLSASSSHRWLKCPIAPTLESKIPQTT-SIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
            LS S   R L CP+   L +   + T +  AS GT  H +          AE ++    
Sbjct: 348 VLSPSQFERALVCPLRWFLTTVGAEGTANAAASLGTLVHAVAEE--NPHGTAEELTEALE 405

Query: 65  TFENDTRIVDTEMASSVSMVLAYV-------RTFSGPFLSETEVPLEPFTTEPGATGTAD 117
              N+        A  V+   A+             P   + E  +E         G  D
Sbjct: 406 ARINELGYNLDTWAGRVADRRAHAIVDNLASYVVGVPGDVDVEETVEATVEGVTIRGRMD 465

Query: 118 ILIFNSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
            L        + D K G G        +N QL  Y    +     +          I   
Sbjct: 466 RLEHVDEGVRVTDLKTGKGGYTKASVRDNPQLAAYQMALIASGRSV------AGARIALL 519

Query: 176 RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV 235
                  +++  +   +L +     +E    A     +          + ++CR+C    
Sbjct: 520 GGAKPQILDQPPLRGQELEKWLDCVREVALGARGPYFQAR-------PSQEACRYCSFDR 572

Query: 236 RCPALSR 242
            CPA  R
Sbjct: 573 LCPARER 579


>gi|108759273|ref|YP_630123.1| hypothetical protein MXAN_1877 [Myxococcus xanthus DK 1622]
 gi|108463153|gb|ABF88338.1| conserved domain protein [Myxococcus xanthus DK 1622]
          Length = 391

 Score =  115 bits (289), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/295 (14%), Positives = 86/295 (29%), Gaps = 35/295 (11%)

Query: 3   HHAFLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAE--- 57
            H  LS S   R+  CP++  L    K      +  S G   H +L   L++ +D E   
Sbjct: 7   QH--LSYSRLSRFEACPLSYQLHYLDKRTAEPGVPLSFGKALHAVLERLLQEVIDTEYVG 64

Query: 58  --TVSHQKLTFENDTRI-------VDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT 108
             +       +  +          V  +    +   +          +   E        
Sbjct: 65  RLSEERALQLYREEWAASGLSGLDVFQQGLRILQDFVRQQGRVDCRDILAVEKEFRLPVG 124

Query: 109 EPGATGTADILI-FNSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRP 165
                G  D +   +     ++D+K         + +++ QL LYA  A   +       
Sbjct: 125 PFTVLGFIDRVDWVDDETVHVMDYKSNHQLFTREELDSSLQLSLYALAARRMWPW----A 180

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
           + + L++   R      + E   + + L       +  G            +       +
Sbjct: 181 KKVRLSMWMLRH---GVLQETTRTEEQLEAALAYVETLGQQM-------ETAESFPARLN 230

Query: 226 DSCRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDE 280
            +C +C  +  CPA ++   LE  +      T +L         +    K     
Sbjct: 231 PNCVYCDHRRDCPAYAQA--LEGRRGVVCEDTSDLESVARERQEVAHLAKILGAR 283


>gi|145225244|ref|YP_001135922.1| UvrD/REP helicase [Mycobacterium gilvum PYR-GCK]
 gi|145217730|gb|ABP47134.1| UvrD/REP helicase [Mycobacterium gilvum PYR-GCK]
          Length = 1038

 Score =  115 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/254 (18%), Positives = 73/254 (28%), Gaps = 30/254 (11%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIY-ASEGTFAHNL------LAHCLEQGVDAETV 59
            LS S+      CP+   LE           ++ G+  H L          L   +D    
Sbjct: 789  LSPSTLQMLADCPLRWLLERHGGARGRDVRSTLGSLVHALVSESGTAESVL---LDELDK 845

Query: 60   SHQKLTFENDTRIVDT-----EMASSVSMVLAYVRTFSGPFLSETEVPL-----EPFTTE 109
               KL F+      +      EM ++     +  R       +E +V       E     
Sbjct: 846  VWGKLPFDAQWHSDNERIRHLEMLATFLKWRSDTRGELTEVGTEIDVDGVVAGGEGDGPG 905

Query: 110  PGATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
                G  D L  +   + ++VD K G        A+ + QL +Y        G I    E
Sbjct: 906  VRVRGRLDRLERDSEGRLVVVDVKTGKSPVSKDDAQAHAQLAMYQLAVAA--GLIADGDE 963

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                 ++     TG    E             E +E     +   +            +D
Sbjct: 964  PGGGRLVYLGKTTGGRATERHQD-----AVTPEVRELWEARVHEAAAATQGPSFVARVND 1018

Query: 227  SCRFCRAKVRCPAL 240
             C  C  +  CPA 
Sbjct: 1019 GCAHCPVRATCPAQ 1032


>gi|324998799|ref|ZP_08119911.1| RecB family exonuclease [Pseudonocardia sp. P1]
          Length = 251

 Score =  115 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/242 (16%), Positives = 64/242 (26%), Gaps = 44/242 (18%)

Query: 29  PQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSV------- 81
           P+  S     GT  H +L   L +                    +   +  +V       
Sbjct: 1   PEPPSRAQVRGTLVHAVLER-LSRCRRPSAPGGGTCPARPCWDELSAGLGDAVTGGPLFT 59

Query: 82  --------------SMVLAYVRTFSGPFLS-------ETEVPLEPFTTEPGATGTADILI 120
                         + +L    T   P            E  L+         G  D L 
Sbjct: 60  GPGDPELAVWLDSAAGLLDTYFTLEDPAEVPAVAVEERVETSLDGADGVVPLRGIVDRLD 119

Query: 121 FN-STQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIFGRPEALTLTIIQPRV 177
            +      +VD+K GA      E +   QL  YA   L   G +      L L+      
Sbjct: 120 ESPDGTLRVVDYKTGATPGEGFEGSVLFQLKFYALTVLLTRGRVPDELRLLYLS------ 173

Query: 178 RTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
                   +    D+L   A+          S   + A + +       +CR C  +  C
Sbjct: 174 --DGTALTYRPDEDELHRFARLL----DAVWSAIRRAAPTGDFRPNRGRACRTCDHRAHC 227

Query: 238 PA 239
           PA
Sbjct: 228 PA 229


>gi|254776586|ref|ZP_05218102.1| helicase, UvrD/Rep family protein [Mycobacterium avium subsp. avium
           ATCC 25291]
          Length = 655

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/252 (16%), Positives = 72/252 (28%), Gaps = 21/252 (8%)

Query: 7   LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNL--------LAHCLEQGVDAE 57
           L+ S+      CP+    E         + ++ G+  H L             E      
Sbjct: 405 LTPSTMQTLTDCPLRWLAERHGGTDPRDLRSAIGSVVHALIAQPHRSPAELVAELDRAWR 464

Query: 58  TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT---EPGATG 114
            +        ++       M  + +   A  R        E E+     T    E    G
Sbjct: 465 HLPFAAQWHSDNELARHRAMLEAFAQWRANTRGALTEVGVEVEIDGTLSTGDGREVRLRG 524

Query: 115 TADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALH-QYGDIFGRPEALTL 170
             D +  ++  + +IVD K G        A+ + QL LY     H   G   G  E    
Sbjct: 525 RVDRVERDAAGRLVIVDVKTGKTPVSKDDAQQHAQLALYQLAVAHGLLGAAGGDAEPGGA 584

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRF 230
            ++       S + E                ++   AL   +      +     +D C  
Sbjct: 585 RLVYVGKTAASGVVEREQDP-----LTAAAADQWREALRRAADATAGPQFIARRNDGCTH 639

Query: 231 CRAKVRCPALSR 242
           C  +  CPA + 
Sbjct: 640 CPXRPCCPAHAD 651


>gi|326383309|ref|ZP_08204997.1| UvrD/REP helicase [Gordonia neofelifaecis NRRL B-59395]
 gi|326198059|gb|EGD55245.1| UvrD/REP helicase [Gordonia neofelifaecis NRRL B-59395]
          Length = 1101

 Score =  115 bits (287), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 46/261 (17%), Positives = 72/261 (27%), Gaps = 35/261 (13%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHC--------LEQGVDA- 56
            LS S+     KC +   LE        +  A  GT  H L+           +   +   
Sbjct: 840  LSPSNVDALTKCSLRWMLERHGGRDGDAEQAVTGTLVHTLVQAVAGNLDRTEVNAALHEV 899

Query: 57   -ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE------ 109
             E VS     +          M ++    L   R        E EV     T        
Sbjct: 900  WERVSSPAQWYSARELERAEGMLTNFRDWLRISREDLTAAGVEVEVDATLPTGVDDHGNA 959

Query: 110  ---PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGAL----HQYG 159
                   G  D L  +S  + ++VD K G      V AE + QL  Y            G
Sbjct: 960  LLPVRLVGRMDRLETDSRGRPVVVDVKTGKNPVRAVDAEVHPQLATYQLALRLGGVTGLG 1019

Query: 160  DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
                    L       +    +   +  ++ + + E     +E         ++ +V   
Sbjct: 1020 STEPGGGRLVYVASANKKTGAAQRVQPPLTPEQVDEWISVVRE--------AARASVGPV 1071

Query: 220  HYGVNDDSCRFCRAKVRCPAL 240
                 +  C  C     CPA 
Sbjct: 1072 FTATPNSGCSHCSLVQSCPAQ 1092


>gi|118466579|ref|YP_883296.1| helicase, UvrD/Rep family protein [Mycobacterium avium 104]
 gi|118167866|gb|ABK68763.1| helicase, UvrD/Rep family protein [Mycobacterium avium 104]
          Length = 1042

 Score =  115 bits (287), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/252 (17%), Positives = 72/252 (28%), Gaps = 21/252 (8%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNL--------LAHCLEQGVDAE 57
            L+ S+      CP+    E         + ++ G+  H L             E      
Sbjct: 792  LTPSTMQTLTDCPLRWLAERHGGTDPRDLRSAIGSVVHALIAQPHRSPAELVAELDRAWR 851

Query: 58   TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT---EPGATG 114
             +        ++       M  + +   A  R        E E+     T    E    G
Sbjct: 852  HLPFAAQWHSDNELARHRAMLEAFAQWRANTRGALTEVGVEVEIDGTLSTGDGREVRLRG 911

Query: 115  TADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALH-QYGDIFGRPEALTL 170
              D L  ++  + +IVD K G        A+ + QL LY     H   G   G  E    
Sbjct: 912  RVDRLERDAAGRLVIVDVKTGKTPVSKDDAQQHAQLALYQLAVAHGLLGAAGGDAEPGGA 971

Query: 171  TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRF 230
             ++       S + E                ++   AL   +      +     +D C  
Sbjct: 972  RLVYVGKAAASGVVEREQDP-----LTAAAADQWREALRRAADATAGPQFIARRNDGCTH 1026

Query: 231  CRAKVRCPALSR 242
            C  +  CPA + 
Sbjct: 1027 CPLRPCCPAHAD 1038


>gi|25027346|ref|NP_737400.1| putative helicase [Corynebacterium efficiens YS-314]
 gi|259506515|ref|ZP_05749417.1| helicase [Corynebacterium efficiens YS-314]
 gi|23492627|dbj|BAC17600.1| putative helicase [Corynebacterium efficiens YS-314]
 gi|259165935|gb|EEW50489.1| helicase [Corynebacterium efficiens YS-314]
          Length = 1024

 Score =  114 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 46/257 (17%), Positives = 69/257 (26%), Gaps = 18/257 (7%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHCLEQGVDAE------TV 59
            LS S     + CP+  +L+       T I    GT  H                      
Sbjct: 767  LSPSRIEALMNCPLRASLDRLDSEDETPIAMLRGTLVHAFAEAVARGADPERAGEMVTEA 826

Query: 60   SHQKLTFENDTRIVDTEMASSV----SMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGT 115
                    + +R    +            L   R       +E EV +   +TE G  G 
Sbjct: 827  YMDLANVPSWSRETTEQDFRRTITRTHTWLQTSRVTFDLVGTEMEVEV-GISTEVGIRGR 885

Query: 116  ADILIFNS-TQWIIVDFKYGAGVPVK--AENNTQLMLYACGALHQY---GDIFGRPEALT 169
             D L  N   + +IVD K G    V+     + QL  Y             +       T
Sbjct: 886  MDRLERNHAGELVIVDLKTGRQAAVQKDMGEHAQLASYQLALSRGVLHGDRVEDPAPGET 945

Query: 170  LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
               +   V      +   I+  D   K  E  +     L   +            + +C 
Sbjct: 946  PEPVGGGVLVYPAHDAKGITTRDQAAKTPEELDELAALLPELAHLRRGPNLLARVNPTCG 1005

Query: 230  FCRAKVRCPALSRHVLL 246
             C  K  CP      L+
Sbjct: 1006 NCPVKSLCPVQPEGRLI 1022


>gi|19552001|ref|NP_600003.1| putative helicase [Corynebacterium glutamicum ATCC 13032]
 gi|62389664|ref|YP_225066.1| helicase, UVRD/REP family [Corynebacterium glutamicum ATCC 13032]
 gi|21323541|dbj|BAB98168.1| Superfamily I DNA and RNA helicases [Corynebacterium glutamicum ATCC
            13032]
 gi|41324999|emb|CAF19480.1| HELICASE, UVRD/REP FAMILY [Corynebacterium glutamicum ATCC 13032]
          Length = 1016

 Score =  114 bits (285), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 43/266 (16%), Positives = 79/266 (29%), Gaps = 32/266 (12%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHC---LEQGVDAETVSHQ 62
            LS S   + L CP+   L+     + T I   +GT  H         ++  +  E V+  
Sbjct: 759  LSPSRIEQLLNCPLRAVLDRLDSEEETPIAMLKGTLVHAFAEAVAGGVDAALAEEKVTSA 818

Query: 63   KLTFENDTRIVDTEMASSVSMVLAYVRTF-----SGPFLSETEVPLEPFTTE-PGATGTA 116
             +   N           +   +L+   T+     +      TE+ +     +     G  
Sbjct: 819  YMQLANVPSWSRESTEIAFRRILSRTDTWLKTSRADFTEVGTEMDVSVTIDDSVSIRGRM 878

Query: 117  DILIFN-STQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQY-----------GDIF 162
            D L  N S + ++VDFK G          ++ QL  Y                   G+  
Sbjct: 879  DRLERNKSGELVVVDFKTGKTQIAAKDMGDHPQLFAYQLALSKGVLHGDKISDPNPGETP 938

Query: 163  GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
                   L       +      +   + +DL + A          L   ++         
Sbjct: 939  DPVGGGLLVYPATDTKAVGQRMQDPKTQEDLDDFA--------AMLPGLAEHLRGPNLLA 990

Query: 223  VNDDSCRFCRAKVRCPALSRHVLLEA 248
              + +C  C  +  CP      ++ A
Sbjct: 991  RVNPTCSTCPVRSLCPVQPEGRVIHA 1016


>gi|296169028|ref|ZP_06850690.1| UvrD/Rep family helicase [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295896287|gb|EFG75946.1| UvrD/Rep family helicase [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 638

 Score =  114 bits (285), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 40/258 (15%), Positives = 69/258 (26%), Gaps = 27/258 (10%)

Query: 7   LSASSSHRWLKCPIAPTLESKIPQTTSIYASE---GTFAHNLL--------AHCLEQGVD 55
           L+ S+      CP+    E      T+  A     G+  H LL            E    
Sbjct: 390 LTPSTLQMLNDCPLRWLAERHG--GTNPRALRSTIGSLLHALLAEPGRTESELLAELDRA 447

Query: 56  AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVP----LEPFTTEPG 111
              +  +      +       M  +     A  R        E E+           E  
Sbjct: 448 WRHLPFEAEWHSANELARHRAMIEAFLEWRAQTRGALTEVGVEVEIDGALAASGDRGEVR 507

Query: 112 ATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
             G  D L  ++  + +IVD K G        A+ + QL +Y        G +    E  
Sbjct: 508 LRGRVDRLERDAAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAE--GLVDAGTEPG 565

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
              ++       S + E               ++     +   ++           +D C
Sbjct: 566 GARLVYLGKTGASGVTEREQDP-----LTPAARDEWRRLVRRAAEATAGPRFVARRNDGC 620

Query: 229 RFCRAKVRCPALSRHVLL 246
             C  +  CPA +     
Sbjct: 621 SHCPLRPSCPAHADGAAQ 638


>gi|145294938|ref|YP_001137759.1| hypothetical protein cgR_0884 [Corynebacterium glutamicum R]
 gi|140844858|dbj|BAF53857.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 1016

 Score =  114 bits (285), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 43/266 (16%), Positives = 80/266 (30%), Gaps = 32/266 (12%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHC---LEQGVDAETVSHQ 62
            LS S   + L CP+   L+     + T I   +GT  H         ++  +  E V+  
Sbjct: 759  LSPSRIEQLLNCPLRAVLDRLDSEEETPIAMLKGTLVHAFAEAVAGGVDAALAEEKVTSA 818

Query: 63   KLTFENDTRIVDTEMASSVSMVLAYVRTF-----SGPFLSETEVPLEPFTTE-PGATGTA 116
             +   N           +   +L+   T+     +      TE+ +     +     G  
Sbjct: 819  YMQLANVPSWSRESTEIAFRRILSRTDTWLKTSRADFTEVGTEMDVSVTIDDSVSIRGRM 878

Query: 117  DILIFN-STQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQY-----------GDIF 162
            D L  N S + ++VDFK G          ++ QL  Y                   G+  
Sbjct: 879  DRLERNKSGELVVVDFKTGKTQIAAKDMGDHPQLFAYQLALSKGVLHGDKISDPNPGETP 938

Query: 163  GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
                   L       +      +   + +DL + A          L   ++       + 
Sbjct: 939  DPVGGGLLVYPATDTKAVGQRMQDPKTQEDLDDFA--------AMLPGLAEHLRGPNLFA 990

Query: 223  VNDDSCRFCRAKVRCPALSRHVLLEA 248
              + +C  C  +  CP      ++ A
Sbjct: 991  RVNPTCSTCSVRSLCPVQPEGRVIHA 1016


>gi|120402800|ref|YP_952629.1| UvrD/REP helicase [Mycobacterium vanbaalenii PYR-1]
 gi|119955618|gb|ABM12623.1| UvrD/REP helicase [Mycobacterium vanbaalenii PYR-1]
          Length = 1038

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 43/254 (16%), Positives = 81/254 (31%), Gaps = 30/254 (11%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIY-ASEGTFAHNLL------AHCLEQGVDA--E 57
            LS S+      CP+   LE           ++ G+  H L+         L  G++   E
Sbjct: 790  LSPSTLQMLSDCPLRWLLERHGGSRGRDVRSTLGSLVHALVSESGRTESQLLNGLEKVWE 849

Query: 58   TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPL-----EPFTTEPGA 112
             +      + ++ R+   EM S+        R       +E EV       +        
Sbjct: 850  ELPFDAQWYSDNERVRHLEMLSTFLRWREGTRGELTEVGTEIEVDGQIAAPDGELPAVRL 909

Query: 113  TGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQY---GDIFGRPE 166
             G  D L  +   + +++D K G        A+++ QL +Y           GD  G   
Sbjct: 910  RGRLDRLERDSEGRLVVIDLKTGKSPVSKDDAQSHAQLAMYQLAVAAGLLADGDEPGGGR 969

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
             + L   +      +  ++  ++ D   E  ++            +      +     +D
Sbjct: 970  LVYLG--KTTGGGATERHQDALTPDGRAEWDEQVHR--------AAAATQGPQFTARVND 1019

Query: 227  SCRFCRAKVRCPAL 240
             C  C  +  CPA 
Sbjct: 1020 GCAHCPVRAMCPAQ 1033


>gi|296130311|ref|YP_003637561.1| UvrD/REP helicase [Cellulomonas flavigena DSM 20109]
 gi|296022126|gb|ADG75362.1| UvrD/REP helicase [Cellulomonas flavigena DSM 20109]
          Length = 1076

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/254 (15%), Positives = 71/254 (27%), Gaps = 23/254 (9%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYAS-EGTFAHNLLAHCLEQGV----DAETVS 60
             +S S      +C +   LE+      S      GT  H +        +          
Sbjct: 823  PVSPSRLETAQRCTLRWALEAAGGTPASSAQQSLGTLVHAIAQDHPTADLPTLRAELDRR 882

Query: 61   HQKLTFENDTRIVDTEM--ASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
              +L   +    V       + +  + AY+R    P L E        T      G+ D 
Sbjct: 883  GAELALGDGWPAVAARRKADAMLERLAAYLRGAGEPLLVEAP--FAVETDRAVVRGSIDR 940

Query: 119  LIFN-------STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALH-QYGDIFGRPEAL 168
            +          S    +VD K G+ VP  A+   + QL  Y           +     ++
Sbjct: 941  VERALVEGDGASGAVEVVDLKTGSRVPSVAQAAEHAQLGAYQLAVDAGAVPGLAPGTHSV 1000

Query: 169  TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
               ++     +G P         + L   +         +   + R  +       ++ C
Sbjct: 1001 GARLVHLAHGSGGP----TQRRQEGLGPEETGPSWARELVDEVADRMAAASFEARGNELC 1056

Query: 229  RFCRAKVRCPALSR 242
              C  +  CP    
Sbjct: 1057 DRCPVRRACPLRGE 1070


>gi|319950043|ref|ZP_08024011.1| ATP-dependent DNA helicase [Dietzia cinnamea P4]
 gi|319436293|gb|EFV91445.1| ATP-dependent DNA helicase [Dietzia cinnamea P4]
          Length = 445

 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 50/257 (19%), Positives = 74/257 (28%), Gaps = 23/257 (8%)

Query: 5   AFLSASSSHRWLKCPIAPTLESKIPQTT--SIYA--SEGTFAHNLLAHCLEQGVDAETVS 60
           A LS S      +CP+   L+S    ++     A    G+  H L    +E G+D +T+ 
Sbjct: 191 AVLSPSGFGALEECPLRWFLQSVGGDSSDAGSAAPLVRGSAVHALTQ-AVEGGIDEDTIR 249

Query: 61  ------HQKLTFENDT--RIVDTEMASSVSMVLAYVRTFSGPFLSE-TEVPLEPFTTE-P 110
                  + LT             M         +  +    + +   E P E       
Sbjct: 250 SAVRRRAEALTLSRGWFAERGAETMVEMAETFRRWRSSTRDEYTTAAVEEPFEFDAGGGV 309

Query: 111 GATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIFGRPEA 167
              G  D L   S  Q + VD K  A    K +   N QL LY            G  E 
Sbjct: 310 RVRGRIDRLEATSAGQVVPVDVKTSAAAASKKDAAVNPQLALYQLAVARGAVAAAGGREP 369

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
               ++    R G    E V           +  E     +    +  V   +       
Sbjct: 370 GGGLLLYLAGREGRLPTERVQDP-----LGTDGAEALVDRVQEAGRATVGPRYTARVGRW 424

Query: 228 CRFCRAKVRCPALSRHV 244
           C  C  +  CPA     
Sbjct: 425 CEHCSVRSSCPAQPEGK 441


>gi|269955586|ref|YP_003325375.1| UvrD/REP helicase [Xylanimonas cellulosilytica DSM 15894]
 gi|269304267|gb|ACZ29817.1| UvrD/REP helicase [Xylanimonas cellulosilytica DSM 15894]
          Length = 1197

 Score =  113 bits (282), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/250 (14%), Positives = 62/250 (24%), Gaps = 24/250 (9%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIY-ASEGTFAHNLLAHC-------LEQGVDAE 57
             +S S       C +  + E+           + GT  H +           L+  +D  
Sbjct: 953  PVSPSKVETVTTCALRWSFEAAGGTAADDQNQTLGTLVHAIAEALPTGSLSALKAELDRR 1012

Query: 58   TVSHQKL--TFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGT 115
                           R    +M   ++  LA             E   +         G 
Sbjct: 1013 WPQLALPPGWPARQLRQRAEQMIEHLATYLA-----DAGSPLAVEAEFDVEVGRARLRGK 1067

Query: 116  ADILIFN-STQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIFGRPEALTLTI 172
             D +        I+ D K G   P   ++  + QL  Y         D   R     L  
Sbjct: 1068 VDRVEDAGDGAAIVADLKTGRKAPTVDQSVTHPQLGAYQLAVEAGAIDGATRSAGARLVF 1127

Query: 173  IQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCR 232
            +      G+   +  +     L    +     +  +   +    S       +D C  C 
Sbjct: 1128 V------GTDTKKPTMRVQPALAPEPDGSSWASALVEGAADTMASERFAAHPNDLCPMCP 1181

Query: 233  AKVRCPALSR 242
             +  CP    
Sbjct: 1182 VRRSCPLQPE 1191


>gi|41409399|ref|NP_962235.1| hypothetical protein MAP3301c [Mycobacterium avium subsp.
            paratuberculosis K-10]
 gi|41398230|gb|AAS05851.1| hypothetical protein MAP_3301c [Mycobacterium avium subsp.
            paratuberculosis K-10]
          Length = 1044

 Score =  113 bits (282), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 43/252 (17%), Positives = 72/252 (28%), Gaps = 21/252 (8%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNL--------LAHCLEQGVDAE 57
            L+ S+      CP+    E         + ++ G+  H L             E      
Sbjct: 794  LTPSTMQTLTDCPLRWLAERHGGTDPRDLRSAIGSVVHALIAQPHRSPAELVAELDRVWR 853

Query: 58   TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT---EPGATG 114
             +        ++       M  + +   A  R        E E+     T    E    G
Sbjct: 854  HLPFAAQWHSDNELARHRAMLEAFAQWRANTRGALTEVGVEVEIDGTLSTGDGREVRLRG 913

Query: 115  TADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALH-QYGDIFGRPEALTL 170
              D L  ++  + +IVD K G        A+ + QL LY     H   G   G  E    
Sbjct: 914  RVDRLERDAAGRLVIVDVKTGKTPVSKDDAQQHAQLALYQLAVAHGLLGAAGGDAEPGGA 973

Query: 171  TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRF 230
             ++       S + E                ++   AL   +      +     +D C  
Sbjct: 974  RLVYVGKAAASGVVEREQDP-----LTAAAADQWREALRRAADATAGPQFIARRNDGCTH 1028

Query: 231  CRAKVRCPALSR 242
            C  +  CPA + 
Sbjct: 1029 CPLRPCCPAHAD 1040


>gi|256374968|ref|YP_003098628.1| hypothetical protein Amir_0821 [Actinosynnema mirum DSM 43827]
 gi|255919271|gb|ACU34782.1| hypothetical protein Amir_0821 [Actinosynnema mirum DSM 43827]
          Length = 279

 Score =  112 bits (281), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 38/267 (14%), Positives = 65/267 (24%), Gaps = 32/267 (11%)

Query: 6   FLSASSSHRWLKCPIAPTL---ESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVS 60
            ++ +    W  CP    +   +   P     +A  + G   HN L    +      +  
Sbjct: 18  RVTPAKLATWADCPRRFRMAYVDRPSPGRGGPWAHSAMGAAVHNALKALFDLPPAQRSPD 77

Query: 61  HQKLTFENDT-----------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE 109
                                       A  V   +  + T   P     E  +   T  
Sbjct: 78  RSVALLNRAWKSDGFQDAEQSWRYRDRAAGWVRDYVETLDTTIDP--IGVERWVSAPTGT 135

Query: 110 PGATGTADILIFNSTQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQYGDIFGRPEA 167
             A G  D +     + +IVD+K G        A  +  L LYA  A         R E 
Sbjct: 136 IVAEGRVDRIDLRGDELVIVDYKTGKHALSTDDARGSQALALYAVAARRTLRKPCARVEL 195

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSL----KSKRAVSLEHYGV 223
             L            +  W  + + +       +E     +       +       +   
Sbjct: 196 HHL--------PTGSVAVWEHTEESIGRHVARAEEAADDIVLAESTLAAGADRDEVYPPR 247

Query: 224 NDDSCRFCRAKVRCPALSRHVLLEATK 250
               C +C  +  CP            
Sbjct: 248 VGRQCSWCDFRRHCPEGQEAAPTLEPW 274


>gi|291006368|ref|ZP_06564341.1| ATP-dependent DNA helicase [Saccharopolyspora erythraea NRRL 2338]
          Length = 1058

 Score =  112 bits (280), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/251 (17%), Positives = 75/251 (29%), Gaps = 21/251 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLL--------AHCLEQGVDA 56
             +S S+     KCP+    E    Q T+   +  GT  H L+           L + +D 
Sbjct: 801  RVSPSTVDTLSKCPLRWMAERHGGQDTAELASVTGTLVHALVQAAADGATEEQLHRALDE 860

Query: 57   --ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE----P 110
              E+V      F    R     M  S    L   R        E ++ L     +     
Sbjct: 861  AWESVDAGAPWFSRKERARVERMIESFQAWLVASRAELTQVGVERDLDLTIEGRDGGPSL 920

Query: 111  GATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEA 167
               G  D L  +   + ++VD K G        AE + QL +Y   A     +     E 
Sbjct: 921  RLRGRVDRLEADGEGRPVVVDVKTGKTPVSKNDAEEHPQLAVYQLAAALGAFNDGAWTEP 980

Query: 168  LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
                ++               +        ++  +     +   +  +V   +    +  
Sbjct: 981  GGARLLYVAKPEA---RTGAATERVQRGLDRDRVQVWLDVVHDAAASSVGPAYVASENAD 1037

Query: 228  CRFCRAKVRCP 238
            C  C A+  CP
Sbjct: 1038 CPRCPARTCCP 1048


>gi|134097673|ref|YP_001103334.1| ATP-dependent DNA helicase [Saccharopolyspora erythraea NRRL 2338]
 gi|133910296|emb|CAM00409.1| possible ATP-dependent DNA helicase [Saccharopolyspora erythraea NRRL
            2338]
          Length = 1051

 Score =  112 bits (280), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/251 (17%), Positives = 75/251 (29%), Gaps = 21/251 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLL--------AHCLEQGVDA 56
             +S S+     KCP+    E    Q T+   +  GT  H L+           L + +D 
Sbjct: 794  RVSPSTVDTLSKCPLRWMAERHGGQDTAELASVTGTLVHALVQAAADGATEEQLHRALDE 853

Query: 57   --ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE----P 110
              E+V      F    R     M  S    L   R        E ++ L     +     
Sbjct: 854  AWESVDAGAPWFSRKERARVERMIESFQAWLVASRAELTQVGVERDLDLTIEGRDGGPSL 913

Query: 111  GATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEA 167
               G  D L  +   + ++VD K G        AE + QL +Y   A     +     E 
Sbjct: 914  RLRGRVDRLEADGEGRPVVVDVKTGKTPVSKNDAEEHPQLAVYQLAAALGAFNDGAWTEP 973

Query: 168  LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
                ++               +        ++  +     +   +  +V   +    +  
Sbjct: 974  GGARLLYVAKPEA---RTGAATERVQRGLDRDRVQVWLDVVHDAAASSVGPAYVASENAD 1030

Query: 228  CRFCRAKVRCP 238
            C  C A+  CP
Sbjct: 1031 CPRCPARTCCP 1041


>gi|257068317|ref|YP_003154572.1| DNA/RNA helicase, superfamily I [Brachybacterium faecium DSM 4810]
 gi|256559135|gb|ACU84982.1| DNA/RNA helicase, superfamily I [Brachybacterium faecium DSM 4810]
          Length = 1058

 Score =  112 bits (280), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/254 (18%), Positives = 76/254 (29%), Gaps = 25/254 (9%)

Query: 6    FLSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHCLEQGVDAE------- 57
             LS S+  R + CP +  +E     +        GT  H+L         DAE       
Sbjct: 809  RLSPSALERAVDCPQSWLMERAGGTRAGGPAQLIGTALHHLAQVHPRGPADAEEDLLAEL 868

Query: 58   -TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTA 116
             T+       E  +       A   + +LA     +G      E P E         G+ 
Sbjct: 869  HTLLRAVPGTETWSGRRRVRRAEDAARLLAAHLRSAGEP-LAVEAPFEVELGRVQLRGSI 927

Query: 117  DILIFNSTQWIIVDFKYGA--GVPVKAENNTQLMLYACGALH------QYGDIFGRPEAL 168
            D +  + T   +VD K G       KAE + QL  Y               D   R    
Sbjct: 928  DRIEGDPTGLHVVDLKTGRAAKSAAKAEEDLQLAAYQAAVREGALTEQLGPDAPERLIGA 987

Query: 169  TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
             L  +    +  +   +  +S  +      +  ++ +  +S  +  A         +  C
Sbjct: 988  QLVYVGTGGKKAAVRTQTALSRAEDPAWFDDLVQQVSREVSGTAVTA-------RVNAHC 1040

Query: 229  RFCRAKVRCPALSR 242
              C  +  CP    
Sbjct: 1041 THCAVRSSCPLQPE 1054


>gi|269218750|ref|ZP_06162604.1| helicase, UvrD/Rep family [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269211861|gb|EEZ78201.1| helicase, UvrD/Rep family [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 1079

 Score =  112 bits (280), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 74/255 (29%), Gaps = 23/255 (9%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSI--YASEGTFAHNLLAHCL----EQGVDAETV 59
             +S S     L CP+   L     + +     A  GT  H +         E+ +     
Sbjct: 833  VVSPSRVETMLDCPLRGFLSLVGAEDSDDRRTADIGTLVHAIAERSAGASREEIMGDFEA 892

Query: 60   SHQKLTFENDTRIVDTEMASS------VSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT 113
            S        D      E A +      ++  L       G    E  + ++        +
Sbjct: 893  SWAAFDKPEDPVAAQAEYARARILVEGLASYLEDFARGGGSAEVERRISVDME-DGVVLS 951

Query: 114  GTADILIFNSTQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEALTLT 171
            G  D +  +     IVDFK G       +AE+N QL LY            G    + L 
Sbjct: 952  GKIDRVEHDGAARRIVDFKTGKHTVSAKQAEDNVQLQLYQWAMGKSGLPADGGAALVYL- 1010

Query: 172  IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
                     +     + +  +      E K      L    +     E       +CR C
Sbjct: 1011 -------GQTLKKTNLPAQREQRPLGPEGKALAEERLRQAGRLLQGGEFPARPSQACRTC 1063

Query: 232  RAKVRCPALSRHVLL 246
            R    CPA S+  L 
Sbjct: 1064 RFVSLCPAKSQGRLA 1078


>gi|311739799|ref|ZP_07713633.1| probable helicase [Corynebacterium pseudogenitalium ATCC 33035]
 gi|311304872|gb|EFQ80941.1| probable helicase [Corynebacterium pseudogenitalium ATCC 33035]
          Length = 1035

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 72/256 (28%), Gaps = 18/256 (7%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTS-IYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
            LS S     L CP+   L +     ++  +   GT AH             +        
Sbjct: 781  LSPSRVEALLNCPLKAVLGNVAEDPSTEEHLLRGTLAHAFFEAIGRGMDAEKAKLLVMEA 840

Query: 66   FENDTRIVDTEMASSVSMV---LAYVRTFSGPFLSETE---VPLEPFTT---EPGATGTA 116
            FE    +   ++   +      L   R ++       E   V +        E    G  
Sbjct: 841  FERIQDVPQWQLRFRLDEFSTLLDRAREWARQSEVNQELAGVEIPVGVRVSEEVRIGGYM 900

Query: 117  DILIFN-STQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQY--GDIFGRPEALTLT 171
            D L+ +    +++VD K G   P   + E++ QLM Y     H    G      E +   
Sbjct: 901  DRLLRDGEGNYLVVDLKTGRSKPAKKEGEDHVQLMTYQLALAHGAFDGHQVHDGEGMPRQ 960

Query: 172  IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
                     +      I   D   K+ E  E     L    +           +  C  C
Sbjct: 961  GGVLVYPGATTKKIGEIWQSD---KSPEALEEFAALLPPLVEEMRGPRITARTNKDCDKC 1017

Query: 232  RAKVRCPALSRHVLLE 247
              +  CP      +  
Sbjct: 1018 PIRSICPVQEEGRMTT 1033


>gi|257054746|ref|YP_003132578.1| DNA/RNA helicase, superfamily I [Saccharomonospora viridis DSM 43017]
 gi|256584618|gb|ACU95751.1| DNA/RNA helicase, superfamily I [Saccharomonospora viridis DSM 43017]
          Length = 1066

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/255 (16%), Positives = 70/255 (27%), Gaps = 23/255 (9%)

Query: 6    FLSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLL--------AHCLEQGVDA 56
             +S S     +KCP+   LE         + A  GT  H L            L + +D 
Sbjct: 810  RVSPSVVDTLVKCPLRWLLERHGGTDPAQLSAVTGTLVHALAQAAAEGTDEQTLWKELDE 869

Query: 57   E--TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE----P 110
                V      F    R+    M  S    L   R        E ++ +     E     
Sbjct: 870  AWAKVDAGAPWFSRKERVRVEGMVRSFLTWLRQSRDELTQHAVEQDMRVSLPEAEGEPSV 929

Query: 111  GATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEA 167
              TG  D L  +   + +++D K          A  + QL +Y    L        +   
Sbjct: 930  ALTGRVDRLELDAEGRPVVIDLKTSKSPVAKDAAAEHPQLAVYQLATL-LGAFSGHKGHT 988

Query: 168  LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
                ++               +  +     +E   R    +   +   V   +    +  
Sbjct: 989  GGARLLYVGKPNAKT----GATVREQPALDEETARRWLNEVRKAAVDTVGPTYPVRENVD 1044

Query: 228  CRFCRAKVRCPALSR 242
            C  C ++  CP    
Sbjct: 1045 CSRCPSRSACPLRPE 1059


>gi|269127955|ref|YP_003301325.1| UvrD/REP helicase [Thermomonospora curvata DSM 43183]
 gi|268312913|gb|ACY99287.1| UvrD/REP helicase [Thermomonospora curvata DSM 43183]
          Length = 1059

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/258 (14%), Positives = 64/258 (24%), Gaps = 33/258 (12%)

Query: 7    LSASSSHRWLKCPIAPTL------ESKIPQTTSIYASEGTFAHNLLA------HCLEQGV 54
            +S S    +  C +   L          P      A+ G   H +           E+ V
Sbjct: 807  ISPSQVETFTTCGLRWLLASAVGARDGGPD---ELATMGKVVHAVAELAGSHGDLAEEDV 863

Query: 55   DAETVSHQKLTFENDTR---IVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPG 111
                    K      +        + A  V   LA+ R      L   E   +       
Sbjct: 864  AQRLDEIWKELNFGSSWYSGKQREQAAKMVDKFLAWHRANPNE-LVALEEDFQVELGRVV 922

Query: 112  ATGTADILIFNS-TQWIIVDFKY--GAGVPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              G  D    +   + ++VD K         +   + QL +Y            G  E  
Sbjct: 923  IRGRIDRAERDEHGRAVVVDIKTSAQKVPDKELARHPQLGVYQYAVTLGALQRHGLVEPG 982

Query: 169  TLTIIQP----RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVN 224
               ++Q              +   + D   +  K+  E         +            
Sbjct: 983  GAVLVQVGKGSYENKAREQRQPPPAEDGDPDWPKKLVEVV-------ATGMAGEVFQARP 1035

Query: 225  DDSCRFCRAKVRCPALSR 242
            +D CR C  +  CP    
Sbjct: 1036 NDKCRTCPVRSCCPVHDE 1053


>gi|255323799|ref|ZP_05364925.1| helicase, uvrd/rep family [Corynebacterium tuberculostearicum SK141]
 gi|255298979|gb|EET78270.1| helicase, uvrd/rep family [Corynebacterium tuberculostearicum SK141]
          Length = 1027

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 72/256 (28%), Gaps = 18/256 (7%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTS-IYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
            LS S     L CP+   L +     ++  +   GT AH             +        
Sbjct: 773  LSPSRVEALLNCPLKAVLGNVAEDPSTEEHLLRGTLAHAFFEALGRGMDAEKAKLLVMEA 832

Query: 66   FENDTRIVDTEMASSVSMV---LAYVRTFSGPFLSETE---VPLEPFTT---EPGATGTA 116
            FE    +   ++   +      L   R ++       E   V +        E    G  
Sbjct: 833  FERIQDVPQWQLRFKLDEFSTLLDRAREWACQSEVNQELAGVEIPVGVRVSEEVRIGGYM 892

Query: 117  DILIFN-STQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQY--GDIFGRPEALTLT 171
            D L+ +    +++VD K G   P   + E++ QLM Y     H    G      E +   
Sbjct: 893  DRLLRDEEGNYLVVDLKTGRSKPAKKEGEDHVQLMTYQLALAHGAFDGHQVHDGEGMPRQ 952

Query: 172  IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
                     +      I   D   K+ E  E     L    +           +  C  C
Sbjct: 953  GGVLVYPGATTKKIGEIWQSD---KSPEALEEFAALLPPLVEEMRGPRITARTNKDCDKC 1009

Query: 232  RAKVRCPALSRHVLLE 247
              +  CP      +  
Sbjct: 1010 PIRSICPVQEEGRMTT 1025


>gi|117928983|ref|YP_873534.1| UvrD/REP helicase [Acidothermus cellulolyticus 11B]
 gi|117649446|gb|ABK53548.1| UvrD/REP helicase [Acidothermus cellulolyticus 11B]
          Length = 1095

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/246 (16%), Positives = 76/246 (30%), Gaps = 26/246 (10%)

Query: 6    FLSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHC-LEQGVDAETVSHQK 63
             +S S    + +CP+   LES      +S     GT  H   A   ++     E +    
Sbjct: 853  PVSPSRLELFTRCPLRWLLESCGGRGRSSASQVVGTAVHRAAATFSVDVAQLRERLDAAL 912

Query: 64   LTFENDTRIVDTEMASSVSMVLAY---VRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
               +  T           + ++         +   L   E   +        TG  D L 
Sbjct: 913  ADTDLGTGWFAAAQRDRAAAMVERLAAWMARNPRRLLAVERDFQVTVGRALLTGRVDRLE 972

Query: 121  -FNSTQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRV 177
              +  +  +VD K G     KA+   + QL  Y                 +     + R 
Sbjct: 973  QDDDGRLYVVDLKTGRRAVRKADLAEHPQLGAYQVAV-------------VEGAFDEGRT 1019

Query: 178  RTGSPINEWVISADDLLEKAKEFKERGTLALSLK-----SKRAVSLEHYGVNDDSCRFCR 232
              G+ +        + +E  +   E    + + +     ++   +     V +D CRFC 
Sbjct: 1020 PAGAALLFLDEDRPEPVEWGQAPLEAAGGSWAHEMIMKCAEGMAAAVFDAVANDGCRFCP 1079

Query: 233  AKVRCP 238
             ++ CP
Sbjct: 1080 VRICCP 1085


>gi|296138859|ref|YP_003646102.1| UvrD/REP helicase [Tsukamurella paurometabola DSM 20162]
 gi|296026993|gb|ADG77763.1| UvrD/REP helicase [Tsukamurella paurometabola DSM 20162]
          Length = 1094

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/251 (17%), Positives = 71/251 (28%), Gaps = 25/251 (9%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHCLEQGVDAE-------- 57
            LS S+      C +   LE        S   + G   H L+     +    E        
Sbjct: 839  LSPSNVEALSACALRWMLERFGGSDGDSAKQATGNLVHTLVQAVAGRIPKDEVTRSLEKV 898

Query: 58   --TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPL----EPFTTEPG 111
               V  +   F     I   EM  S    LA  R+       E  +           +  
Sbjct: 899  WDRVDLEADWFARRELIRTEEMLESFRAWLAGSRSELTEAGVEVPIDTVIEGTDGAPDVQ 958

Query: 112  ATGTADILIFNS-TQWIIVDFKYGAGVPVKAEN--NTQLMLYACG-ALHQYGDIFGRPEA 167
              G  D L  +   + ++VD K G  +P +A+   + QL  Y    A    G +   P  
Sbjct: 959  IRGRVDRLERDPLGRTVVVDVKTGRTLPSQADGQAHAQLRTYQVAIAHGGLGGVPETPGG 1018

Query: 168  LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
              L  +               +  +         +     +   ++R    E     + S
Sbjct: 1019 GKLLYVAKPHNKTGA------TVREQDALTPADVDEWLGVIREAARRTRGPEFAATLNAS 1072

Query: 228  CRFCRAKVRCP 238
            C+ C     CP
Sbjct: 1073 CQHCAVASCCP 1083


>gi|315445541|ref|YP_004078420.1| DNA/RNA helicase, superfamily I [Mycobacterium sp. Spyr1]
 gi|315263844|gb|ADU00586.1| DNA/RNA helicase, superfamily I [Mycobacterium sp. Spyr1]
          Length = 1038

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/254 (17%), Positives = 72/254 (28%), Gaps = 30/254 (11%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIY-ASEGTFAHNL------LAHCLEQGVDAETV 59
            LS S+      CP+   LE           ++ G+  H L          L   +D    
Sbjct: 789  LSPSTLQMLADCPLRWLLERHGGARGRDVRSTLGSLVHALVSESGTAESVL---LDELDK 845

Query: 60   SHQKLTFENDTRIVDT-----EMASSVSMVLAYVRTFSGPFLSETEVPLEPFT-----TE 109
               KL F+      +      EM ++     +  R       +E +V             
Sbjct: 846  VWGKLPFDAQWHSDNERIRHLEMLATFLKWRSDTRGELTEVGTEIDVDGVVAGGDGDGPG 905

Query: 110  PGATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
                G  D L  +   + ++VD K G        A+ + QL +Y        G I    E
Sbjct: 906  VRVRGRLDRLERDSEGRLVVVDVKTGKSPVSKDDAQAHAQLAMYQLAVAA--GLIADGDE 963

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                 ++     TG    E             E +E     +   +            +D
Sbjct: 964  PGGGRLVYLGKTTGGRATERHQD-----AVTPEVRELWEARVHEAAAATQGPSFVARVND 1018

Query: 227  SCRFCRAKVRCPAL 240
             C  C  +  CPA 
Sbjct: 1019 GCAHCPVRATCPAQ 1032


>gi|262193952|ref|YP_003265161.1| hypothetical protein Hoch_0636 [Haliangium ochraceum DSM 14365]
 gi|262077299|gb|ACY13268.1| conserved hypothetical protein [Haliangium ochraceum DSM 14365]
          Length = 387

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/313 (16%), Positives = 92/313 (29%), Gaps = 35/313 (11%)

Query: 6   FLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETV---- 59
            LS S   R+  CP++  L    K     S+  + G+  H  L H + + +  E V    
Sbjct: 3   RLSFSRLSRYEACPLSYKLHYLDKHEAGDSVPLAFGSAVHAALEHLVREHLAEERVGPLG 62

Query: 60  -SHQKLTFENDTRIVD-------TEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPG 111
                  ++      D        E  + V   +          +   E           
Sbjct: 63  AERAASLWQTAWTESDLAGLSLFREGLALVHRFVREQGVLDHLDVLAVEQEFRITVGGFE 122

Query: 112 ATGTADI-LIFNSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
             G  D     +     +VD+K         + + + Q+ LY   A   +       + +
Sbjct: 123 VLGYLDRVDRVDDETVDVVDYKTNRQLFTRDELDGSLQMSLYQLAAQSLWPW----AKKV 178

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
            LT    R            +++DL    +     G+           + E     + +C
Sbjct: 179 RLTFWMLRHGVQQRT---ERTSEDLEATKRYVATLGSAI-------DRATEFPARLNSNC 228

Query: 229 RFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEM--FKRLN 286
            +C  K  CPA +    LE  +D       +L         + S  K         +R+ 
Sbjct: 229 TWCDHKQHCPAYA--AALEGKRDVVCEDEGDLEAVAREREEVASLAKILYSRKSELERVL 286

Query: 287 AGDEIQGYQLVEG 299
                +  +LV G
Sbjct: 287 KAHLAEQDELVLG 299


>gi|260904112|ref|ZP_05912434.1| UvrD/REP helicase [Brevibacterium linens BL2]
          Length = 1086

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/251 (16%), Positives = 74/251 (29%), Gaps = 23/251 (9%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTT-SIYASEGTFAHNLLAHCLEQGVDAE----TVS 60
             +S S    +  C +   L         S+  S GT  H    +  +    A        
Sbjct: 833  KVSPSQVESFTDCSLRWFLTRNGGDRPGSLAQSLGTIIHAAAENYPQGPASAIREFVDEE 892

Query: 61   HQKLTFENDTRIVDTEMA--SSVSMVLAYVRTFSGPFL-SETEVP---LEPFTTEPGATG 114
             + L F+ +       +        +  Y++   G  +  E +V    ++    E   TG
Sbjct: 893  FKTLDFDAEWERDREHVLAMKMADRLGEYIKDSPGEPIGVEAQVYATGVDENGQEWKVTG 952

Query: 115  TADILIFNSTQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFG----RPEAL 168
              D +        IVDFK G   P   +   + QL +Y          I        +A 
Sbjct: 953  RLDRIERTPEGIRIVDFKTGKNTPTGQEMPRHAQLGVYQEAINSGSITIGDDQVVDAKAY 1012

Query: 169  TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
               ++  R        +  +  D+    A++     +  +      A       V    C
Sbjct: 1013 GAELVFLRYTKQKKREQSALEIDEDPGWARDLINDVSGRMRAAEFPAR------VEPQKC 1066

Query: 229  RFCRAKVRCPA 239
              C  +  CPA
Sbjct: 1067 MSCPVRTSCPA 1077


>gi|227486916|ref|ZP_03917232.1| helicase [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227092990|gb|EEI28302.1| helicase [Corynebacterium glucuronolyticum ATCC 51867]
          Length = 1025

 Score =  110 bits (276), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/265 (16%), Positives = 79/265 (29%), Gaps = 28/265 (10%)

Query: 2    AHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH 61
               A LS S     L+CP+   L S  P  +S    EG   H L    +    D ET   
Sbjct: 756  GQPATLSPSQVESGLQCPLKMVLNSVTPTESSSALREGNLLHALAEASVTLQQDEETWKE 815

Query: 62   QKLTF-----------ENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE- 109
             +                  +  + E    ++  ++ +   +G  L   E+P++    + 
Sbjct: 816  AEQLVLDAYLSSRTVPPWKEKADEEEFVEVMNATVSKMTNLAGD-LVGVEIPMDVTVGQL 874

Query: 110  -----PGATGTADILIFN-STQWIIVDFKYGAGVPVK--AENNTQLMLYACGA----LHQ 157
                     G  D +  +   +  + D K G   P    AE++ Q+ +Y  G     + +
Sbjct: 875  DDGSPIRIKGRLDRVHRDSEGRMKVYDLKTGRSAPTYQEAESHPQMAVYQLGINHSRIQE 934

Query: 158  YGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVS 217
                F   +     +         P +    S   L    ++        L         
Sbjct: 935  NPLEFVTDDGSGGALQSGGAELVYPRSTKKPSQKPL---TEDNARILMDNLRQLVHHTSG 991

Query: 218  LEHYGVNDDSCRFCRAKVRCPALSR 242
                 + +  C  C  ++ CP    
Sbjct: 992  STVPALPNKHCGSCAYRIICPITEE 1016


>gi|284992623|ref|YP_003411177.1| UvrD/REP helicase [Geodermatophilus obscurus DSM 43160]
 gi|284065868|gb|ADB76806.1| UvrD/REP helicase [Geodermatophilus obscurus DSM 43160]
          Length = 1062

 Score =  110 bits (276), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/241 (13%), Positives = 63/241 (26%), Gaps = 13/241 (5%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYAS-EGTFAHNLLAHCLEQGVDAETVSHQKL 64
             +  S+   + +CP+   L +   + +       G+  H +     E    A   +    
Sbjct: 817  RVRPSAIETFQRCPLKWVLGAVGAEASPDATRTVGSAVHAVAQQVAEGLPAAGAPAALAE 876

Query: 65   TFENDTR---IVDTEMASSVSMVLAY---VRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
              +         D     +   +L         +G  L   E   +         G  D 
Sbjct: 877  ELDQLDLGPGWADQRQRIAARDMLDRFLRWHAANGRELLAAEADFDVTVGRARIRGQVDR 936

Query: 119  LIFNS-TQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRV 177
            L  +   + +++D K G       + + QL  Y            G             +
Sbjct: 937  LERDGAGRLVVIDLKTGRSAARDIDTHGQLAAYQVAVAAGAFGEHGEAPGGAAL-----L 991

Query: 178  RTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
            + GS       + D L       +      ++       +          C  C A+  C
Sbjct: 992  QVGSGSKAKEQAQDPLPAGVPVGETWAGELVAQVGDGMGAGTFEVRTGSHCSRCPARRSC 1051

Query: 238  P 238
            P
Sbjct: 1052 P 1052


>gi|169630597|ref|YP_001704246.1| ATP-dependent DNA helicase [Mycobacterium abscessus ATCC 19977]
 gi|169242564|emb|CAM63592.1| Probable ATP-dependent DNA helicase [Mycobacterium abscessus]
          Length = 1058

 Score =  110 bits (275), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 39/262 (14%), Positives = 67/262 (25%), Gaps = 39/262 (14%)

Query: 6    FLSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
             +S S+    + CP+   LE       T    + GT  H L+      GV AE       
Sbjct: 804  RVSPSNVETLMACPLRWMLERHGGTDLTDPRRALGTLVHELV------GVHAEDSDAMCR 857

Query: 65   TFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSE--------TEVPLEPFTTE------- 109
              +     +  E        L         F +         TEV  E            
Sbjct: 858  ALDKAWESMPFESQWYARNELRRHHELLEAFTTWRASTRGELTEVGREIGVDGVLSRAGQ 917

Query: 110  --PGATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGR 164
                  G  D L  +   + +++D K G        A+ + QL  Y   A     +    
Sbjct: 918  PQVRLVGRIDRLERDAEGRPVVIDIKTGKSPATKDDAQQHAQLAAYQVAAAEGLIEGEPA 977

Query: 165  PEALTLTIIQPRV----RTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
                   ++           +  ++  ++        +                      
Sbjct: 978  GAPGGGRLVYIAKPNLDDGATQRHQDPLTPAAQDAWRESIHNAAASTQGPI--------F 1029

Query: 221  YGVNDDSCRFCRAKVRCPALSR 242
                +D C  C  +  CPA + 
Sbjct: 1030 VARVNDGCGHCPLRTCCPAQTD 1051


>gi|152965139|ref|YP_001360923.1| UvrD/REP helicase [Kineococcus radiotolerans SRS30216]
 gi|151359656|gb|ABS02659.1| UvrD/REP helicase [Kineococcus radiotolerans SRS30216]
          Length = 1098

 Score =  110 bits (274), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/248 (15%), Positives = 67/248 (27%), Gaps = 17/248 (6%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQT-TSIYASEGTFAHNLL---------AHCLEQGVD 55
             +S S    + +C +   LES   +   S   + G   H +                 + 
Sbjct: 843  PVSPSRVESFERCGLRWLLESSGARPGDSTGQAIGNLVHRIASEAPEADAFELRRRLDLL 902

Query: 56   AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGT 115
              T+           R     M   ++      R   G  L   E+ ++         G 
Sbjct: 903  WPTLGLPDGWVAETARARALRMVDKLAEYHRDARA-EGRTLVGVELDVDVQVGRARVRGR 961

Query: 116  ADILIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALHQYGDIFGRPEALTLTI 172
             D L  +   + ++VD K G   P +AE   + QL +Y   A              T   
Sbjct: 962  VDRLERDAEGRAVVVDLKTGKVQPSRAEVERSPQLGVYQLAAQEGAFPAPPTGPTGTGGA 1021

Query: 173  IQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCR 232
            +  ++                     +        L+  ++   +     V    C  C 
Sbjct: 1022 VLVQLGGTQK---KAPVQHQRALDEDDDPGWAADLLARAAEGMAAGRFEAVVGPYCGSCP 1078

Query: 233  AKVRCPAL 240
                CPA 
Sbjct: 1079 VLSSCPAQ 1086


>gi|306835514|ref|ZP_07468528.1| probable helicase [Corynebacterium accolens ATCC 49726]
 gi|304568571|gb|EFM44122.1| probable helicase [Corynebacterium accolens ATCC 49726]
          Length = 1035

 Score =  110 bits (274), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 40/254 (15%), Positives = 73/254 (28%), Gaps = 16/254 (6%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTS-IYASEGTFAHNLLAHCLEQ--GVDAETVSHQK 63
            LS S     L CP+   + +     +   +   GT AH  L           A  +  + 
Sbjct: 781  LSPSRVEALLNCPLKAIVGNLAEDPSGAEHLLRGTMAHAFLEAIGRGMDAEKARLLVMEA 840

Query: 64   LTFENDTRIVD-----TEMASSVSMVLAYVRTFS---GPFLSETEVPLEPFTTEPGATGT 115
              F  D           E +  +     + +           E  V +E    +    G 
Sbjct: 841  YEFILDVPQWQLQSKLEEFSRLLERTQQWAQQSEVKNELAGVEVPVYVEV-APDIRVGGF 899

Query: 116  ADILIFN-STQWIIVDFKYGAGVPVK--AENNTQLMLYACGALHQYGDIFGRPEALTLTI 172
             D L+ +    +++VD K G     +  AE N QLM Y         D     +   +  
Sbjct: 900  MDRLMQDGDGNYLVVDLKTGKSAATQAEAEENRQLMTYQLALSRGSFDGQRVRDGEGMPR 959

Query: 173  IQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCR 232
                +      +  + +       A+  +E  +  L   +      +     +  C  C 
Sbjct: 960  AGGVLVYPGKDSSKITTRTQSQLTAEALEEF-STLLPPLAAELRGPQLTARTNKDCDKCP 1018

Query: 233  AKVRCPALSRHVLL 246
             +  CP      + 
Sbjct: 1019 IRTICPVQEEGKMT 1032


>gi|38233328|ref|NP_939095.1| putative ATP-dependent DNA helicase [Corynebacterium diphtheriae NCTC
            13129]
 gi|38199588|emb|CAE49244.1| Putative ATP-dependent DNA helicase [Corynebacterium diphtheriae]
          Length = 1060

 Score =  109 bits (273), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 41/261 (15%), Positives = 74/261 (28%), Gaps = 21/261 (8%)

Query: 5    AFLSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQ--GVDAETVSH 61
            + +S S     L CP+   LE  + +  +  +  +GT AH             +AE +  
Sbjct: 797  SKVSPSLIENALLCPLRARLERLVEEENTPIHMLKGTLAHAFAEAVGRGVDPNEAEQLVT 856

Query: 62   QKLTFENDTRIVD--------TEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT 113
            Q      D             + M   ++  +          +                 
Sbjct: 857  QAFEALLDAPAWSLPHHMSQWSTMLQRLAHWIDVSHAQR-ELVGVEVPVNVVVAPGVELR 915

Query: 114  GTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEALTL 170
            G  D L  N   ++ IVDFK G       +A  N QL+ Y                A+  
Sbjct: 916  GRIDRLERNDAGEFHIVDFKTGKQAVTKDEANENKQLLAYQLALHRGKLMQRNGEPAINT 975

Query: 171  TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAV------SLEHYGVN 224
            T  QP +     +  +  +    +   ++  +         +            +     
Sbjct: 976  TAEQPGLTVDQAVLVYPATDTKTVTTREQAPKDAEELEKFSATLPALLESLSGPQLVARI 1035

Query: 225  DDSCRFCRAKVRCPALSRHVL 245
            +  C  C+ K  CPA     +
Sbjct: 1036 NTRCDQCKIKTMCPAQPEGKM 1056


>gi|187251475|ref|YP_001875957.1| hypothetical protein Emin_1068 [Elusimicrobium minutum Pei191]
 gi|186971635|gb|ACC98620.1| Putative RecB family exonuclease [Elusimicrobium minutum Pei191]
          Length = 411

 Score =  109 bits (272), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 57/382 (14%), Positives = 109/382 (28%), Gaps = 41/382 (10%)

Query: 7   LSASSSHRWLKCPIAPTLES--KIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
            S S    + +CP         KIP+    Y + G+  H  L               Q L
Sbjct: 22  FSYSKMTLYRECPQKYKFRYIHKIPEAPKYYFAFGSAMHKALEFIYSVKQPPFPSLEQIL 81

Query: 65  TFENDTRIVD--------------TEMASSVSMVLAYVRTFSGPFLS--ETEVPLEPFTT 108
            F +                            ++++Y +     F      E        
Sbjct: 82  DFFDADWRSTSYQDKGYASISKELEGYDEGRRILISYYQKHKDSFFIPLAVEFRTTLDID 141

Query: 109 EPGATGTADILI-FNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEA 167
                   D +  F +    I D+K G  V  + +   QL +Y    +     +      
Sbjct: 142 NLSLISIIDRVDYFGNGALAITDYKTGKTVQREPD---QLYMYQK-VMQNSPVLKNIINE 197

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLL-EKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                 + ++   S  +   +   D      KE        L    +      +   ++ 
Sbjct: 198 KEGKETEVKIEKLSFYHLPSLKVMDFEPAPQKEIDVFWEGVLKTADEIRGKNFNPDPSES 257

Query: 227 SCRFCRAKVRCPALSRHVLLEATK-------DPSTNTTVELSKAYSSISLIKSYVKACED 279
            CR+C  K  CP  +     +  K       D        LS     ++       + + 
Sbjct: 258 KCRWCDYKAMCPVFTGMEFEQFQKTEKPVFSDIPVTNEDILSSKIDELAETGQKYSSLKK 317

Query: 280 EMFKRLNAG----DEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKE- 334
           E+   +            Y+ VE     + F D    ++++  +  +   K+ L  P + 
Sbjct: 318 EIISLMKQNNYNQHFGSNYK-VE--LKQKEFLDFEDKEKVIEFLKEKNLIKKTLV-PTQC 373

Query: 335 -LEQLYKEQKVSDEFWEELQEL 355
            +E L  +  V ++    L+EL
Sbjct: 374 SIEALLDDPSVPEDDKARLKEL 395


>gi|302524381|ref|ZP_07276723.1| conserved hypothetical protein [Streptomyces sp. AA4]
 gi|302433276|gb|EFL05092.1| conserved hypothetical protein [Streptomyces sp. AA4]
          Length = 286

 Score =  109 bits (272), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 44/260 (16%), Positives = 68/260 (26%), Gaps = 34/260 (13%)

Query: 6   FLSASSSHRWLKCPIAPTL---ESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVS 60
            +S +    +  CP    L   +   PQ T  +A  + G   HN L    +  V   T  
Sbjct: 19  KVSPARLSTFDDCPRRYRLAYLDRPTPQRTGPWAHSTLGAVVHNALRALFDLPVAKRTPQ 78

Query: 61  HQKLTFENDT-----------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE 109
                                          V+  +        P   E  V     TT 
Sbjct: 79  RAIALVAEHWKDAGFADDDQAARYRARAKGWVAEYVEDNDVSDDPVGLERWVSAPVSTTG 138

Query: 110 PG----ATGTADILIFNSTQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFG 163
                   G AD +     + +IVD+K G   P   +A  +  L +YA  A         
Sbjct: 139 GRPTMIIEGRADRIDQRGGELVIVDYKTGRRAPDEHEARASQALAMYAVAASRTLRMPCT 198

Query: 164 RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE---- 219
           + E   L            I     + + L    +  +E                +    
Sbjct: 199 KVELHHL--------PSGTIAAADHTPETLKRHLERAEETAGDLRVAADTLDAGGDGDVL 250

Query: 220 HYGVNDDSCRFCRAKVRCPA 239
                D  C +C  +  C A
Sbjct: 251 FPARPDRRCAWCDFRPSCVA 270


>gi|118575660|ref|YP_875403.1| superfamily I helicase [Cenarchaeum symbiosum A]
 gi|118194181|gb|ABK77099.1| superfamily I helicase [Cenarchaeum symbiosum A]
          Length = 977

 Score =  109 bits (272), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 40/252 (15%), Positives = 69/252 (27%), Gaps = 34/252 (13%)

Query: 6   FLSASSSHRWLKCPIAPTLES--KIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
            LS++    + KCP+         IP    I    G   H +L    +  ++ +T     
Sbjct: 740 RLSSTKIGTYKKCPLMYWFAHVMTIPSPPGIPMVMGGVIHKVLEKITDAQMNGQTPDEAG 799

Query: 64  LTFENDT-------------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP 110
                +                   E  S +S  + +            E   E      
Sbjct: 800 ALAMLEGQLKYAVYDSRTSFEQSKEEAESMISWFVKWSAGSPNKP-IAVEKKFELEIAGA 858

Query: 111 GATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEA 167
              G+ D +        +++D+K G     P K   + QL LYA  A   Y ++  +   
Sbjct: 859 EFRGSIDRVERTPDGGLVLIDYKTGRTKVSPGKIAEDVQLNLYAEAAKKLYKELPEKAVL 918

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           L L              E+ +    +    K    R    +    +             +
Sbjct: 919 LYL--------ESGETVEYRLDEASV----KSAIGRIEEYVDGIREGRFDP---TPAVST 963

Query: 228 CRFCRAKVRCPA 239
           C FC     C  
Sbjct: 964 CMFCDYSGMCDY 975


>gi|227541922|ref|ZP_03971971.1| helicase [Corynebacterium glucuronolyticum ATCC 51866]
 gi|227182365|gb|EEI63337.1| helicase [Corynebacterium glucuronolyticum ATCC 51866]
          Length = 1025

 Score =  108 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/262 (16%), Positives = 79/262 (30%), Gaps = 28/262 (10%)

Query: 5    AFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
            A LS S     L+CP+   L S  P  +S    EG   H L    +    D ET    + 
Sbjct: 759  ATLSPSQVESGLQCPLKMVLNSVTPTESSSALREGNLLHALAEASVTLQQDEETWKEAEQ 818

Query: 65   TF-----------ENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPG-- 111
                             +  + E    ++  ++ +   +G  L   E+P++    +    
Sbjct: 819  LVLDAYLSSRTVPPWKEKADEEEFVEVMNATVSKMTNLAGD-LVGVEIPMDVAVGQLDDG 877

Query: 112  ----ATGTADILIFN-STQWIIVDFKYGAGVPVK--AENNTQLMLYACGA----LHQYGD 160
                  G  D +  +   +  + D K G   P    AE++ Q+ +Y  G     + +   
Sbjct: 878  SPIHIKGRLDRVHRDSEGRMKVYDLKTGRSAPTYQEAESHPQMAVYQLGINHSRIQENPL 937

Query: 161  IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
             F   +     +         P +    S   L    ++        L            
Sbjct: 938  EFVTDDGSGGALQSGGAELVYPRSTKKPSQKPL---TEDNARILMDNLRQLVHHTSGSTV 994

Query: 221  YGVNDDSCRFCRAKVRCPALSR 242
              + +  C  C  ++ CP    
Sbjct: 995  PALPNKHCGSCAYRIICPITEE 1016


>gi|256825725|ref|YP_003149685.1| DNA/RNA helicase [Kytococcus sedentarius DSM 20547]
 gi|256689118|gb|ACV06920.1| DNA/RNA helicase, superfamily I [Kytococcus sedentarius DSM 20547]
          Length = 1083

 Score =  108 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 70/243 (28%), Gaps = 17/243 (6%)

Query: 9    ASSSHRWLKCPIAPTLE-SKIPQTTSIYASEGTFAHNLLAHCLEQG---VDAETVSHQKL 64
             S+   +  C +   L               G   H+LLA   E     + AE       
Sbjct: 844  PSALGTYQDCALRWFLSTHGGSTPPGRSQELGILLHDLLAERPEDPVPALAAEAERRWAE 903

Query: 65   TFENDTRIVDTEMASSVSMV--LAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
                +      E       +      R  SG  L  TE+PL          G  D L  +
Sbjct: 904  LGSPEVWWSRRERERMAEWLRRYEIYRRESGRELVGTELPLAVEAEGVRLAGRVDRLERH 963

Query: 123  S--TQWIIVDFKYG-AGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRT 179
                   + D K G  G P +   N QL  Y                 +       ++ +
Sbjct: 964  PSSGALHVADLKTGFVGPPSELPGNPQLGAYQVAVAAGA----FEQGTVAGGASLVQLDS 1019

Query: 180  GSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA 239
            G  I         L E   + +ER    ++   +  V   H     D+CR C  +  CPA
Sbjct: 1020 GERIGTIDRRQPPLDEGEVDHRER----VAQAGQGMVQPRHLATVGDACRGCPVRSSCPA 1075

Query: 240  LSR 242
            +  
Sbjct: 1076 VPE 1078


>gi|9630454|ref|NP_046887.1| gp69 [Mycobacterium phage D29]
 gi|6136238|sp|O64262|VG69_BPMD2 RecName: Full=Gene 69 protein; AltName: Full=Gp69
 gi|3172318|gb|AAC18511.1| gp69 [Mycobacterium phage D29]
          Length = 269

 Score =  108 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/271 (14%), Positives = 66/271 (24%), Gaps = 54/271 (19%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYASE--GTFAHNLLA------------------ 47
           S S  +++ KCP+A  L           A    GT  H +                    
Sbjct: 10  SVSQINQYTKCPMAYKLARIDKVWQRPAAWLPQGTAFHAVAEAVEVWESYGMPLTLDEAK 69

Query: 48  HCLEQGVDAETVSHQKLTFENDTRIVDTEM-------------ASSVSMVLAYVRTFSGP 94
                    +  +  + T   +                        V    A+  T    
Sbjct: 70  DMFRWHYANDVGAFTEETPNFEWWTWSGPYNGQRDIERRYTVGLEQVEKFFAWRGTPGQE 129

Query: 95  FLS------ETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLM 148
                      E+  E         G  D ++    +  + D+K G        ++ QL 
Sbjct: 130 IWVTPDGTPAIELYFEIELDGILVRGYIDAVVVVDGELRVRDYKTGNQPG----DDFQLG 185

Query: 149 LYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKE-FKERGTLA 207
           +YA      YG    +     +       +  +P         DL +  +E   E     
Sbjct: 186 VYALAVAMTYGVEAPKTGDYFMV----GKKGKAPKPTKPY---DLTKWTREAITEEFHRV 238

Query: 208 LSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               +             D C+FC     CP
Sbjct: 239 EEGIAASMFDPLPEP---DKCKFCDVSYSCP 266


>gi|229490969|ref|ZP_04384802.1| UvrD/REP helicase domain protein [Rhodococcus erythropolis SK121]
 gi|229322085|gb|EEN87873.1| UvrD/REP helicase domain protein [Rhodococcus erythropolis SK121]
          Length = 1120

 Score =  108 bits (270), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/260 (14%), Positives = 75/260 (28%), Gaps = 33/260 (12%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHC--------LEQGVD-- 55
            LS S+      CP+    E        + +A  GT  H L+           +E+ ++  
Sbjct: 864  LSPSTIELLETCPLRWVFERHGGSDGDNTHAIAGTLVHTLVQALAGRIPPDQVEKALENA 923

Query: 56   AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTF------SGPFLSETEVPLEPFTTE 109
             E++      +         EM ++ +  +   R                E   E     
Sbjct: 924  WESIDLGSQWYSRRELNRTREMLATFTAWMNATRGELTEVGVEVAVEGVLEPR-EEGAPA 982

Query: 110  PGATGTADILIFN-STQWIIVDFKYGAGVPVK--AENNTQLMLYACGALHQYGDIFGRPE 166
                G  D L  +   + ++VD K          A+++ QL  Y   A           +
Sbjct: 983  VKLRGRIDRLERDTEGRPVVVDVKTARNPVSNEAAQSHAQLAAYQVAAAEGAIAGEPATQ 1042

Query: 167  ALTLTIIQ----PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
                 ++      +    +   +  ++A+ +                  +      ++  
Sbjct: 1043 PGGARLVFVAKSNKKDGAAQRVQPPLTAEAVEMWRDVIHN--------AAAATQGPQYLA 1094

Query: 223  VNDDSCRFCRAKVRCPALSR 242
              +D CR C  +  CPA   
Sbjct: 1095 RVNDGCRHCPVRSSCPAHDE 1114


>gi|300857960|ref|YP_003782943.1| hypothetical protein cpfrc_00542 [Corynebacterium pseudotuberculosis
            FRC41]
 gi|300685414|gb|ADK28336.1| hypothetical protein cpfrc_00542 [Corynebacterium pseudotuberculosis
            FRC41]
 gi|302205689|gb|ADL10031.1| Putative ATP-dependent DNA helicase [Corynebacterium
            pseudotuberculosis C231]
 gi|302330241|gb|ADL20435.1| Putative ATP-dependent DNA helicase [Corynebacterium
            pseudotuberculosis 1002]
 gi|308275924|gb|ADO25823.1| Putative ATP-dependent DNA helicase [Corynebacterium
            pseudotuberculosis I19]
          Length = 1062

 Score =  108 bits (270), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/259 (14%), Positives = 78/259 (30%), Gaps = 18/259 (6%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIY-ASEGTFAHNLLAHCLE-------QGVDAET 58
            +S S   + L CP+   L++ I    + +   +G+ AH               + +  E 
Sbjct: 805  ISPSLIEQGLTCPLRARLDAVIEGEETPFQMLKGSLAHAYAEAIARGVESETAKELTTEA 864

Query: 59   VSHQKLTFENDTRIVDTEMASSVSMVLAYVR-TFSGPFLSETEVPLEPFT-TEPGATGTA 116
                                  +  +  ++  + +   L   E  +           G  
Sbjct: 865  FLRLLNAPAWQQETEKAAWIRMIERLEEWITVSAARYELVGVETSVNTKIAEGITIRGRI 924

Query: 117  DILIFN-STQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQ----YGDIFGRPEALT 169
            D +       + I+D+K G       +  ++ QLM Y            GD+    +  +
Sbjct: 925  DRIERTQDGAYRIIDYKTGTRGLSAKEVADHKQLMAYQLALSKGKLSDTGDVISGNDEES 984

Query: 170  LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
            L + Q  +       + + + +   +  +E +E     L    +         V +D C 
Sbjct: 985  LIVDQAVLVYPGSTTKKIKTCEQATKTPEELQEFA-DLLPPLIQNLTGPSLMAVVNDGCS 1043

Query: 230  FCRAKVRCPALSRHVLLEA 248
             C     CPA     +  A
Sbjct: 1044 NCSIINICPAQPEGRMTPA 1062


>gi|240172136|ref|ZP_04750795.1| ATP-dependent DNA helicase [Mycobacterium kansasii ATCC 12478]
          Length = 1051

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/256 (16%), Positives = 73/256 (28%), Gaps = 26/256 (10%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIY-ASEGTFAHNLL------AHCLEQGVDA--- 56
            L+ SS     +CP+    E           ++ G+  H L+         L   +D    
Sbjct: 802  LTPSSLQTLSECPLRWLTERHGGAKPRELRSAVGSVLHALIAGPGRSEAHLLAELDRVWR 861

Query: 57   ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEP-----FTTEPG 111
                       N+       + S V    A  R        E EV            +  
Sbjct: 862  RLPFDASWYSSNELARHRAMIQSFVE-WRARTRGELTEVGVEIEVDGVLQTRRDDGGKIR 920

Query: 112  ATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              G  D L  +   + +IVD K G        A+ + QL +Y        G +    E  
Sbjct: 921  LRGRVDRLERDGAGRLVIVDVKTGKTPVSKDDAQQHAQLAMYQLAVAE--GMVPAGDEPG 978

Query: 169  TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
               ++ P     +   E               +++    +   ++     +     +DSC
Sbjct: 979  GARLVYPGKCATTGATERQQDP-----LTPATRDQWRGLVRQAAEAMAGPQFIARRNDSC 1033

Query: 229  RFCRAKVRCPALSRHV 244
              C  +  CPA +   
Sbjct: 1034 SNCPIRPFCPAHTDRS 1049


>gi|227889485|ref|ZP_04007290.1| conserved hypothetical protein [Lactobacillus johnsonii ATCC 33200]
 gi|227849963|gb|EEJ60049.1| conserved hypothetical protein [Lactobacillus johnsonii ATCC 33200]
          Length = 115

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 18/117 (15%), Positives = 45/117 (38%), Gaps = 6/117 (5%)

Query: 270 IKSYVKACEDEMFK-RLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRI 328
           +  +    +D      +N   +   Y++VE R   R +K      ++       + +++ 
Sbjct: 1   MNRWTHEVKDYAADLAINHDKKWPSYKIVEER-SIRHYKYEAAVAKIAEDHGYHDIYQKK 59

Query: 329 LKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFE 385
           L    +LE+   ++  ++ F +E    I +    P + P        ++ +   EF+
Sbjct: 60  LLPITKLEKQLGKKIFTELFSQE----IVKTADNPTLVPNSDQRQSISKSNPKDEFK 112


>gi|227497413|ref|ZP_03927645.1| possible UvrD/REP helicase [Actinomyces urogenitalis DSM 15434]
 gi|226833089|gb|EEH65472.1| possible UvrD/REP helicase [Actinomyces urogenitalis DSM 15434]
          Length = 1156

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/290 (13%), Positives = 73/290 (25%), Gaps = 51/290 (17%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQT-TSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
             +S S       CP+   L+     T TS     G   H +      +G+  E++     
Sbjct: 871  RVSPSDVDNLSTCPLRWFLQRHGGDTGTSGQQRLGNVVHAIAERAQREGLRGESLHELLE 930

Query: 65   TFEND--------TRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPF---------- 106
                +         ++        +  + +Y+ +  G  L E  + +E            
Sbjct: 931  AQMPELSDPGTWIEQLARQRAHDIIDRLDSYLASVPGQVLVEKRIDVELDLPLPPSEDTD 990

Query: 107  -------TTEPGATGTADILIFNST--------------------QWIIVDFKYGAGVPV 139
                          G  D +                         +  ++D K G     
Sbjct: 991  DEPGRDGVIGVRLAGRIDRIEMVEALDEMQSGTQELDQLPAGQGRRVRVMDLKTGRRPAG 1050

Query: 140  KAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLE-KAK 198
                N QL  Y          +        L  +            +   A       A+
Sbjct: 1051 DVARNAQLATYRMALEA----LGYEVSGAGLVALGESADRNGQTRIYPPGAALAASPDAQ 1106

Query: 199  EFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEA 248
              ++  +  ++  +  A          D CRFC  K  CPA+       A
Sbjct: 1107 TGEDWASQLVAGAAVDASGARLEARVGDHCRFCSVKSSCPAVPEGRRSVA 1156


>gi|317125679|ref|YP_004099791.1| UvrD/REP helicase [Intrasporangium calvum DSM 43043]
 gi|315589767|gb|ADU49064.1| UvrD/REP helicase [Intrasporangium calvum DSM 43043]
          Length = 1053

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/247 (19%), Positives = 79/247 (31%), Gaps = 15/247 (6%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCL----EQGVDAETVSH 61
            +S S    + +C +   L S      S+  AS GT  H+++A       E+ V       
Sbjct: 807  VSPSKVTYFSECGLRWFLTSVGGDGPSLGAASVGTLVHDIVAERPHATREELVAEVDARW 866

Query: 62   QKLTFENDT--RIVDTEMASSVSMVLAYVRTFSGP-FLSETEVPLEPFTTEPGATGTADI 118
             +L             E    VS  +AY  + +        E             G  D 
Sbjct: 867  GRLGLRRGWVTERTRREAHDMVSRYVAYRESVAREWEPVGIETEFRVTVGRAVVAGRVDR 926

Query: 119  LIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALHQYGDIFGRPEALTLTIIQP 175
            +  +   +  IVD K G   P +AE   + QL  Y      Q G      E+    ++  
Sbjct: 927  IERDRQGRLRIVDLKTGTSKPTQAELAQHGQLGAYQVAVASQ-GFPTLGAESAGAALVFI 985

Query: 176  RVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKV 235
                 S +   V+S   L +   +  +   + +   ++   +         +CR C  K 
Sbjct: 986  GKGGLSGLRPAVLSQPALAD--SDDPDWARVLVEQTAEGMGAASFVASQG-NCRTCPVKS 1042

Query: 236  RCPALSR 242
             CP    
Sbjct: 1043 SCPVQPE 1049


>gi|312194627|ref|YP_004014688.1| hypothetical protein FraEuI1c_0740 [Frankia sp. EuI1c]
 gi|311225963|gb|ADP78818.1| Protein of unknown function DUF2800 [Frankia sp. EuI1c]
          Length = 288

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/250 (18%), Positives = 71/250 (28%), Gaps = 28/250 (11%)

Query: 9   ASSSHRWLKCPIAPTL---ESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQK 63
            +    +  CP    +   +   P     +A  S GT AHN L    ++     T     
Sbjct: 18  PTRLASFEDCPRRYRMTYVDRPAPPKGPPWAHTSLGTSAHNALRLWWDEPARRRTPERAA 77

Query: 64  LTFENDT----RIVDTEMASSVSMVLAYVRTF-----SGPFLSETEVPLEPFTTEPGATG 114
               +         D + A +   V A    +             E  +   T      G
Sbjct: 78  ALVRSGWVAEGWRDDQQSADARDRVAAMCERYTAGLDPTDEPRAVERQVATRTDLLALHG 137

Query: 115 TADILIFNSTQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFGRPEALTLTI 172
             D L     + ++VD+K G   P    A  +  L LYA  A         R E   L  
Sbjct: 138 RVDRLDERDGELVVVDYKTGRRAPQDGDARTSPALALYAFAAERMLRQRCRRVELHHL-- 195

Query: 173 IQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL----EHYGVNDDSC 228
                     I E   + + L    +  +   T A++   + A                C
Sbjct: 196 ------PSGRIVEAEHTDESLARHLRRAESIATDAVAATERLAAGQPADVAFPPRPGPLC 249

Query: 229 RFCRAKVRCP 238
            +C  +  CP
Sbjct: 250 SWCDYRRHCP 259


>gi|227505536|ref|ZP_03935585.1| helicase [Corynebacterium striatum ATCC 6940]
 gi|227197833|gb|EEI77881.1| helicase [Corynebacterium striatum ATCC 6940]
          Length = 1021

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 48/268 (17%), Positives = 90/268 (33%), Gaps = 31/268 (11%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAET-----V 59
             +S S     L CP++  L +   + ++  +   GT AH  L   L +G++ E      +
Sbjct: 748  RVSPSRVEALLNCPLSAILGNLAEEESTPMHLIRGTMAHAYLE-ALGRGIEPELGKKMVM 806

Query: 60   SHQKLTFENDTRIVDTEMASSVSMVLAYVR----TFSGPFLSETEVPLEPFT-TEPGATG 114
                   +     + ++MA+   ++    +    + S   L   EVP+           G
Sbjct: 807  EAFASIVDGPGWKMRSDMAAFERLIDRTHQWAMNSESSFELIGVEVPVSVEVLPGITVAG 866

Query: 115  TADILIFNSTQWIIVDFKYGAGV--PVKAENNTQLMLYACGALH------------QYGD 160
              D L+     +++VD K G       +A+ N QLM Y                  + G+
Sbjct: 867  YMDRLVKAGDDYMVVDLKTGNSAVTAKQAKENPQLMTYQLALERGELVGVVDADDAEAGE 926

Query: 161  IFGRPEALTLTIIQPRVRT----GSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAV 216
              G    +      PR        +  +  + + D      +E         +L ++   
Sbjct: 927  NPGSSPVIRTGEGLPRGGGVLVYPAHDSVKITTRDQAAVPPEELAAFAEKLPALVAELH- 985

Query: 217  SLEHYGVNDDSCRFCRAKVRCPALSRHV 244
            S       +DSC  C  +  CP  +   
Sbjct: 986  SERLTARENDSCDRCAIRSICPVQAEGK 1013


>gi|150398844|ref|YP_001322611.1| UvrD/REP helicase [Methanococcus vannielii SB]
 gi|150011547|gb|ABR53999.1| UvrD/REP helicase [Methanococcus vannielii SB]
          Length = 1016

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/252 (14%), Positives = 73/252 (28%), Gaps = 34/252 (13%)

Query: 6    FLSASSSHRWLKCPIAPTLES--KIPQTTSIYASEGTFAHNLLAHC--LEQGVDAETVSH 61
              SAS   +++ CP+         IP     + + GT  H +      L+   +A  +  
Sbjct: 775  KFSASKIKQYIGCPLNFKYNYVLNIPTPKKAHLTVGTDVHKIFEDLGILKNKGEAIDLEL 834

Query: 62   QKLTFENDTRIV--------DTEM---ASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP 110
             K     + +          + E       +     +  + +   +  TE          
Sbjct: 835  AKSMLSENLKEFSFNSKTEFEEEYSKSLKMIEYWFDF-ESKNKNKILATEEKFNLDLGGF 893

Query: 111  GATGTADILIFN-STQWIIVDFKYGAGV----PVKAENNTQLMLYACGALHQYGDIFGRP 165
              TG  D +      ++II+D+K G         K   + Q+ LYA     +YG      
Sbjct: 894  TFTGIIDRIDVTPDGEYIILDYKTGKKSSVLTKPKMAEDVQMALYAMAVFEKYGKYP--- 950

Query: 166  EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
              + +  +         +    ++  ++    +         +        +        
Sbjct: 951  --VKMGQLYVNPDVSKDVII-DVNPANIENIKENVISNVNKIMDEDFTVINTP------- 1000

Query: 226  DSCRFCRAKVRC 237
              C FC  K  C
Sbjct: 1001 KMCYFCDYKDIC 1012


>gi|262194077|ref|YP_003265286.1| hypothetical protein Hoch_0777 [Haliangium ochraceum DSM 14365]
 gi|262077424|gb|ACY13393.1| conserved hypothetical protein [Haliangium ochraceum DSM 14365]
          Length = 387

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/313 (15%), Positives = 93/313 (29%), Gaps = 35/313 (11%)

Query: 6   FLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETV---- 59
            LS S   R+  CP++  L    +     S+  + G+  H  L H + + +  E V    
Sbjct: 3   RLSFSRLSRYEACPLSYKLHYLDQHEAGDSVPLAFGSAVHAALEHLVREHLAEERVGPLC 62

Query: 60  -SHQKLTFENDTRI-------VDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPG 111
                + ++N           +  E  + +   +          +   E           
Sbjct: 63  AERVAVLWQNAWTESGLSGLSLFREGLALLHRFVREQGVVDHLDVLAVEQEFRITVGGFE 122

Query: 112 ATGTADI-LIFNSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
             G  D     +     +VD+K         + +++ Q+ LY   A   +       + +
Sbjct: 123 VLGYLDRVDRVDDETVDVVDYKSNRQLFTRDELDSSLQMSLYQLAAQSLWPW----AKKV 178

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
            LT    R            +++DL    +     GT             E       +C
Sbjct: 179 RLTFWMLRHGVQQRT---ERTSEDLEATKRYVATLGTAIERAT-------EFPARLSSNC 228

Query: 229 RFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEM--FKRLN 286
            +C  K  CPA +    LE  +D       +L         + S  K         +R+ 
Sbjct: 229 TWCDHKQHCPAYA--AALEGKRDVVCEDEGDLEAVAREREEVASLAKILYSRKSELERVL 286

Query: 287 AGDEIQGYQLVEG 299
                +  +LV G
Sbjct: 287 KAHLAEQDELVLG 299


>gi|326334226|ref|ZP_08200449.1| helicase, UvrD/Rep family [Nocardioidaceae bacterium Broad-1]
 gi|325948017|gb|EGD40134.1| helicase, UvrD/Rep family [Nocardioidaceae bacterium Broad-1]
          Length = 293

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/255 (17%), Positives = 69/255 (27%), Gaps = 26/255 (10%)

Query: 7   LSASSSHRWLKCPIAPTL--ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           LSAS+    L CP    L  E+    T S     G   H +        +DA TV     
Sbjct: 37  LSASALEAILTCPAQWFLAREAGGAVTDSSSQGFGKVVHAIAEQLARGDLDAATVEDLMP 96

Query: 65  TFENDTRIVD-----------TEMASSVSMVLAYVRTFSGPFLSETEVPLEPFT-----T 108
             +     ++             +   ++  L + R      +   E  L          
Sbjct: 97  FVDEVWGRLEFRTPWSAAREREAVREVLARFLTWHRRPGARTVIGFEEQLTAKVSLPSGE 156

Query: 109 EPGATGTADILIFNS-TQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFGRP 165
                G AD L  +   + ++VD K G   P   + + + QL LY     H         
Sbjct: 157 TVRLNGYADRLELDESGRIVVVDLKTGKYPPTAQEVKEHGQLGLYQLAVEHGAAASLAEG 216

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
                  +          +E         E  +   +     L        + E      
Sbjct: 217 ATSGGAELIQLRHPAGSGSELPKVQVQAPEPPEIINQ-----LEKAVATVRAEEFVARPG 271

Query: 226 DSCRFCRAKVRCPAL 240
             C  C+    CPA 
Sbjct: 272 KQCDRCQFVALCPAQ 286


>gi|226305705|ref|YP_002765665.1| ATP-dependent DNA helicase [Rhodococcus erythropolis PR4]
 gi|226184822|dbj|BAH32926.1| putative ATP-dependent DNA helicase [Rhodococcus erythropolis PR4]
          Length = 1103

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/260 (14%), Positives = 75/260 (28%), Gaps = 33/260 (12%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHC--------LEQGVD-- 55
            LS S+      CP+    E        + +A  GT  H L+           +E+ ++  
Sbjct: 847  LSPSTIELLETCPLRWVFERHGGSDGDNTHAIAGTLVHTLVQALAGRIPPDQVEKALENA 906

Query: 56   AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTF------SGPFLSETEVPLEPFTTE 109
             E++      +         EM ++ +  +   R                E   E     
Sbjct: 907  WESIDLGSQWYSRRELNRTREMLATFTAWMNATRGELTEVGVEVAVEGVLEPR-EEGAPA 965

Query: 110  PGATGTADILIFN-STQWIIVDFKYGAGVPVK--AENNTQLMLYACGALHQYGDIFGRPE 166
                G  D L  +   + ++VD K          A+++ QL  Y   A           +
Sbjct: 966  VKLRGRIDRLERDTQGRPVVVDVKTARNPVSNEAAQSHAQLAAYQVAAAEGAIAGEPATQ 1025

Query: 167  ALTLTIIQ----PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
                 ++      +    +   +  ++A+ +                  +      ++  
Sbjct: 1026 PGGARLVFVAKSNKKDGAAQRVQPPLTAEAVEMWRDVIHN--------AAAATQGPQYLA 1077

Query: 223  VNDDSCRFCRAKVRCPALSR 242
              +D CR C  +  CPA   
Sbjct: 1078 RVNDGCRHCPVRSSCPAHDE 1097


>gi|262203379|ref|YP_003274587.1| UvrD/REP helicase [Gordonia bronchialis DSM 43247]
 gi|262086726|gb|ACY22694.1| UvrD/REP helicase [Gordonia bronchialis DSM 43247]
          Length = 1129

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/262 (16%), Positives = 75/262 (28%), Gaps = 22/262 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK- 63
             LS S+     +C +   LE           A  G+  H L+   +   +D   V+    
Sbjct: 868  VLSPSNVDALTRCSLRWLLERNGGRDGDGTPALTGSLVHTLVQ-AVAGELDPTEVTEALR 926

Query: 64   ----------LTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLE----PFTTE 109
                        +          M  +    L   R+       E  V       P    
Sbjct: 927  AIWDRVDTGAGWYSARELERAESMLVNFREWLRISRSDLDEVGVELAVDATIPATPDDPA 986

Query: 110  PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
                G  D L  +   + ++VD K          A+++ QL  Y     H  G       
Sbjct: 987  VRLRGRMDRLERDGAGRPVVVDVKTAKTPISKADAQDHAQLAAYQVALAHG-GLTGADDA 1045

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLE-KAKEFKERGTLALSLKSKRAVSLEHYGVND 225
             ++      R+   S  N    +A+ +    + E  +     +   ++ +V   +    +
Sbjct: 1046 VVSAEPGGARLVYVSSANRNSGAAERVQAPLSPELLDEWITVVRHAARASVGPVYAATPN 1105

Query: 226  DSCRFCRAKVRCPALSRHVLLE 247
              C  C     CPA  R   + 
Sbjct: 1106 PGCGHCALAASCPAQIRGKAVT 1127


>gi|296118827|ref|ZP_06837403.1| putative ATP-dependent DNA helicase [Corynebacterium ammoniagenes DSM
            20306]
 gi|295968316|gb|EFG81565.1| putative ATP-dependent DNA helicase [Corynebacterium ammoniagenes DSM
            20306]
          Length = 1057

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/269 (14%), Positives = 71/269 (26%), Gaps = 29/269 (10%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIY-ASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
             LS S     LKCP+   L       +  Y    G  AH  +   + +G D E    + +
Sbjct: 787  RLSPSRIEALLKCPLNAMLSDAADNNSDKYHMVRGNLAHAYME-AIGRGADEELARRETV 845

Query: 65   TFEND--------TRIVDTEMASSVSMVLAYVRTFSGPF-LSETEVPLEPFT-TEPGATG 114
                               +    +     +++       L + EV +   T      +G
Sbjct: 846  AAFEQIQTSPTWKRPQERADFEGLLQRTYQWIQETRDALELVDVEVRVSVETQPGVRVSG 905

Query: 115  TADILIFN---------STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALHQYGDIFG 163
              D L                 ++D K G+  P   E   + QL+ Y     H       
Sbjct: 906  YIDRLERARAEEGADTEEGGLRVIDLKTGSYKPSDEETSQHPQLLAYQLVLAHGALRQDE 965

Query: 164  RPEALTLTIIQPRVRTGSPI-----NEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
            +   +            + +        + +A+   ++  E  E     L          
Sbjct: 966  QGTQVVSGEDGEVRDGATLVFPGTDTVKIATAEQARKEDAELAEFAEK-LPPLLDELAGP 1024

Query: 219  EHYGVNDDSCRFCRAKVRCPALSRHVLLE 247
                     C  C     CP  ++  +  
Sbjct: 1025 RVTATISSECERCPLISICPVQAQGKVTT 1053


>gi|262198225|ref|YP_003269434.1| hypothetical protein Hoch_5053 [Haliangium ochraceum DSM 14365]
 gi|262081572|gb|ACY17541.1| hypothetical protein Hoch_5053 [Haliangium ochraceum DSM 14365]
          Length = 267

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/268 (16%), Positives = 75/268 (27%), Gaps = 28/268 (10%)

Query: 3   HHAFLSASSSHRWLKCPIA--PTLESKIPQTTS-IYASEGTFAHNLLAHCLEQGVDAETV 59
            HA  SAS     L+CP         K+ +  +   A  G   H LL H L+     +  
Sbjct: 8   AHAPWSASKVQTALRCPRLFHYRYVDKLSEPETMPEARVGKAVHALLEHVLQGQELEDAE 67

Query: 60  SHQKLTFENDTRIVD-TEMASSVSMVLAYVRTFSGPFLSETE-------VPLE-----PF 106
              +   E++   +    +   V   +  +  F        E       V ++      +
Sbjct: 68  IDARAQLESEREQLRFDALRPGVEAFVGRLSGFRQRRRVYRELFEYTLAVRVDMVATQFY 127

Query: 107 TTEPGATGTADILIF-NSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRP 165
             +    G  D     +     +VD K G     +A    QL  YA  AL  +  +    
Sbjct: 128 AGDAFYRGIIDAAFLFDDDSLALVDHKTGQRAARQAIGE-QLEGYAVLALGWFRHLRRVW 186

Query: 166 EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
             +             P+    I    +    +             +  AV+        
Sbjct: 187 LGVHWVAEHCVDW-AEPVPVSEIRTRMVPALLQSI---------EAAALAVADGPRPNPG 236

Query: 226 DSCRFCRAKVRCPALSRHVLLEATKDPS 253
             C FC  +  CPA           +P 
Sbjct: 237 SWCEFCNYRSVCPAAIEMRFERVDDEPD 264


>gi|262194305|ref|YP_003265514.1| hypothetical protein Hoch_1024 [Haliangium ochraceum DSM 14365]
 gi|262077652|gb|ACY13621.1| conserved hypothetical protein [Haliangium ochraceum DSM 14365]
          Length = 387

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/314 (15%), Positives = 98/314 (31%), Gaps = 37/314 (11%)

Query: 6   FLSASSSHRWLKCPIAPTL---ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET---V 59
            LS S   R+  CP++  L   +  +          GT  H  L H + + + AE    +
Sbjct: 3   RLSYSRLSRYEACPLSYRLHYIDQHVADR-GEPVRFGTAVHAALEHVVREHLAAERCGPL 61

Query: 60  SHQKLTFENDTRIVDTEM------ASSVSMVLAYVRTF---SGPFLSETEVPLEPFTTEP 110
           SH+++         ++ +         ++++  +VR         +   E          
Sbjct: 62  SHERVAVLWQNAWTESGLSGLSLFREGLALLHRFVREQGVVDHLDVLAVEQEFRITVGGF 121

Query: 111 GATGTADI-LIFNSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRPEA 167
              G  D     +     +VD+K         + + + Q+ LY   A   +       + 
Sbjct: 122 EVLGYLDRVDRVDDETVDVVDYKTNRQLFTRDELDGSLQMSLYQLAAQSLWPW----AKK 177

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + LT    R            + +DL    +     G            + ++    + +
Sbjct: 178 VRLTFWMLRHGVQQRT---ERTTEDLEATRRYVGTIGRAI-------DEASDYPARLNSN 227

Query: 228 CRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEM--FKRL 285
           C +C  K  CPA +    LE  +D       +L         + S  K         +R+
Sbjct: 228 CTWCDHKQHCPAYA--AALEGKRDVVCEDEGDLEAVARQREEVASLAKILYSRKSELERV 285

Query: 286 NAGDEIQGYQLVEG 299
                 +  +LV G
Sbjct: 286 LKAHLAEQDELVLG 299


>gi|262194124|ref|YP_003265333.1| hypothetical protein Hoch_0825 [Haliangium ochraceum DSM 14365]
 gi|262077471|gb|ACY13440.1| conserved hypothetical protein [Haliangium ochraceum DSM 14365]
          Length = 387

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 51/314 (16%), Positives = 99/314 (31%), Gaps = 37/314 (11%)

Query: 6   FLSASSSHRWLKCPIAPTL---ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET---V 59
            LS S   R+  CP++  L   +  +          GT  H  L H + + + AE    +
Sbjct: 3   RLSYSRLSRYEACPLSYRLHYIDQHVADR-GEPVRFGTAVHAALEHAVREHLAAERCGPL 61

Query: 60  SHQKLTFENDTRIVDTEM------ASSVSMVLAYVRTF---SGPFLSETEVPLEPFTTEP 110
           SH+++         ++ +         ++++  +VR         +   E          
Sbjct: 62  SHERVAVLWQNAWTESGLSGLSLFREGLALLHRFVREQGVVDHLDVLAVEQEFRITVGGF 121

Query: 111 GATGTADI-LIFNSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRPEA 167
              G  D     +     +VD+K         + + + Q+ LY   A   +       + 
Sbjct: 122 EVLGYLDRVDRVDDETVDVVDYKTNRQLFTRDELDGSLQMSLYQLAAQSLWPW----AKR 177

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + LT    R            + +DL    +     G            + ++    + +
Sbjct: 178 VRLTFWMLRHGVQQRT---ERTTEDLEATRRYVGTIGRAI-------DEASDYPARLNSN 227

Query: 228 CRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEM--FKRL 285
           C +C  K  CPA +R   LE  +D       +L         + S  K         +R+
Sbjct: 228 CSWCDHKQHCPAYARA--LEGKRDVVCEDEGDLEAVAREREEVASLAKILYSRKSELERV 285

Query: 286 NAGDEIQGYQLVEG 299
                 +  +LV G
Sbjct: 286 LKAHLAEQDELVLG 299


>gi|84494609|ref|ZP_00993728.1| putative ATP-dependent DNA helicase [Janibacter sp. HTCC2649]
 gi|84384102|gb|EAP99982.1| putative ATP-dependent DNA helicase [Janibacter sp. HTCC2649]
          Length = 1047

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/253 (13%), Positives = 69/253 (27%), Gaps = 23/253 (9%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYAS-EGTFAHNLLAHCLEQGVDAETVSHQKL 64
             +  S+   +  C +   L         I     GT  H + A              ++ 
Sbjct: 798  RVGPSAIDGFTSCQLKWALTKVGGDGPMIGQRDIGTLIHEIAAEGDADAATMRATLDERW 857

Query: 65   --------TFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTA 116
                       +  R     M   ++                 E  ++        +GT 
Sbjct: 858  PRLGLPQGWSTDLKRRQAEGMVDRLARFFDENTAVGWQR-LAAESRMKVELGRIVLSGTV 916

Query: 117  DILIFNS-TQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
            D L  +   +  ++D+K G+  P       + QL  Y    +    +    P++ +   +
Sbjct: 917  DRLDVSPSGEVRVIDYKTGSSKPKASDVPRHGQLGAYQLAVIEGGFEDVEVPQSSSGAAL 976

Query: 174  QPRVRTGSPINE----WVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
                +             ++ D+    A+         +   +  A        +DD CR
Sbjct: 977  LHVGKAAGKATTMQVQPPLAEDEDPGWAERLIVDTGELMGGATYVA------TPSDDLCR 1030

Query: 230  FCRAKVRCPALSR 242
             C  +  CPA   
Sbjct: 1031 TCPVRSSCPAQPE 1043


>gi|183981381|ref|YP_001849672.1| ATP-dependent DNA helicase [Mycobacterium marinum M]
 gi|183174707|gb|ACC39817.1| ATP-dependent DNA helicase [Mycobacterium marinum M]
          Length = 1057

 Score =  106 bits (265), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 46/255 (18%), Positives = 79/255 (30%), Gaps = 24/255 (9%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAH--CLEQGVDAETVSHQK 63
            L+ S+      CP+    E         + A+ G+  H L+A     E+ + AE     K
Sbjct: 808  LTPSTLQTLNDCPLRWLAERHGGTNPRDLRATIGSVLHALIAEPGASEEQLLAELARVWK 867

Query: 64   LTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP-----------GA 112
            L           E+A   +M+ A+V          TEV +E                   
Sbjct: 868  LLPFEADWFSSNELARHRAMIQAFVEWRGQTRSELTEVGVEIDIDGVLDAARDDGGAIRL 927

Query: 113  TGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEALT 169
             G  D L  +   + +IVD K          A+ N QL +Y        G +    E   
Sbjct: 928  RGRVDRLERDGAGRLVIVDIKTAKTPVSKDDAQQNAQLAMYQLAVAE--GMVEAGAEPGG 985

Query: 170  LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
              ++ P     +   +               +++    +   ++ A         +D C 
Sbjct: 986  ARLVYPGKSAAAGAAQRDQDP-----LTPAARDQWRNLVRQAAEAAAGPHFIARRNDGCS 1040

Query: 230  FCRAKVRCPALSRHV 244
             C  +  CPA +   
Sbjct: 1041 HCPIRPSCPAHTDRS 1055


>gi|271969588|ref|YP_003343784.1| hypothetical protein Sros_8396 [Streptosporangium roseum DSM 43021]
 gi|270512763|gb|ACZ91041.1| hypothetical protein Sros_8396 [Streptosporangium roseum DSM 43021]
          Length = 293

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 45/270 (16%), Positives = 76/270 (28%), Gaps = 32/270 (11%)

Query: 9   ASSSHRWLKCPIAPTL---ESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQK 63
            S  + WL+CP        +   PQ    +A  S G   HN LA    +     T     
Sbjct: 18  PSRLNTWLECPRRHRFTYMDRPSPQKGPPWAHNSVGVSVHNALAAWWREPYARRTPVTAA 77

Query: 64  LTFENDTRIVDTEMASSVSMVLAYVRT---------FSGPFLSETEVPLEPFTTEPGATG 114
           +   +         A   +      R                   E  +   T+    +G
Sbjct: 78  VLVTSGWINEGFRDAEQSAAWRDRAREMTAGYVASLDPSDEPVGVERTVAAKTSVIAVSG 137

Query: 115 TADILIFNSTQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEALTL-- 170
             D L     + ++VD+K G        A ++  L +YA  +         R E   L  
Sbjct: 138 RVDRLDRRGDELVVVDYKTGRRPLTADDARSSLALAVYAVASSRVMHRPCHRVELHHLPT 197

Query: 171 -TIIQPRVRTGSPINEWVISAD---DLLEKAKEFKERGTLALSLKSKRAVSLE------- 219
            TI +      S       + D   +  +    +++    A +  + R            
Sbjct: 198 GTIAEWEHTDASLARHLSRAEDIAVEASDAEDRYRDWSGTARARGAGRTPPGVPPEIDAL 257

Query: 220 HYGVNDDSCRFCRAKVRCP---ALSRHVLL 246
                   C +C  +  CP   A +   L 
Sbjct: 258 FPPKPGPLCSWCDFRRHCPEGQAAAGDRLP 287


>gi|256831951|ref|YP_003160678.1| UvrD/REP helicase [Jonesia denitrificans DSM 20603]
 gi|256685482|gb|ACV08375.1| UvrD/REP helicase [Jonesia denitrificans DSM 20603]
          Length = 1059

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 49/246 (19%), Positives = 72/246 (29%), Gaps = 23/246 (9%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTS-IYASEGTFAHNLLAHC-------LEQGVDAE 57
             LS S       C +   LE+   Q  S +  S GT  H++ AH          Q +D  
Sbjct: 815  PLSPSRVDVAQTCSLRWALETSGGQPASGLSQSVGTLIHDVAAHAPMGTITQFTQLLDER 874

Query: 58   TVSHQKLTFENDTRIVDTE--MASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGT 115
                         R+      M   ++   + VR          E P          +G+
Sbjct: 875  WDQLNLPPGWPAQRLRSQAQTMVGKLAQYTSMVR--DDVVEVLVEHPFTVEIAGARISGS 932

Query: 116  ADIL-IFNSTQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALHQYGDIFGRPEALTLTI 172
             D + I  S    IVD K G   P +A+   N QL +Y    LH  G + G        +
Sbjct: 933  IDRVEILRSGDARIVDLKTGRTAPTQADTQVNPQLGIYQLAVLH--GAVPGVEHTHGADL 990

Query: 173  IQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCR 232
            +     T  P         +            T  +        S       +  C  C 
Sbjct: 991  LYIATPTKKPTTRHQPPLTEPDN------NWVTTLIEDTVTTMRSASMTAHRNRLCDQCP 1044

Query: 233  AKVRCP 238
             +  CP
Sbjct: 1045 VRTSCP 1050


>gi|118618003|ref|YP_906335.1| ATP-dependent DNA helicase [Mycobacterium ulcerans Agy99]
 gi|118570113|gb|ABL04864.1| ATP-dependent DNA helicase [Mycobacterium ulcerans Agy99]
          Length = 1057

 Score =  106 bits (264), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 45/255 (17%), Positives = 79/255 (30%), Gaps = 24/255 (9%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAH--CLEQGVDAETVSHQK 63
            L+ S+      CP+    E         + A+ G+  H L+A     E+ + AE     K
Sbjct: 808  LTPSTLQTLNDCPLRWLAERHGGTNPRDLRATIGSVLHALIAEPGASEEQLLAELARVWK 867

Query: 64   LTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP-----------GA 112
            L           E+A   +M+ A+V          TEV +E                   
Sbjct: 868  LLPFEADWFSSNELARHRAMIQAFVEWRGQTRSELTEVGVEIDIDGVLDAARDDGGAIRL 927

Query: 113  TGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEALT 169
             G  D L  +   + +I+D K          A+ N QL +Y        G +    E   
Sbjct: 928  RGRVDRLERDGAGRLVILDIKTAKTPVSKDDAQQNAQLAMYQLAVAE--GMVEAGAEPGG 985

Query: 170  LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
              ++ P     +   +               +++    +   ++ A         +D C 
Sbjct: 986  ARLVYPGKSAAAGAAQRDQDP-----LTPAARDQWRNLVRQAAEAAAGPHFIARRNDGCS 1040

Query: 230  FCRAKVRCPALSRHV 244
             C  +  CPA +   
Sbjct: 1041 HCPIRPSCPAHTDRS 1055


>gi|269125448|ref|YP_003298818.1| hypothetical protein Tcur_1197 [Thermomonospora curvata DSM 43183]
 gi|268310406|gb|ACY96780.1| hypothetical protein Tcur_1197 [Thermomonospora curvata DSM 43183]
          Length = 312

 Score =  106 bits (264), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 43/271 (15%), Positives = 60/271 (22%), Gaps = 49/271 (18%)

Query: 9   ASSSHRWLKCPIAPT---LESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQK 63
            S  + WL+CP       L+   P     +A  S G   HN LA      +   T     
Sbjct: 19  PSRLNTWLECPRRYRMTYLDRPAPPKGPPWAHNSLGLSVHNALASWWRLPLPERTPEAAG 78

Query: 64  LTFENDT-------RIVDTEMASSVSMVLAYVRTFSGPFL--SETEVPLEPFTTEPGATG 114
                                       +        P       E  +   T      G
Sbjct: 79  TLLLRGWIAEGFRDAAQSAAWRERARRWVERYTGGLDPVAEPVGVERTVAVKTLRIALQG 138

Query: 115 TADILIFNSTQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQYGDIFGRPEALTLTI 172
             D L     Q ++VD+K G   P    A  +  L  YA  A H       R E   L  
Sbjct: 139 RIDRLDDRDGQLVVVDYKTGRREPTADDARTSLALGGYAVAAAHVLRRPCRRVELHHL-- 196

Query: 173 IQPRVRTGSPINEWVISADDLLEKAKEFK-------------------------ERGTLA 207
                     +  W  +A+ L       +                         +     
Sbjct: 197 ------PSGTVAAWEHTAESLQRHIDRAEQIAAEASAADEAYRTGPAPAASVRFDLADEQ 250

Query: 208 LSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
                               C +C     CP
Sbjct: 251 AQRAYHEPFDEVFPPRTGPLCAWCDFNRVCP 281


>gi|227824288|ref|ZP_03989120.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226904787|gb|EEH90705.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 181

 Score =  105 bits (263), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 43/151 (28%), Positives = 63/151 (41%), Gaps = 5/151 (3%)

Query: 81  VSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVK 140
           +   +   +          E  ++         GTAD LI       I+D KYG+G+ V 
Sbjct: 1   MLEHVGAAKQSCPDPAVMVEQRVDFSRWVRQGFGTADALIIADGTLHIIDLKYGSGIEVS 60

Query: 141 AENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEF 200
           AE+N QL  Y  GAL Q+GD++   + + LTI QPR +    ++EW + A DLL  A   
Sbjct: 61  AEDNPQLKCYGLGALDQFGDLYD-IDEVRLTIYQPRRQN---VSEWRLPASDLLAWADTL 116

Query: 201 KE-RGTLALSLKSKRAVSLEHYGVNDDSCRF 230
            +    L    K   A             +F
Sbjct: 117 LKPAADLTWDGKGDFACRPCSRIEVRSVGKF 147


>gi|262194197|ref|YP_003265406.1| hypothetical protein Hoch_0903 [Haliangium ochraceum DSM 14365]
 gi|262077544|gb|ACY13513.1| conserved hypothetical protein [Haliangium ochraceum DSM 14365]
          Length = 387

 Score =  105 bits (263), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 50/314 (15%), Positives = 98/314 (31%), Gaps = 37/314 (11%)

Query: 6   FLSASSSHRWLKCPIAPTL---ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET---V 59
            LS S   R+  CP++  L   +  +          GT  H  L H + + + AE    +
Sbjct: 3   RLSYSRLSRYEACPLSYRLHYIDQHVADR-GEPVRFGTAVHAALEHAVREHLAAERCGPL 61

Query: 60  SHQKLTFENDTRIVDTEM------ASSVSMVLAYVRTF---SGPFLSETEVPLEPFTTEP 110
           SH+++         ++ +         ++++  +VR         +   E          
Sbjct: 62  SHERVAVLWQNAWTESGLSGLSLFREGLALLHRFVREQGVVDHLDVLAVEQEFRITVGGF 121

Query: 111 GATGTADI-LIFNSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRPEA 167
              G  D     +     +VD+K         + + + Q+ LY   A   +       + 
Sbjct: 122 EVLGYLDRVDRVDDETVDVVDYKTNRQLFTRDELDGSLQMSLYQLAAQSLWPW----AKR 177

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + LT    R            + +DL    +     G            + ++    + +
Sbjct: 178 VRLTFWMLRHGVQQRT---ERTTEDLEATRRYVGTIGRAI-------DEASDYPARLNSN 227

Query: 228 CRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEM--FKRL 285
           C +C  K  CPA +    LE  +D       +L         + S  K         +R+
Sbjct: 228 CAWCDHKQHCPAYA--AALEGKRDVVCEDEGDLEAVAREREEVASLAKILYSRKSELERV 285

Query: 286 NAGDEIQGYQLVEG 299
                 +  +LV G
Sbjct: 286 LKAHLAEQDELVLG 299


>gi|323126210|gb|ADX30675.1| gp72 [Mycobacterium phage Wonder]
          Length = 271

 Score =  105 bits (263), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/272 (11%), Positives = 68/272 (25%), Gaps = 54/272 (19%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYASE--GTFAHNLLAHCLEQGVDAE--TVSHQK 63
           S S   ++ +CP +  L           A    G+  H +L     + +D +  ++   +
Sbjct: 9   SVSQLKQYERCPYSYKLARVDKVWQRPAAWLPQGSAVHTVLEEYRRRELDGDPMSLEEAQ 68

Query: 64  LTFEND----------------TRIVDTEMA-------------SSVSMVLAYVRTFSGP 94
             F+ +                                        +    A+       
Sbjct: 69  EMFKEEYAKEVSQYTDVTPNFDWWFRSGRYDGASDLERRWHIGLEQIEKFFAWTEGHPEE 128

Query: 95  FLS-------ETEVPLEPFTTEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAENNTQ 146
            +          E+  +         G  D ++ +     I+ D+K G        ++ Q
Sbjct: 129 VIWIAPDGTPGIELGFDIDLDGVLVRGYIDAVLRDSDGNVIVRDYKTGNTPG----DDFQ 184

Query: 147 LMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTL 206
           L +Y+      YG    +     +       +       +     +     +   E+   
Sbjct: 185 LGVYSVALAETYGIEPPQIGDYYMA----GKKGVKGKPTYPYDLGEWPR--ERVAEKFRE 238

Query: 207 ALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
                +      +      D C FC     CP
Sbjct: 239 LEENIAAERFDPDPEP---DKCAFCDVSYHCP 267


>gi|262194027|ref|YP_003265236.1| hypothetical protein Hoch_0715 [Haliangium ochraceum DSM 14365]
 gi|262077374|gb|ACY13343.1| conserved hypothetical protein [Haliangium ochraceum DSM 14365]
          Length = 387

 Score =  105 bits (263), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/293 (15%), Positives = 90/293 (30%), Gaps = 35/293 (11%)

Query: 6   FLSASSSHRWLKCPIAPTL---ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET---V 59
            LS S   R+  CP++  L   +  +          GT  H  L H + + + AE    +
Sbjct: 3   RLSYSRLSRYEACPLSYRLHYIDQHVADR-GEPVRFGTAVHAALEHAVREHLAAERCGPL 61

Query: 60  SHQKLTFENDTRIVDTEM------ASSVSMVLAYVRTF---SGPFLSETEVPLEPFTTEP 110
           SH+++         ++ +         ++++  +VR         +   E          
Sbjct: 62  SHERVAVLWQNAWTESGLSGLSLFREGLALLHRFVREQGVVDHLDVLAVEQEFRITVGGF 121

Query: 111 GATGTADI-LIFNSTQWIIVDFKYGAG--VPVKAENNTQLMLYACGALHQYGDIFGRPEA 167
              G  D     +     +VD+K         + + + Q+ LY   A   +       + 
Sbjct: 122 EVLGYLDRVDRVDDETVDVVDYKTNRQLFTRDELDGSLQMSLYQLAAQSLWPW----AKR 177

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + LT    R            + +DL    +     G            + ++    + +
Sbjct: 178 VRLTFWMLRHGVQQRT---ERTTEDLEATRRYVGTIGRAI-------DEASDYPARLNSN 227

Query: 228 CRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDE 280
           C +C  K  CPA +    LE  +D       +L         + S  K     
Sbjct: 228 CAWCDHKQHCPAYA--AALEGKRDVVCEDEGDLEAVAREREEVASLAKILYSR 278


>gi|289432505|ref|YP_003462378.1| hypothetical protein DehalGT_0555 [Dehalococcoides sp. GT]
 gi|288946225|gb|ADC73922.1| conserved hypothetical protein [Dehalococcoides sp. GT]
          Length = 379

 Score =  105 bits (263), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/303 (13%), Positives = 80/303 (26%), Gaps = 37/303 (12%)

Query: 6   FLSASSSHRWLKCPIAPTL--ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
            LS S   ++  CP+         +      Y S GT  H+   H     V       + 
Sbjct: 3   PLSYSQIDQYQSCPLKYRFLYSDGLKPLEKGYFSFGTTLHDCAEHFFRVKVPPPLSLEKL 62

Query: 64  LTFENDTR--------IVDTEMASSVSMVLA---YVRTFSGPFLSETEVPLEPFTTEPGA 112
           + +              ++         +LA    +           E            
Sbjct: 63  MEYYQSHWRSGGYESVEIEENYRQLGREILAEFHRIHRADFHMPLAVEHQYTVNLDGVKL 122

Query: 113 TGTADILIFNS-TQWIIVDFKYGA--GVPVKAENNTQLMLYACGALHQYGDIFGRPEALT 169
           TG  D +      +  IVD+K           ++N QL LY       +    G      
Sbjct: 123 TGKIDRVDKLPSGELCIVDYKSNKDLFSAEYVQDNLQLSLYQLAVEQIWYLPVGELCLYH 182

Query: 170 LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
           L                  +      ++KE        +   + +          ++ C 
Sbjct: 183 L---------------RSNTVMRCPARSKEVIADARRLVLEVAGKIEKAIFPACENNFCP 227

Query: 230 FCRAKVRCP-ALSRHV----LLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKR 284
            C     CP    ++     L EA+         E     S  + I+  +++ ++ + + 
Sbjct: 228 -CDFAHLCPLYRHKYAPPPQLPEASPIDIPLAVEEYVMLQSRKNEIEVRIESLKEAIIEY 286

Query: 285 LNA 287
             A
Sbjct: 287 CRA 289


>gi|257054727|ref|YP_003132559.1| RecB family exonuclease [Saccharomonospora viridis DSM 43017]
 gi|256584599|gb|ACU95732.1| RecB family exonuclease [Saccharomonospora viridis DSM 43017]
          Length = 286

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 69/256 (26%), Gaps = 34/256 (13%)

Query: 9   ASSSHRWLKCPIAPT---LESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQK 63
            +    +  CP       L+   P  T  +A  + G   HN L           T    +
Sbjct: 20  PARLSLYDDCPRRFRMTYLDQPAPSRTGPWAHTTLGAVIHNALRELFALPASERTPERAE 79

Query: 64  LTFENDTR-----------IVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE--- 109
                  R                     +  +      + P   E  V     +     
Sbjct: 80  ALVSRHWRSGGFADAEQVARYAEAARRWTADYVERHGADAEPVGVERWVSATVGSDPASP 139

Query: 110 -PGATGTADILIFNSTQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQYGDIFGRPE 166
                G AD +  +  + +++D+K G   P    A  +  L LYA  A         R E
Sbjct: 140 SLIVEGRADRIDAHDGELVVIDYKTGRTPPSDEHARRSRALALYAIAASRTLRKPCSRVE 199

Query: 167 ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE----HYG 222
              +          + +     +  DL E  ++ +E    + +   K     +       
Sbjct: 200 LHHV--------PTATVAVAEHTDADLNEHVQKAEETAAASRAAADKLTRGGDPDQLFPA 251

Query: 223 VNDDSCRFCRAKVRCP 238
                C +C  +  CP
Sbjct: 252 RPAPRCAWCELRSHCP 267


>gi|227502911|ref|ZP_03932960.1| helicase [Corynebacterium accolens ATCC 49725]
 gi|227076333|gb|EEI14296.1| helicase [Corynebacterium accolens ATCC 49725]
          Length = 846

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/253 (16%), Positives = 75/253 (29%), Gaps = 14/253 (5%)

Query: 7   LSASSSHRWLKCPIAPTLESKIPQTTS-IYASEGTFAHNLLAHCLEQ--GVDAETVSHQK 63
           LS S     L CP+   + +     +   +   GT AH  L           A  +  + 
Sbjct: 592 LSPSRVEALLNCPLKAIVGNLAEDPSGAEHLLRGTMAHAFLEAIGRGMDAEKARLLVMEA 651

Query: 64  LTFENDTRIVD-----TEMASSVSMVLAYVRTFS-GPFLSETEVPLEPFT-TEPGATGTA 116
                D           E +  +     + +       L+  EV +      +    G  
Sbjct: 652 YELILDVPQWQLQSKLEEFSRLLERTQQWAQQSEVKNELAGVEVLVYVEVAPDIRVGGFM 711

Query: 117 DILIFN-STQWIIVDFKYGAGVPVK--AENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
           D L+ +    +++VD K G     +  AE N QLM Y         D     +   +   
Sbjct: 712 DRLMKDGDGNYLVVDLKTGKSAATQAEAEENRQLMTYQLALSRGSFDGQRVRDGEGMPRA 771

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
              +      +  + +       A+  +E   L  SL ++     +     +  C  C  
Sbjct: 772 GGVLVYPGKDSSKITTRTQSQLTAEALEEFSALLPSLAAEL-RGPQLTARTNKDCDKCPI 830

Query: 234 KVRCPALSRHVLL 246
           +  CP      + 
Sbjct: 831 RTICPVQEEGKMT 843


>gi|192824065|ref|YP_001994527.1| gp69 [Mycobacterium phage KBG]
 gi|190610295|gb|ACE79817.1| gp69 [Mycobacterium phage KBG]
          Length = 304

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 45/273 (16%), Positives = 78/273 (28%), Gaps = 62/273 (22%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYA--SEGTFAHNLLAHCL--EQGVDAETVSHQK 63
           S S    + KCP+A  L           A   +GT  H +  H +    G +      ++
Sbjct: 46  SVSQLSSFEKCPMAYKLARIDKVWRRPAAWLQQGTAVHAVAEHYMLRRLGFEPGGPMTRE 105

Query: 64  LTFENDTRIVDTEMAS--SVSMVLAYVRT---FSGPFLSE-------------------- 98
             +E         ++    V+  L +  +   + GP   E                    
Sbjct: 106 EAYEVFKDSYQEGISESTDVTPNLDWWFSSGPYRGPDDVERRWKIGLEQVDKVIDWIENH 165

Query: 99  --------------TEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENN 144
                          E+ L+    +    G  D ++    + ++VD K G        ++
Sbjct: 166 PSLEVWSTPDGKPGIELDLDFMLGDIQIRGFIDAVLILDGEPMVVDHKTGLKPG----DD 221

Query: 145 TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERG 204
            QL +YA      YG        +   I                   DL +  +E     
Sbjct: 222 FQLAVYALALKKLYGL------DVQRGIYFMAKTGKPTYPY------DLTDWTEEKITER 269

Query: 205 TLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
            LA+  K +     E      D+C  C   + C
Sbjct: 270 FLAMEAKLEA---GEFEPNPGDACGRCDVALSC 299


>gi|57234561|ref|YP_181362.1| hypothetical protein DET0620 [Dehalococcoides ethenogenes 195]
 gi|57225009|gb|AAW40066.1| conserved domain protein [Dehalococcoides ethenogenes 195]
          Length = 379

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/303 (12%), Positives = 75/303 (24%), Gaps = 37/303 (12%)

Query: 6   FLSASSSHRWLKCPIAPTL--ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
            LS S   ++  CP+         +      Y S GT  H+   +     V         
Sbjct: 3   PLSYSQIDQYQSCPLKYRFLYIDGLKPPAKGYFSFGTTLHDCAEYFFRVKVPPPPSLENL 62

Query: 64  LTFE--------NDTRIVDTEMASS---VSMVLAYVRTFSGPFLSETEVPLEPFTTEPGA 112
           + +          ++   +         +      + +         E            
Sbjct: 63  MEYYCLHWRSEGYESAEAEENYRQLGGKILADFHRIHSADFHMPLAVEHQYTVNLDGVKL 122

Query: 113 TGTADILIFNS-TQWIIVDFKYGA--GVPVKAENNTQLMLYACGALHQYGDIFGRPEALT 169
           TG  D +      +  I+D+K           +NN QL LY       +    G      
Sbjct: 123 TGKIDRVDKLPSGELCIIDYKSNKDLFSAEYVQNNLQLSLYQLAVEQIWFLPVGELCLYH 182

Query: 170 LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
           L                  +A     ++KE        +   +++          +  C 
Sbjct: 183 L---------------RSNTAMRCPARSKEVIADARNLVLEVAEKIEKAIFPACENSFCP 227

Query: 230 FCRAKVRCP-ALSRHVLLEATKDPSTNT----TVELSKAYSSISLIKSYVKACEDEMFKR 284
            C     CP    ++                   E  +  S    I++ +   ++ + + 
Sbjct: 228 -CDFAHLCPLYRHKYAPPPQLPQAPPVDISHAVEEYVELQSRKGEIEARIDTLKEAIIEY 286

Query: 285 LNA 287
             A
Sbjct: 287 CRA 289


>gi|73748458|ref|YP_307697.1| hypothetical protein cbdb_A602 [Dehalococcoides sp. CBDB1]
 gi|73660174|emb|CAI82781.1| conserved domain protein [Dehalococcoides sp. CBDB1]
          Length = 379

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/303 (13%), Positives = 80/303 (26%), Gaps = 37/303 (12%)

Query: 6   FLSASSSHRWLKCPIAPTL--ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
            LS S   ++  CP+         +      Y S GT  H+   H     V       + 
Sbjct: 3   PLSYSQIDQYQSCPLKYRFLYIDGLKPLEKGYFSFGTTLHDCAEHFFRVKVPPPLSLEKL 62

Query: 64  LTFENDTR--------IVDTEMASSVSMVLA---YVRTFSGPFLSETEVPLEPFTTEPGA 112
           + +              ++         +LA    +           E            
Sbjct: 63  MEYYQSHWRSGGYESVEIEENYRQLGREILAEFHRIHRADFHMPLAVEHQYTVNLDGVKL 122

Query: 113 TGTADILIFNS-TQWIIVDFKYGA--GVPVKAENNTQLMLYACGALHQYGDIFGRPEALT 169
           TG  D +      +  IVD+K           ++N QL LY       +    G      
Sbjct: 123 TGKIDRVDKLPSGELCIVDYKSNKDLFSAEYVQDNLQLSLYQLAVEQIWYLPVGELCLYH 182

Query: 170 LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
           L                  +      ++KE        +   + +          ++ C 
Sbjct: 183 L---------------RSNTVMRCPARSKEVIADARRLVLEVAGKIEKAIFPACENNFCP 227

Query: 230 FCRAKVRCP-ALSRHV----LLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKR 284
            C     CP    ++     L EA+         E     S  + I+  +++ ++ + + 
Sbjct: 228 -CDFAHLCPLYRHKYAPPPQLPEASPIDIPLAVEEYVMLQSRKNEIEVRIESLKEAIIEY 286

Query: 285 LNA 287
             A
Sbjct: 287 CRA 289


>gi|29566091|ref|NP_817661.1| gp72 [Mycobacterium phage Bxz2]
 gi|29424816|gb|AAN01826.1| gp72 [Mycobacterium phage Bxz2]
          Length = 271

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/272 (11%), Positives = 68/272 (25%), Gaps = 54/272 (19%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYASE--GTFAHNLLAHCLEQGVDAE--TVSHQK 63
           S S   ++ +CP +  L           A    G+  H +L     + +D +  ++   +
Sbjct: 9   SVSQLKQYERCPYSYKLARVDKVWQRPAAWLPQGSAVHTVLEEYRRRELDGDPMSLEEAQ 68

Query: 64  LTFEND----------------TRIVDTEMA-------------SSVSMVLAYVRTFSGP 94
             F+ +                                        +    A+       
Sbjct: 69  EMFKEEYAKEVSQYTDVTPNFDWWFRSGRYDGASDLERRWHIGLEQIEKFFAWTEGHPEE 128

Query: 95  FLS-------ETEVPLEPFTTEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAENNTQ 146
            +          E+  +         G  D ++ +     I+ D+K G        ++ Q
Sbjct: 129 VIWIAPDGTPGIELGFDIDLDGVLVRGYIDTVLRDSDGNVIVRDYKTGNTPG----DDFQ 184

Query: 147 LMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTL 206
           L +Y+      YG    +     +       +       +     +     +   E+   
Sbjct: 185 LGVYSVALAETYGIEPPQIGDYYMA----GKKGVKGKPTYPYDLGEWPR--ERVAEKFRE 238

Query: 207 ALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
                +      +      D C FC     CP
Sbjct: 239 LEENIAAERFDPDPEP---DKCAFCDVSYHCP 267


>gi|147669238|ref|YP_001214056.1| exonuclease-like protein [Dehalococcoides sp. BAV1]
 gi|146270186|gb|ABQ17178.1| RecB family exonuclease-like protein [Dehalococcoides sp. BAV1]
          Length = 379

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/303 (13%), Positives = 82/303 (27%), Gaps = 37/303 (12%)

Query: 6   FLSASSSHRWLKCPIAPTL--ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
            LS S   ++  CP+         +      Y S GT  H+   H     V       + 
Sbjct: 3   PLSYSQIDQYQSCPLKYRFLYIDGLKPLEKGYFSFGTTLHDCAEHFFRVKVPPPLSLEKL 62

Query: 64  LTFENDTR--------IVDTEMASSVSMVLA---YVRTFSGPFLSETEVPLEPFTTEPGA 112
           + +              ++         +LA    +           E            
Sbjct: 63  MEYYQSHWRSGGYESVEIEENYRQLGREILAEFHRIHRADFHMPLAVEHQYTVNLDGVKL 122

Query: 113 TGTADILIFNS-TQWIIVDFKYGA--GVPVKAENNTQLMLYACGALHQYGDIFGRPEALT 169
           TG  D +      +  IVD+K           ++N QL LY       +    G      
Sbjct: 123 TGKIDRVDKLPSGELCIVDYKSNKDLFSAEYVQDNLQLSLYQLAVEQIWYLPVGELCLYH 182

Query: 170 LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
           L                  +A     ++KE        +   +++          ++ C 
Sbjct: 183 L---------------RSNTAMRCPARSKEVIADARRLVLEVAEKIEKAIFPACENNFCP 227

Query: 230 FCRAKVRCP-ALSRHV----LLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKR 284
            C     CP    ++     L EA+         E        + I++ +++ ++ + + 
Sbjct: 228 -CDFAHLCPLYRHKYAPPPQLPEASPIDIPLAVEEYVMLQFRKNEIEARIESLKEAIIEY 286

Query: 285 LNA 287
             A
Sbjct: 287 CRA 289


>gi|227832526|ref|YP_002834233.1| putative ATP-dependent DNA helicase II [Corynebacterium aurimucosum
            ATCC 700975]
 gi|262183606|ref|ZP_06043027.1| putative ATP-dependent DNA helicase II [Corynebacterium aurimucosum
            ATCC 700975]
 gi|227453542|gb|ACP32295.1| putative ATP-dependent DNA helicase II [Corynebacterium aurimucosum
            ATCC 700975]
          Length = 1004

 Score =  105 bits (261), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/265 (17%), Positives = 79/265 (29%), Gaps = 26/265 (9%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTT-SIYASEGTFAHNLLAHCLEQGVDA---ETVSHQ 62
            +S S     L CP+   L   +   + +I    G  AH  L               V   
Sbjct: 740  VSPSRVDALLSCPLNAVLGQLVEDDSANINLLRGNLAHAFLEALGRGASTEPAKRLVLDA 799

Query: 63   KLTFENDTRIVDTEMASSVSMVLAYVRTFS-------GPFLSETEVPLEPFTTEPGATGT 115
              +             +    ++    ++         P   E  V ++    +    G 
Sbjct: 800  FDSLLEGPAWHREASLADFERLIDRTHSWVLSSSTSLEPVGVEVPVTVDIG-PDVTIRGF 858

Query: 116  ADILIFNSTQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
             D L      +++VD K G  VP    A+NNTQLM Y     H                +
Sbjct: 859  IDRLAKAGEDYVVVDLKTGTKVPSADSAQNNTQLMTYQLALAHGELVTAPVEPGGESQAV 918

Query: 174  QPRVRTGSPINEWVI-----------SADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
              R   G P    V+           + +   +  +E +E      SL ++     +   
Sbjct: 919  SIRTGDGLPRGGGVLVYPRSTTASVSTREQATKPPEELEEFAQALPSLVAEL-RGPDLTA 977

Query: 223  VNDDSCRFCRAKVRCPALSRHVLLE 247
              +  C  C  +  CP ++   L+ 
Sbjct: 978  RENADCDRCPIRSICPVMNEGGLVT 1002


>gi|298674325|ref|YP_003726075.1| UvrD/REP helicase [Methanohalobium evestigatum Z-7303]
 gi|298287313|gb|ADI73279.1| UvrD/REP helicase [Methanohalobium evestigatum Z-7303]
          Length = 1085

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/249 (15%), Positives = 75/249 (30%), Gaps = 22/249 (8%)

Query: 7    LSASSSHRWLKCPIAPTLES--KIPQTTSI----YASEGTFAHNLLAHCLEQGVDAETVS 60
             S SS   + +CP    L+   ++P  +S      A+ G+F H +L   +++ V+ +   
Sbjct: 840  FSYSSIKTYEECPKKYELQELLRMPDRSSEKLGEAANIGSFVHKVLEIGVKRKVETKDQL 899

Query: 61   HQKLTFENDTRIVDTEMASSVSMV--LAYVRTFSGPFL---SETEVPLEPFTTEPGATGT 115
            +  +    +       M                    +      E             G 
Sbjct: 900  YNIVYELAEKPDWK--MIDLKKTYTLFDTFWERHKDKIHYNFAVEKRFSVPIGGFYFKGF 957

Query: 116  ADILIFNST---QWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTI 172
             D + F S       ++D+K G   P   +   QL+LYA G  + Y +       +TL +
Sbjct: 958  IDRVDFLSGCDTDVEVIDYKAGKTDPPTEDRARQLLLYAYGFNYLYPE--YTVRRVTLEM 1015

Query: 173  IQPRVRTGSPINEWVISADDLLEKAKEFKERG----TLALSLKSKRAVSLEHYGVNDDSC 228
            +         +N   +    +    K                 +    +      +   C
Sbjct: 1016 LGKEKPRSFELNGAGVYESIIDRMTKPLDNNAIQNMVETAKWIAHDYENGFEKTGDHRIC 1075

Query: 229  RFCRAKVRC 237
              C  ++ C
Sbjct: 1076 ENCGFRLYC 1084


>gi|297562751|ref|YP_003681725.1| UvrD/REP helicase [Nocardiopsis dassonvillei subsp. dassonvillei DSM
            43111]
 gi|296847199|gb|ADH69219.1| UvrD/REP helicase [Nocardiopsis dassonvillei subsp. dassonvillei DSM
            43111]
          Length = 1060

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/250 (12%), Positives = 63/250 (25%), Gaps = 23/250 (9%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
             +S S    +  C +   LE     ++    ++ GT     +           T      
Sbjct: 817  RVSPSQVESFTNCQLRWLLERAAGASSGDSASALGTV----VHAVAVLVAQGSTPDEISG 872

Query: 65   TFENDTRIVD-----------TEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT 113
              +     +D               + V  ++ +        +  TE            T
Sbjct: 873  RMDEIWADLDFGGPWQARAQRDRADTMVRKLVDWEAANDRELVV-TEEGFRVDVGGIEIT 931

Query: 114  GTADILIFNS-TQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTI 172
            G  D L  +   + ++VD K G         + QL +Y    L       G  E     +
Sbjct: 932  GRVDRLERDDQGRAVVVDIKTGKNKADDLARHPQLGVYQMAVLKGAFAKLGLTEPGGAAL 991

Query: 173  IQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCR 232
            +Q   +      +      +  +            +   +            +  CR C 
Sbjct: 992  VQVGEKIQRAREQPQPPLSEDPDPG-----WAGTLVREVATGMGGSRFTATRNKGCRSCA 1046

Query: 233  AKVRCPALSR 242
             +  CP    
Sbjct: 1047 VRACCPVQDE 1056


>gi|108798374|ref|YP_638571.1| UvrD/REP helicase [Mycobacterium sp. MCS]
 gi|119867471|ref|YP_937423.1| UvrD/REP helicase [Mycobacterium sp. KMS]
 gi|108768793|gb|ABG07515.1| UvrD/REP helicase [Mycobacterium sp. MCS]
 gi|119693560|gb|ABL90633.1| UvrD/REP helicase [Mycobacterium sp. KMS]
          Length = 1051

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 78/256 (30%), Gaps = 32/256 (12%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLL------AHCLEQGVD---A 56
            LS S+      CP+   LE         + ++ G+  H L+         L   ++   A
Sbjct: 802  LSPSTLQALTDCPLRWLLERHGGRDGRDVRSAVGSLLHALVSEPGRTESQLLNDLERVWA 861

Query: 57   ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVP-----LEPFTTEPG 111
            +     +   +N+       M S+     A  R       +E +V       +       
Sbjct: 862  DLPYEAQWHADNELTRHQA-MLSAFEQWRAQTRRELTEVGTEIDVDGVVCDADDGRPAVR 920

Query: 112  ATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQY---GDIFGRP 165
              G  D L  +S  + ++VD K G        A+ + QL +Y           GD+ G  
Sbjct: 921  VRGRLDRLERDSAGRLVVVDIKTGKSPVTKDDAQRHAQLAMYQLAVAAGLLAEGDVPGGG 980

Query: 166  EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
            + + L                  +  +      E   +    +   +            +
Sbjct: 981  KLVYL----------GKSGAAGPTEREQDALTPETVAQWRQDVGEAAAATQGPGFVARVN 1030

Query: 226  DSCRFCRAKVRCPALS 241
            DSC  C  +  CPA S
Sbjct: 1031 DSCAHCPVRSSCPAQS 1046


>gi|126434058|ref|YP_001069749.1| UvrD/REP helicase [Mycobacterium sp. JLS]
 gi|126233858|gb|ABN97258.1| UvrD/REP helicase [Mycobacterium sp. JLS]
          Length = 1051

 Score =  103 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/256 (16%), Positives = 78/256 (30%), Gaps = 32/256 (12%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLL------AHCLEQGVD---A 56
            LS S+      CP+   LE         + ++ G+  H L+         L   ++   A
Sbjct: 802  LSPSTLQALTDCPLRWLLERHGGRDGRDVRSAVGSLLHALVSEPGRTESQLLNDLERVWA 861

Query: 57   ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVP-----LEPFTTEPG 111
            +     +   +N+       M S+     A  R       +E +V       +       
Sbjct: 862  DLPYEAQWHADNELTRHQA-MLSAFEQWRAQTRRELTEVGTEIDVDGVVCDADDGRPAVR 920

Query: 112  ATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQY---GDIFGRP 165
              G  D L  +S  + ++VD K G        A+ + QL +Y           GD+ G  
Sbjct: 921  VRGRLDRLERDSAGRLVVVDIKTGKSPVTKDDAQRHAQLAMYQLAVAAGLLAEGDVPGGG 980

Query: 166  EALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVND 225
            + + L                  +  +      +   +    +   +            +
Sbjct: 981  KLVYL----------GKSGAAGPTEREQDALTPDTVAQWRQDVGEAAAATQGPGFVARVN 1030

Query: 226  DSCRFCRAKVRCPALS 241
            DSC  C  +  CPA S
Sbjct: 1031 DSCAHCPVRSSCPAQS 1046


>gi|270307980|ref|YP_003330038.1| hypothetical protein DhcVS_558 [Dehalococcoides sp. VS]
 gi|270153872|gb|ACZ61710.1| hypothetical protein DhcVS_558 [Dehalococcoides sp. VS]
          Length = 379

 Score =  103 bits (258), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 48/303 (15%), Positives = 83/303 (27%), Gaps = 37/303 (12%)

Query: 6   FLSASSSHRWLKCPIAPTL--ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
            LS S   ++L CP+         +      Y S GT  H+   H     V       + 
Sbjct: 3   PLSYSQIDQYLSCPLKYRFLYIDGLKPLEKGYFSFGTTLHDCAEHFFRIKVPPPPSLEKM 62

Query: 64  LTFENDTR--------IVDTEMASSVSMVLA---YVRTFSGPFLSETEVPLEPFTTEPGA 112
           L +               +         +LA    + +         E            
Sbjct: 63  LEYYRLHWRSEGYESVEAEENYRQLGKEILAEFCRIHSADFHMPLAVEYQYTVNLDGVKL 122

Query: 113 TGTADILI-FNSTQWIIVDFKYGA--GVPVKAENNTQLMLYACGALHQYGDIFGRPEALT 169
           TG  D +    S +  IVD+K           +NN QL LY       +    G      
Sbjct: 123 TGKIDRVDKLLSGELCIVDYKSNKDLFSSEYVQNNLQLSLYQLAVEQIWFLPVGELCLYH 182

Query: 170 LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
           L                  +A     ++KE        +   +++          +  C 
Sbjct: 183 L---------------RSNTAMRCSSRSKEVITDARQLVLEVAEKIKKAIFPACENGFCP 227

Query: 230 FCRAKVRCP-ALSRHV----LLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMFKR 284
            C     CP    ++     L EA          E ++  S  S I++ +   ++ + + 
Sbjct: 228 -CDFAHLCPLYRHKYAPPPQLPEAPAVDIPRAVEEYAELQSRKSEIEARIDTLKESIIEY 286

Query: 285 LNA 287
             A
Sbjct: 287 CRA 289


>gi|219851287|ref|YP_002465719.1| UvrD/REP helicase [Methanosphaerula palustris E1-9c]
 gi|219545546|gb|ACL15996.1| UvrD/REP helicase [Methanosphaerula palustris E1-9c]
          Length = 1019

 Score =  103 bits (258), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/251 (12%), Positives = 69/251 (27%), Gaps = 35/251 (13%)

Query: 6    FLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ- 62
              SAS+   +  CP+        ++P         G+  H+++ H       ++++  Q 
Sbjct: 779  RFSASALSTYQDCPLQFKFANLYRVPLPRQPQLVFGSTLHSVIEHLTRNPDPSQSLRDQG 838

Query: 63   KLTFENDT-----RIVDTEMASS------VSMVLAYVRTFSGPFLSETEVPLEPFTTEPG 111
                E             E  +       +   LA+ +  +   +   E           
Sbjct: 839  LALLEEYWSPEPYESKTQESEAHDSASALLDTYLAW-QAGNPNTVIGVEKEFTFSFAGHS 897

Query: 112  ATGTADILIFN-STQWIIVDFKYGAGV----PVKAENNTQLMLYACGALHQYGDIFGRPE 166
              G  D L       ++++DFK G             + QL LY+      Y  +  + E
Sbjct: 898  IHGFIDRLEQTPDGNYVVIDFKSGKKPDSLTKKAVGEHIQLNLYSMAVQQMYQVLPEKAE 957

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
               L               ++ + + +                              ++ 
Sbjct: 958  LFYL--------KDGKRVSYLPTEETIQVFTGTLSTLIGGI-------TREEFPPKSDNQ 1002

Query: 227  SCRFCRAKVRC 237
             C++C  +  C
Sbjct: 1003 RCQWCAYRPLC 1013


>gi|284033230|ref|YP_003383161.1| UvrD/REP helicase [Kribbella flavida DSM 17836]
 gi|283812523|gb|ADB34362.1| UvrD/REP helicase [Kribbella flavida DSM 17836]
          Length = 1076

 Score =  103 bits (258), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/255 (14%), Positives = 73/255 (28%), Gaps = 26/255 (10%)

Query: 10   SSSHRWLKCPIAPTL--ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFE 67
            S+    + CP+   L   +     ++     G   H L    +  G             +
Sbjct: 821  SALTTIVDCPLRWFLQRRAGGETPSTSAIGFGMVLHTLA-DAVATGTLPPDADELNGWLD 879

Query: 68   NDTRIVD-----------TEMASSVSMVLAYVRTFSGPFLSETEVPL-----EPFTTEPG 111
                 ++            E   ++   +A+ +      +  +EV       +       
Sbjct: 880  KVWTQLEFESAWISDRERVEAEQALRRFVAWHQGRPDRRMIGSEVEFSVLLPDADHPAVQ 939

Query: 112  ATGTADILIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACG-ALHQYGDIFGRPEA 167
              G  D +  +   +  ++D K G   P K     + QL +Y    A  Q   +    E+
Sbjct: 940  VKGRMDRVEQDADGKIRVIDLKTGRTAPTKPAVARHVQLAIYQRAIASRQLKLLGEDAES 999

Query: 168  LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
                ++Q R            +    LE  +  +     A+    +   S E     +D 
Sbjct: 1000 GGAELVQLRHDDSGLPKVQGQAP---LEPGENGRTWLDEAVEEAEEMVRSEEFVAKRNDG 1056

Query: 228  CRFCRAKVRCPALSR 242
            C  C  +  CP    
Sbjct: 1057 CSRCDVRGLCPIQPE 1071


>gi|331694961|ref|YP_004331200.1| UvrD/REP helicase [Pseudonocardia dioxanivorans CB1190]
 gi|326949650|gb|AEA23347.1| UvrD/REP helicase [Pseudonocardia dioxanivorans CB1190]
          Length = 1106

 Score =  103 bits (258), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/278 (14%), Positives = 70/278 (25%), Gaps = 54/278 (19%)

Query: 6    FLSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNL------------LAHCLEQ 52
             +S S   R + CP+   LE        ++ A  G+  H L            L   L  
Sbjct: 831  PVSPSDVERIVACPLRWVLERHGGGDVGALAAVTGSLVHALVQASAAGAQPAELEDALRS 890

Query: 53   GVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFL-SETEVPLEPFTTE-- 109
                  +      F          M ++    +   R      +  E  V L+       
Sbjct: 891  A--WSHLDAGAPWFGRRELERVRAMLAAFDDWVRTSRDQGLRLVAVEQPVRLDLPVEGDL 948

Query: 110  -----------------PGATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLML 149
                                 G  D L  +   + ++VD K G        A  + QL +
Sbjct: 949  PPDGSAQPEVGRSGGPWLQLRGRVDRLEVDSEGRPVVVDVKTGKTAVSARAAAEHPQLAV 1008

Query: 150  YACGALHQY-------GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKE 202
            Y   A           G   G    + L   +         ++  + A +L         
Sbjct: 1009 YQLAAALGAFGRLLEKGVTPGGARLVYL-ADRKASGQAKEPSQPPLDAAELARW------ 1061

Query: 203  RGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
                 ++  ++              C  C  +  CPA 
Sbjct: 1062 --RGVVATCAEETSGSAFVARVSADCERCPVRTSCPAR 1097


>gi|313812633|gb|EFS50347.1| UvrD/REP helicase [Propionibacterium acnes HL025PA1]
          Length = 1061

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 89/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 781  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 840

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 841  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 899

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 900  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 959

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I   + +    ++       V   D+  E           ++    + 
Sbjct: 960  ASVSGAELVHLRIGAGKGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1018

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1019 VTSGEYPAIANSGCGHCPARAGCPAL 1044


>gi|315080857|gb|EFT52833.1| UvrD/REP helicase [Propionibacterium acnes HL078PA1]
          Length = 1061

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 781  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 840

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 841  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 899

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 900  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 959

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 960  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1018

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1019 VTSGEYPAIANRGCGHCPARAGCPAL 1044


>gi|327329921|gb|EGE71675.1| putative ATP-dependent DNA helicase [Propionibacterium acnes
            HL097PA1]
          Length = 1058

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 89/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 778  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 837

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 838  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 896

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 897  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 956

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I   + +    ++       V   D+  E           ++    + 
Sbjct: 957  ASVSGAELVHLRIGAGKGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1015

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1016 VTSGEYPAIANSGCGHCPARAGCPAL 1041


>gi|313822552|gb|EFS60266.1| UvrD/REP helicase [Propionibacterium acnes HL036PA2]
          Length = 1061

 Score =  103 bits (256), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 781  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 840

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 841  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 899

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 900  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 959

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 960  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1018

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1019 VTSGEYPAIANRGCGHCPARAGCPAL 1044


>gi|172040183|ref|YP_001799897.1| putative ATP-dependent DNA helicase II [Corynebacterium urealyticum
            DSM 7109]
 gi|171851487|emb|CAQ04463.1| putative ATP-dependent DNA helicase II [Corynebacterium urealyticum
            DSM 7109]
          Length = 1188

 Score =  103 bits (256), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 38/257 (14%), Positives = 73/257 (28%), Gaps = 33/257 (12%)

Query: 7    LSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHCLEQGVDAET------- 58
            LS S       C +    +  +  Q  +     GT  H +    ++Q +  E        
Sbjct: 935  LSPSKLDNIDNCALKTFFDDNRGAQEETNPMRVGTVVHAIAQAIVQQDLSLEDAQYAART 994

Query: 59   -----VSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT----- 108
                 V              +  +A+  S +     T +     E E  L+         
Sbjct: 995  ALKWAVVGPAFEVNAALERWEQGIANLHSWITETC-TQTEGTEWEVEQQLDTTLGTLPTG 1053

Query: 109  -EPGATGTADILIFN-STQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFGR 164
             E    G  D++  +   + ++ DFK G       +A+ + QL  Y        G     
Sbjct: 1054 EEVFLRGRIDLMATDADGRVVVYDFKTGKTPKTAAEAQASRQLGAYQFLVHVNRGKQPYG 1113

Query: 165  PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVN 224
               +     + +++     ++   S + L E  +                          
Sbjct: 1114 AHLIYPATSEGKLKKS---SQPDFSPEQLAETRQNLLAAAEQISEPVQIA-------TPG 1163

Query: 225  DDSCRFCRAKVRCPALS 241
            D  C++C   + CPA  
Sbjct: 1164 DAQCKYCSYHLICPAKD 1180


>gi|314989616|gb|EFT33707.1| UvrD/REP helicase [Propionibacterium acnes HL005PA3]
 gi|315084653|gb|EFT56629.1| UvrD/REP helicase [Propionibacterium acnes HL027PA2]
 gi|328754849|gb|EGF68465.1| UvrD/REP helicase [Propionibacterium acnes HL020PA1]
          Length = 1061

 Score =  103 bits (256), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 781  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 840

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 841  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 899

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 900  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 959

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 960  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1018

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1019 VTSGEYPAIANRGCGHCPARAGCPAL 1044


>gi|50842800|ref|YP_056027.1| putative ATP-dependent DNA helicase [Propionibacterium acnes
            KPA171202]
 gi|50840402|gb|AAT83069.1| putative ATP-dependent DNA helicase [Propionibacterium acnes
            KPA171202]
 gi|315105904|gb|EFT77880.1| UvrD/REP helicase [Propionibacterium acnes HL030PA1]
          Length = 1061

 Score =  103 bits (256), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 781  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 840

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 841  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 899

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 900  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 959

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 960  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1018

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1019 VTSGEYPAIANRGCGHCPARAGCPAL 1044


>gi|327327124|gb|EGE68903.1| putative ATP-dependent DNA helicase [Propionibacterium acnes
            HL096PA3]
          Length = 1061

 Score =  103 bits (256), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 781  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 840

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 841  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 899

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 900  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 959

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 960  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1018

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1019 VTSGEYPAIANRGCGHCPARAGCPAL 1044


>gi|282853718|ref|ZP_06263055.1| UvrD/REP helicase [Propionibacterium acnes J139]
 gi|282583171|gb|EFB88551.1| UvrD/REP helicase [Propionibacterium acnes J139]
          Length = 1085

 Score =  103 bits (256), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 43/260 (16%), Positives = 86/260 (33%), Gaps = 28/260 (10%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQGVDAETV 59
            LSAS     L CP    +  +   ++     AS G+  H +         L + +     
Sbjct: 811  LSASHVGELLTCPRRWFMTRRAGASSGSAFRASIGSLVHRICAENMDQWSLPKALAELEA 870

Query: 60   SHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP----GAT 113
            +  ++    + +      +  ++V     +++      L  TEV ++   T P       
Sbjct: 871  AWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPSGTARVR 929

Query: 114  GTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYGDIFGRP 165
            G+ D L  +    + +VD K G     + + +   Q+ +Y       G            
Sbjct: 930  GSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGPTSVSGA 989

Query: 166  EALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
            E + L I   + +    ++       V   D+              ++    +   S E+
Sbjct: 990  ELVHLRIGAGKGQANPKVDYQNGLVDVPWPDEAEA-VDGCCNWIEASVDRALRIVRSGEY 1048

Query: 221  YGVNDDSCRFCRAKVRCPAL 240
              + +  C  C A+  CPAL
Sbjct: 1049 PAIANRGCGHCPARAGCPAL 1068


>gi|300858869|ref|YP_003783852.1| hypothetical protein cpfrc_01452 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300686323|gb|ADK29245.1| hypothetical protein cpfrc_01452 [Corynebacterium
           pseudotuberculosis FRC41]
          Length = 135

 Score =  103 bits (256), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 50/125 (40%), Gaps = 11/125 (8%)

Query: 243 HVLLEATKD---PSTNTTVELSKAYSSISLIKSYVKACEDEMFK-RLNAGDEIQGYQLVE 298
             L+ A  +   P+     E+++    +  + ++    E       +N G    G++LVE
Sbjct: 3   KNLVLAKHEFAPPAELGDAEIAQVLYRLPSLSAWATDAEAHALSLAVNQGKTWPGFKLVE 62

Query: 299 GRKGNRSFKDINRAQELLTSVLGEEA--FKRILKTPKELEQLYKEQKVSDEFWEELQELI 356
           GR   R + D +   E+  +    +   +   LKT   LE+   ++     F E L +L+
Sbjct: 63  GR-SIRKYADESAVAEMAGTGGITDIYDYDHKLKTITTLEKQAGKK----RFTELLGDLV 117

Query: 357 TRGDG 361
               G
Sbjct: 118 VEPAG 122


>gi|313820643|gb|EFS58357.1| UvrD/REP helicase [Propionibacterium acnes HL036PA1]
 gi|314924886|gb|EFS88717.1| UvrD/REP helicase [Propionibacterium acnes HL036PA3]
          Length = 1058

 Score =  103 bits (256), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 778  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 837

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 838  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 896

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 897  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 956

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 957  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1015

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1016 VTSGEYPAIANRGCGHCPARAGCPAL 1041


>gi|315090099|gb|EFT62075.1| UvrD/REP helicase [Propionibacterium acnes HL110PA4]
          Length = 1061

 Score =  103 bits (256), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 43/260 (16%), Positives = 86/260 (33%), Gaps = 28/260 (10%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQGVDAETV 59
            LSAS     L CP    +  +   ++     AS G+  H +         L + +     
Sbjct: 787  LSASHVGELLTCPRRWFMTRRAGASSGSAFRASIGSLVHRICAENMDQWSLPKALAELEA 846

Query: 60   SHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP----GAT 113
            +  ++    + +      +  ++V     +++      L  TEV ++   T P       
Sbjct: 847  AWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPSGTARVR 905

Query: 114  GTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYGDIFGRP 165
            G+ D L  +    + +VD K G     + + +   Q+ +Y       G            
Sbjct: 906  GSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGPTSVSGA 965

Query: 166  EALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
            E + L I   + +    ++       V   D+              ++    +   S E+
Sbjct: 966  ELVHLRIGAGKGQANPKVDYQNGLVDVPWPDEAEA-VDGCCNWIEASVDRALRIVRSGEY 1024

Query: 221  YGVNDDSCRFCRAKVRCPAL 240
              + +  C  C A+  CPAL
Sbjct: 1025 PAIANRGCGHCPARAGCPAL 1044


>gi|313792360|gb|EFS40459.1| UvrD/REP helicase [Propionibacterium acnes HL110PA1]
 gi|313816226|gb|EFS53940.1| UvrD/REP helicase [Propionibacterium acnes HL059PA1]
 gi|313832979|gb|EFS70693.1| UvrD/REP helicase [Propionibacterium acnes HL056PA1]
 gi|314960466|gb|EFT04568.1| UvrD/REP helicase [Propionibacterium acnes HL002PA2]
 gi|314962479|gb|EFT06579.1| UvrD/REP helicase [Propionibacterium acnes HL082PA1]
 gi|314972836|gb|EFT16933.1| UvrD/REP helicase [Propionibacterium acnes HL053PA1]
 gi|314983660|gb|EFT27752.1| UvrD/REP helicase [Propionibacterium acnes HL005PA1]
 gi|315085338|gb|EFT57314.1| UvrD/REP helicase [Propionibacterium acnes HL002PA3]
 gi|315109403|gb|EFT81379.1| UvrD/REP helicase [Propionibacterium acnes HL030PA2]
 gi|327329832|gb|EGE71587.1| putative ATP-dependent DNA helicase [Propionibacterium acnes
            HL096PA2]
 gi|327443714|gb|EGE90368.1| UvrD/REP helicase [Propionibacterium acnes HL043PA2]
 gi|327443749|gb|EGE90403.1| UvrD/REP helicase [Propionibacterium acnes HL013PA2]
          Length = 1061

 Score =  103 bits (256), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 781  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 840

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 841  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 899

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 900  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 959

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 960  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1018

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1019 VTSGEYPAIANRGCGHCPARAGCPAL 1044


>gi|315077695|gb|EFT49746.1| UvrD/REP helicase [Propionibacterium acnes HL053PA2]
          Length = 1061

 Score =  103 bits (256), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 781  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 840

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 841  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 899

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 900  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 959

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 960  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1018

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1019 VTSGEYPAIANRGCGHCPARAGCPAL 1044


>gi|289428079|ref|ZP_06429782.1| UvrD/REP helicase [Propionibacterium acnes J165]
 gi|289158679|gb|EFD06880.1| UvrD/REP helicase [Propionibacterium acnes J165]
 gi|313825513|gb|EFS63227.1| UvrD/REP helicase [Propionibacterium acnes HL063PA1]
 gi|314978139|gb|EFT22233.1| UvrD/REP helicase [Propionibacterium acnes HL072PA2]
 gi|315088602|gb|EFT60578.1| UvrD/REP helicase [Propionibacterium acnes HL072PA1]
          Length = 1058

 Score =  103 bits (256), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 778  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 837

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 838  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 896

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 897  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 956

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 957  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1015

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1016 VTSGEYPAIANRGCGHCPARAGCPAL 1041


>gi|239990573|ref|ZP_04711237.1| putative ATP-dependent DNA helicase [Streptomyces roseosporus NRRL
           11379]
          Length = 287

 Score =  102 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 37/262 (14%), Positives = 78/262 (29%), Gaps = 30/262 (11%)

Query: 7   LSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
           LS S+  +    C +   L  ++      +     G   H L     ++     T +   
Sbjct: 24  LSPSALDQLANTCTLQWFLGREVKADAPATAAQGFGNVVHVLA----DEVASGRTPADLD 79

Query: 64  LTFEN--------------DTRIVDTEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFT- 107
           +  E                +     +  +++   L + V    G   + +E   +    
Sbjct: 80  VLMERLDSVWNGLAFDAPWKSEQEKDQARAALERFLHWHVLDRGGRTPTASEHDFDVTLE 139

Query: 108 ---TEPGATGTADILIFN-STQWIIVDFKYGAGVP--VKAENNTQLMLYACGALH-QYGD 160
                    G+ D +  +   +  +VDFK G G P   +   + QL +Y          +
Sbjct: 140 AGEYAVRIRGSMDRVEEDAEGRAYVVDFKTGKGAPTKDEVAAHPQLAVYQLAVREGAVDE 199

Query: 161 IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
           +F             ++R  +P  E   +   +  +     E  +  L+  +K+ +    
Sbjct: 200 VFDGRRPEPGGAELVQLRQPAPKKEGGDAFPKVQAQEPLAGEWVSDLLATAAKKVLDERF 259

Query: 221 YGVNDDSCRFCRAKVRCPALSR 242
                  C  C  +  C A   
Sbjct: 260 TPTTGTHCSHCAFRASCSAQPE 281


>gi|289425545|ref|ZP_06427322.1| UvrD/REP helicase [Propionibacterium acnes SK187]
 gi|289154523|gb|EFD03211.1| UvrD/REP helicase [Propionibacterium acnes SK187]
          Length = 1058

 Score =  102 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 778  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 837

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 838  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 896

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 897  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 956

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 957  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1015

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1016 VTSGEYPAIANRGCGHCPARAGCPAL 1041


>gi|313764134|gb|EFS35498.1| UvrD/REP helicase [Propionibacterium acnes HL013PA1]
 gi|314914864|gb|EFS78695.1| UvrD/REP helicase [Propionibacterium acnes HL005PA4]
 gi|314929975|gb|EFS93806.1| UvrD/REP helicase [Propionibacterium acnes HL067PA1]
 gi|315101552|gb|EFT73528.1| UvrD/REP helicase [Propionibacterium acnes HL046PA1]
 gi|327452205|gb|EGE98859.1| UvrD/REP helicase [Propionibacterium acnes HL087PA3]
 gi|328753881|gb|EGF67497.1| UvrD/REP helicase [Propionibacterium acnes HL087PA1]
          Length = 1061

 Score =  102 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 781  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 840

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 841  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 899

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 900  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 959

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 960  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1018

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1019 VTSGEYPAIANRGCGHCPARAGCPAL 1044


>gi|295130854|ref|YP_003581517.1| UvrD/REP helicase [Propionibacterium acnes SK137]
 gi|291375110|gb|ADD98964.1| UvrD/REP helicase [Propionibacterium acnes SK137]
 gi|313771952|gb|EFS37918.1| UvrD/REP helicase [Propionibacterium acnes HL074PA1]
 gi|313801692|gb|EFS42932.1| UvrD/REP helicase [Propionibacterium acnes HL110PA2]
 gi|313807184|gb|EFS45677.1| UvrD/REP helicase [Propionibacterium acnes HL087PA2]
 gi|313809681|gb|EFS47415.1| UvrD/REP helicase [Propionibacterium acnes HL083PA1]
 gi|313819378|gb|EFS57092.1| UvrD/REP helicase [Propionibacterium acnes HL046PA2]
 gi|313830017|gb|EFS67731.1| UvrD/REP helicase [Propionibacterium acnes HL007PA1]
 gi|313838406|gb|EFS76120.1| UvrD/REP helicase [Propionibacterium acnes HL086PA1]
 gi|314967656|gb|EFT11755.1| UvrD/REP helicase [Propionibacterium acnes HL037PA1]
 gi|314975742|gb|EFT19837.1| UvrD/REP helicase [Propionibacterium acnes HL045PA1]
 gi|315095787|gb|EFT67763.1| UvrD/REP helicase [Propionibacterium acnes HL038PA1]
 gi|315098849|gb|EFT70825.1| UvrD/REP helicase [Propionibacterium acnes HL059PA2]
 gi|327442648|gb|EGE89302.1| UvrD/REP helicase [Propionibacterium acnes HL043PA1]
 gi|327453454|gb|EGF00109.1| UvrD/REP helicase [Propionibacterium acnes HL092PA1]
 gi|328761487|gb|EGF75011.1| putative ATP-dependent DNA helicase [Propionibacterium acnes
            HL099PA1]
          Length = 1058

 Score =  102 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 778  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 837

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 838  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 896

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 897  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 956

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 957  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1015

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1016 VTSGEYPAIANRGCGHCPARAGCPAL 1041


>gi|314983239|gb|EFT27331.1| UvrD/REP helicase [Propionibacterium acnes HL110PA3]
          Length = 1058

 Score =  102 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 43/260 (16%), Positives = 86/260 (33%), Gaps = 28/260 (10%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQGVDAETV 59
            LSAS     L CP    +  +   ++     AS G+  H +         L + +     
Sbjct: 784  LSASHVGELLTCPRRWFMTRRAGASSGSAFRASIGSLVHRICAENMDQWSLPKALAELEA 843

Query: 60   SHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP----GAT 113
            +  ++    + +      +  ++V     +++      L  TEV ++   T P       
Sbjct: 844  AWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPSGTARVR 902

Query: 114  GTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYGDIFGRP 165
            G+ D L  +    + +VD K G     + + +   Q+ +Y       G            
Sbjct: 903  GSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGPTSVSGA 962

Query: 166  EALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
            E + L I   + +    ++       V   D+              ++    +   S E+
Sbjct: 963  ELVHLRIGAGKGQANPKVDYQNGLVDVPWPDEAEA-VDGCCNWIEASVDRALRIVRSGEY 1021

Query: 221  YGVNDDSCRFCRAKVRCPAL 240
              + +  C  C A+  CPAL
Sbjct: 1022 PAIANRGCGHCPARAGCPAL 1041


>gi|314920397|gb|EFS84228.1| UvrD/REP helicase [Propionibacterium acnes HL050PA3]
 gi|314956489|gb|EFT00777.1| UvrD/REP helicase [Propionibacterium acnes HL027PA1]
 gi|314957333|gb|EFT01436.1| UvrD/REP helicase [Propionibacterium acnes HL002PA1]
 gi|327452696|gb|EGE99350.1| UvrD/REP helicase [Propionibacterium acnes HL083PA2]
 gi|328752852|gb|EGF66468.1| UvrD/REP helicase [Propionibacterium acnes HL025PA2]
          Length = 1058

 Score =  102 bits (255), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 778  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 837

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 838  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 896

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 897  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 956

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 957  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1015

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1016 VTSGEYPAIANRGCGHCPARAGCPAL 1041


>gi|313827480|gb|EFS65194.1| UvrD/REP helicase [Propionibacterium acnes HL063PA2]
          Length = 1058

 Score =  102 bits (255), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 88/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 778  MAGEIELSASHIGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 837

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 838  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 896

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 897  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 956

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 957  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1015

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1016 VTSGEYPAIANRGCGHCPARAGCPAL 1041


>gi|307328514|ref|ZP_07607688.1| UvrD/REP helicase [Streptomyces violaceusniger Tu 4113]
 gi|306885782|gb|EFN16794.1| UvrD/REP helicase [Streptomyces violaceusniger Tu 4113]
          Length = 1118

 Score =  102 bits (255), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 44/262 (16%), Positives = 80/262 (30%), Gaps = 30/262 (11%)

Query: 7    LSASSSHRWLK-CPIAPTLESKIP-QTTSIYAS-EGTFAHNLLAHCLEQGVDAETVSHQK 63
            LS S+  + +  C +   L  ++     S  A   G   H L     ++     T +   
Sbjct: 855  LSGSALDQLVNTCSLQWFLGREVKADAPSTAAQGFGNVVHVLA----DEVASGRTPADLA 910

Query: 64   LTFENDTRIVD--------------TEMASSVSMVLAY-VRTFSGPFLSETE----VPLE 104
            +  E    + D               +  +++   L + V    G     TE    V LE
Sbjct: 911  VLMERLDSVWDALAFDAPWKSRQEKEQARAALERFLHWHVMERGGRTPVATEHSFDVTLE 970

Query: 105  PFTTEPGATGTADILIFN-STQWIIVDFKYGAGVPVK--AENNTQLMLYACGALH-QYGD 160
                +    G+ D +  +      +VDFK G     +   E++ QL  Y          D
Sbjct: 971  ADVYKVRIRGSMDRVETDGEGHAYVVDFKTGKQAVTRGDVEHHPQLAAYQLAVREGAVDD 1030

Query: 161  IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
            +F             ++R G+   +       +  +     E     L+  + R +    
Sbjct: 1031 LFEGGRPEAGGAELVQLRQGAAKKDGGDDVPKVQAQEPPDGEWVGQLLATAAGRVLDERF 1090

Query: 221  YGVNDDSCRFCRAKVRCPALSR 242
                 D C  C  +  C A + 
Sbjct: 1091 TPTTGDHCERCAFRGACSARAE 1112


>gi|213965910|ref|ZP_03394101.1| helicase, uvrd/rep family [Corynebacterium amycolatum SK46]
 gi|213951488|gb|EEB62879.1| helicase, uvrd/rep family [Corynebacterium amycolatum SK46]
          Length = 1119

 Score =  102 bits (255), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 43/248 (17%), Positives = 77/248 (31%), Gaps = 24/248 (9%)

Query: 9    ASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK----L 64
             S     L CP+   L+   P   +     G+  H  +    +     E  S  +     
Sbjct: 874  PSKVEATLNCPLKAMLDKSAP---TSAMYLGSLLHQAVEAVAKGVTVPEAQSEIRRVFGD 930

Query: 65   TFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFT-TEPGATGTADILIFN- 122
              ++      TE  + ++ +  + R         TEVP++     +    G  D LI + 
Sbjct: 931  LSDDPEWRKRTEEETWLTGLEDWQRWIETKKDIGTEVPVKVNINDDIVIVGRIDRLIEDA 990

Query: 123  STQWIIVDFKYGAGVP--VKAENNTQLMLYACGALH---------QYGDIFGRPEALTLT 171
                 IVD K G   P   + E + QL  Y                  +     E     
Sbjct: 991  DGAVQIVDIKTGKTAPSGKEVEGHAQLATYQLALSKGKLVESGDGLAVNNGEGIEQSGAY 1050

Query: 172  IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFC 231
            ++ PR      I    I++ +  +  ++        +   ++         +  D C+FC
Sbjct: 1051 LVFPRKSHNKTI----ITSREQSKLTEDKLADWERRVEQVARATSGPRALALAGDHCKFC 1106

Query: 232  RAKVRCPA 239
                 CPA
Sbjct: 1107 TLSKACPA 1114


>gi|317125689|ref|YP_004099801.1| hypothetical protein Intca_2568 [Intrasporangium calvum DSM 43043]
 gi|315589777|gb|ADU49074.1| hypothetical protein Intca_2568 [Intrasporangium calvum DSM 43043]
          Length = 308

 Score =  102 bits (255), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 44/250 (17%), Positives = 69/250 (27%), Gaps = 28/250 (11%)

Query: 8   SASSSHRWLKCPIAPTLES-----KIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
           S S    WL CP    ++         +    + S G   HN+L    +      T    
Sbjct: 35  SPSRLLAWLDCPRRYRMQYLDRPRPPARPQRAHTSVGITTHNVLRDFWDLPPGRRTPDGV 94

Query: 63  KLTFENDTRIVDTEMASSVSMVLAYVRTF---------SGPFLSETEVPLEPFTTEPGAT 113
                +    V        +     VR                   E  +   T     T
Sbjct: 95  AELVRSSWIDVGFRDPEQSATWRGRVRETVVAYLRGSNRDQQPVGIERSVALRTASIAVT 154

Query: 114 GTADILIFNSTQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQYGDIFGRPEALTLT 171
           G  D L     + ++VD+K G  VP    A  +  L LYA GA   +     R E   + 
Sbjct: 155 GRVDRLDDREGELVVVDYKTGRQVPTEDDARTSLPLALYAVGAARTFRRSCVRVELHHV- 213

Query: 172 IIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL----EHYGVNDDS 227
                      +     +A+ L  K  E +        + ++ A                
Sbjct: 214 -------PSQTVAAHTHTAESLARKVAEAESIAADLRRVDAEFAERGVESPSFPPRPSPL 266

Query: 228 CRFCRAKVRC 237
           C +C  +  C
Sbjct: 267 CTWCDFRAHC 276


>gi|326771897|ref|ZP_08231182.1| helicase, UvrD/Rep family [Actinomyces viscosus C505]
 gi|326638030|gb|EGE38931.1| helicase, UvrD/Rep family [Actinomyces viscosus C505]
          Length = 1206

 Score =  102 bits (255), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 39/308 (12%), Positives = 66/308 (21%), Gaps = 71/308 (23%)

Query: 6    FLSASSSHRWLKCPIAPTL-ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
             +S S       CP+   L  S      S   + G+  H +     ++ +    +     
Sbjct: 893  RVSPSDVEGLAACPLKWFLTRSGGSAPASDAQALGSLVHAVAERAEKEHLRGPALREAFE 952

Query: 65   TFENDT-----------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT----- 108
                D                  M   +   LA           E  V  +         
Sbjct: 953  ERLTDLGYPATWQGGLAADRARAMIERLDAYLADCDALGVRADVEQPVRADVDIPLSVLS 1012

Query: 109  -------------------EPGATGTADILIF----------------NSTQWIIVDFKY 133
                                   +G  D L                   +    ++D K 
Sbjct: 1013 PAVRQRAGLRIPTKGGNAVPVTISGRIDRLEHVGGLLGGESEDSAGPDRNGTVRVIDLKT 1072

Query: 134  GAGVPVKAENNTQLMLYACG-----------ALHQYGDIFGRPEALTLTIIQPRVRTGSP 182
            G  VP   + + QL  Y              AL   G    +       +  P       
Sbjct: 1073 GQRVPKDVQRHPQLATYRLALSSQGLDVVGGALVFLGKEPSKRSGDGYVLAPPGAALDPS 1132

Query: 183  INEWVISADDLLEKAKEF--------KERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
                  + +       E         +      ++  +   V  +      + CR CR K
Sbjct: 1133 PAAPEPTQEPAQNPDAEANGAADSSEESWAEDLVAAAAMAGVGPQIEARTGEHCRTCRVK 1192

Query: 235  VRCPALSR 242
              CP    
Sbjct: 1193 DSCPVQVE 1200


>gi|282164943|ref|YP_003357328.1| hypothetical protein MCP_2273 [Methanocella paludicola SANAE]
 gi|282157257|dbj|BAI62345.1| hypothetical protein [Methanocella paludicola SANAE]
          Length = 404

 Score =  102 bits (255), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 59/405 (14%), Positives = 106/405 (26%), Gaps = 74/405 (18%)

Query: 4   HAFLSASSSHRWLKCPIAPTLE-------SKIPQTTSIYASEGTFAHNLLAHCL--EQGV 54
           H+ LSA     +  CP+             ++P+  SI A  G   H  L          
Sbjct: 6   HSRLSA-----YENCPLKYRFAYVDRVKLERMPE--SIEAFMGKRVHETLEKLYSDRMLS 58

Query: 55  DAETVSHQKLTFENDT-----------------RIVDTEMASSVSMVLAYVRTFSGPFLS 97
             +T+      ++                              V+        F      
Sbjct: 59  KEDTMDELLDFYDGVWGKNWSDDVQIVRKDLTVENYHETGRRCVADYYRRYAPFDQGRTL 118

Query: 98  ETEVPLEPFTTEPGATGTADILIFN-STQWIIVDFKYGAGVPV--KAENNTQLMLYACGA 154
           + E P+          G  D L      ++ I D+K    +P     + + QL LY  G 
Sbjct: 119 KLEAPVYINIDGYRLMGYIDRLDLTGDGRYEIHDYKTSRSLPEQQYFDGDRQLALYQIGV 178

Query: 155 LHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKR 214
            + + D     E + L                   + + L   +  K      +      
Sbjct: 179 RNMWKD----AEKVDLVWHYLVYDR----EMRSCRSPECL---ERLKASVVGVIQQIEAA 227

Query: 215 AVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTTVEL------SKAYSSIS 268
               +        C +C  +  CP       +             +      +K Y    
Sbjct: 228 EKEYDFPASESGLCNWCEYRSLCPTCKHEAAVGNLPANEFLDDDGVKLVNYYAKLYEEKK 287

Query: 269 LIKSYVKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFK--------------DINRAQE 314
                + A  + + + +    + +G +++  R  +R  K              D   A E
Sbjct: 288 EYNERMDARLELLREAIIDYAKREGVEVI--RGSDRKLKVKIETKAKFPGKGDDEREALE 345

Query: 315 LLTSVLGEEAFKRILKTPK--ELEQLYKEQKVSDEFWEELQELIT 357
           LL    G       L T     L +  K   +       L++ IT
Sbjct: 346 LLLKSAGA---WDNLSTLDTFALARALKNDTLDPALISNLRKFIT 387


>gi|192824246|ref|YP_001994887.1| gp70 [Mycobacterium phage Pukovnik]
 gi|190610476|gb|ACE79996.1| gp70 [Mycobacterium phage Pukovnik]
          Length = 266

 Score =  102 bits (254), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/270 (12%), Positives = 69/270 (25%), Gaps = 53/270 (19%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYASE--GTFAHNLLAHCLEQGVDAETVSHQK-- 63
           S S  +++ +CP+A  L           A    GT  H +     +   +   +S ++  
Sbjct: 8   SVSQLNQYTRCPMAYKLARIDKVWARPAAWLPQGTAFHTVAEVYEKALAEGREMSLERAQ 67

Query: 64  ----------------LTFENDTRIVD-------------TEMASSVSMVLAYVRTFSGP 94
                            T   +                        V     +  T    
Sbjct: 68  EIFREEYAKDIGELCAETPNFEWWTWSGPYNGERDIERRFEIGLEQVEKFYNWRNTKGQT 127

Query: 95  FLS------ETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLM 148
                      E+            G  D ++    +  + D+K G        ++ QL 
Sbjct: 128 IWITPDGKPAIELSFNIELDGIKVRGYIDAVVVVDGKPRVRDYKTGNSPG----DDFQLG 183

Query: 149 LYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLAL 208
           +YA      YG    + +     +   + +   P + + ++        ++  ER     
Sbjct: 184 VYALAIEILYGV---KVDTGDYFMAGKKGKPAKPTDPYDLTEW----TREKVTERFHEVE 236

Query: 209 SLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
           +                D C FC     CP
Sbjct: 237 AKIQAGDFEALPEP---DKCNFCDVSYSCP 263


>gi|309810402|ref|ZP_07704236.1| UvrD/REP helicase [Dermacoccus sp. Ellin185]
 gi|308435642|gb|EFP59440.1| UvrD/REP helicase [Dermacoccus sp. Ellin185]
          Length = 1117

 Score =  102 bits (254), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/264 (12%), Positives = 69/264 (26%), Gaps = 28/264 (10%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
             +S S    + +C +   L +      S+  ++ GT  H L     ++    +    ++ 
Sbjct: 851  RVSPSKIEGFHRCGLNWLLTTNGGFGPSVGASTIGTLVHELAEEFADEPALMDEALEKRW 910

Query: 65   --------TFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTA 116
                          +     M   +   L      +G      E            +G+ 
Sbjct: 911  PRLGLGDSWVSRGEKARAQSMVKKLQGYLGDA-AATGWAGEAAERRFSAIVGRAKISGSI 969

Query: 117  DILIFNSTQ-WIIVDFKYGAGVPVKAE--NNTQLMLYACGALHQYGDIFGRPEALTLTII 173
            D L  +  +   ++D+K G+  P   E   + QL  Y                   L  +
Sbjct: 970  DRLEHHPERGLRVIDYKTGSSKPKDEEVAAHPQLAAYQAALEADAFGPGRPSAGAALVQL 1029

Query: 174  QPRVRTGSPINEWVISADDLLEKAKEF---------------KERGTLALSLKSKRAVSL 218
                 TG+     V +   L+                     +      +   +    + 
Sbjct: 1030 GQAAGTGANSTARVQAQPPLVADEDAASDGEPGAVDEPIVGTRGWAFDLMQRTADGMGAA 1089

Query: 219  EHYGVNDDSCRFCRAKVRCPALSR 242
                  + +C  C  K  CP    
Sbjct: 1090 TFVAAANPNCTMCPVKSSCPIQPE 1113


>gi|314986297|gb|EFT30389.1| UvrD/REP helicase [Propionibacterium acnes HL005PA2]
          Length = 1058

 Score =  102 bits (254), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 89/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS    +L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 778  MAGEIELSASHIGEFLACPRGWFMTRRAGASSGSALRASIGSLVHRICAGNMDQWSLPEA 837

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 838  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 896

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 897  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEAIGP 956

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I     +    ++       V   D+  E           ++    + 
Sbjct: 957  ASVSGAELVHLRIGAGIGQANPKVDYQSGLVDVPWPDE-AEPVDGCCNWVEASVDKALRI 1015

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1016 VTSGEYPAIANRGCGHCPARAGCPAL 1041


>gi|297157456|gb|ADI07168.1| putative ATP-dependent DNA helicase [Streptomyces bingchenggensis
            BCW-1]
          Length = 1132

 Score =  102 bits (254), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/262 (15%), Positives = 78/262 (29%), Gaps = 30/262 (11%)

Query: 7    LSASSSHRWLK-CPIAPTLESKIP-QTTSIYAS-EGTFAHNLLAHCLEQGVDAETVSHQK 63
            LS S+  + +  C +   L  ++   T S  A   G   H L     ++     T +   
Sbjct: 869  LSGSALDQLVNTCSLQWFLGREVKADTPSTAAQGFGNVVHVLA----DEVASGRTPADLA 924

Query: 64   LTFENDTRIVD--------------TEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFT- 107
            +  E    + D                  +++   L + V    G     TE   +    
Sbjct: 925  VLMERLDSVWDALSFDAPWKSRQEKEHARAALERFLRWHVMERGGRAPVATEHEFDVTLE 984

Query: 108  ---TEPGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALH-QYGD 160
                +    G+ D +  +   +  +VDFK G          ++ QL +Y           
Sbjct: 985  ADAYQVRIRGSMDRVEADEEGRAYVVDFKTGKQAVTRDAVAHHPQLAVYQLAVREGAVDG 1044

Query: 161  IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
            +F             ++R G+   E   +   +  +     E     L+  + R +    
Sbjct: 1045 LFADGHPEPGGAELVQLRQGAARKEGGDAVPKVQAQEPPRGEWVGELLATAAGRVLDERF 1104

Query: 221  YGVNDDSCRFCRAKVRCPALSR 242
                 + C  C  +  C A + 
Sbjct: 1105 SPSAGEHCNRCSFRGACSARAE 1126


>gi|302858581|gb|ADL71327.1| gp67 [Mycobacterium phage Eagle]
          Length = 263

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/267 (14%), Positives = 74/267 (27%), Gaps = 54/267 (20%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           S S   ++ KCP +  L           A  ++G+  H  +      G      + Q + 
Sbjct: 9   SVSQLKQYEKCPYSYKLSRLDKAWQRPAAWTAQGSAVHEAIEAWERSGRTMSLEAAQAVF 68

Query: 66  FENDTRIVDTEMA----------------------------SSVSMVLAYVRTFSGPFLS 97
            E+  + ++   A                              V   + +  + +   + 
Sbjct: 69  RESYQKYINAACAITPNFEYWFASGRYGGRLDIARRYDIGLEQVGKYIDWATSHTEEVIW 128

Query: 98  -------ETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLY 150
                    E+  +         G  D +I      I+ D K G        ++ QL +Y
Sbjct: 129 IAPDGTPGIELGFDIDLDGVLVRGFIDAVIETDEGLIVRDHKTGKQPG----DDFQLAVY 184

Query: 151 ACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSL 210
           A     +YG          +          S    +     +L +  KE        L  
Sbjct: 185 AVALAEEYGIEPPELGDYWM--------GQSGKATYPY---NLTDWTKEAITEKFKELDE 233

Query: 211 KSKRAVSLEHYGVNDDSCRFCRAKVRC 237
           K +          ++D+CRFC     C
Sbjct: 234 KVRA--GKFDPNPSEDNCRFCDVSFAC 258


>gi|302521801|ref|ZP_07274143.1| ATP dependent DNA helicase [Streptomyces sp. SPB78]
 gi|302430696|gb|EFL02512.1| ATP dependent DNA helicase [Streptomyces sp. SPB78]
          Length = 439

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/260 (15%), Positives = 80/260 (30%), Gaps = 34/260 (13%)

Query: 7   LSASSSHRWLK-CPIAPTLESKI--PQTTSIYASEGTFAHNLLAHCLEQGVDAETVS--- 60
           LSAS+  + +  C +   L  ++      S     G   H +LA  +  G     +    
Sbjct: 184 LSASALGQLVDVCALQWFLGREVRAEAPASTAQGFGNVVH-VLADEVATGRSPADLDVLM 242

Query: 61  --------HQKLTFENDTRIVDTEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFTT--- 108
                            +        +++   L + V   +G     +E P +       
Sbjct: 243 ERLDTVWDGLAFDAPWKSAQERENARAALERFLRWHVLDRTGRTPVASEHPFDVTLPAGD 302

Query: 109 -EPGATGTADILIFNS-TQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQY--GDIF 162
            E    GT D +  ++  +  +VDFK G   P   + +++ QL +Y              
Sbjct: 303 HEIRIRGTMDRVDADAAGRAYVVDFKTGKNAPTADEVDHHPQLAVYQRAVAEGAVGPLTP 362

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
           G  E + L +   +    SP  +     +          +     L+  + R ++     
Sbjct: 363 GGAELVHLRLEASKKDPLSPKVQPQEFPE---------GDWLPDLLTEAAARVLNERFRP 413

Query: 223 VNDDSCRFCRAKVRCPALSR 242
                C  C  +  C A + 
Sbjct: 414 TPGSHCDHCAFRASCSAKAE 433


>gi|282598672|ref|YP_003358769.1| gp66 [Mycobacterium phage Peaches]
 gi|255928199|gb|ACU41817.1| gp66 [Mycobacterium phage Peaches]
          Length = 263

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/267 (14%), Positives = 73/267 (27%), Gaps = 54/267 (20%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           S S   ++ KCP +  L           A  ++G+  H  +      G      + Q + 
Sbjct: 9   SVSQLKQYEKCPYSYKLSRLDKAWQRPAAWTAQGSAVHEAIEAWERSGRTMSLEAAQAVF 68

Query: 66  FENDTRIVDTEMA----------------------------SSVSMVLAYVRTFSGPFLS 97
            E+  + ++   A                              V   + +  + +   + 
Sbjct: 69  RESYQKYINAACAITPNFEYWFASGRYGGRLDIARRYDIGLEQVGKYIDWATSHTEEVIW 128

Query: 98  -------ETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLY 150
                    E+  +         G  D +I      I+ D K G        ++ QL +Y
Sbjct: 129 IAPDGTPGIELGFDIDLDGVLVRGFIDAVIETDEGLIVRDHKTGKQPG----DDFQLAVY 184

Query: 151 ACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSL 210
           A     +YG          +          S    +     +L +  KE        L  
Sbjct: 185 AVALAEEYGIEPPELGDYWM--------GQSGKATYPY---NLTDWTKEAITEKFKELD- 232

Query: 211 KSKRAVSLEHYGVNDDSCRFCRAKVRC 237
            +           ++D+CRFC     C
Sbjct: 233 -ANVRAGKFDPNPSEDNCRFCDVSFAC 258


>gi|289640634|ref|ZP_06472806.1| conserved hypothetical protein [Frankia symbiont of Datisca
           glomerata]
 gi|289509523|gb|EFD30450.1| conserved hypothetical protein [Frankia symbiont of Datisca
           glomerata]
          Length = 281

 Score =  102 bits (253), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/265 (15%), Positives = 65/265 (24%), Gaps = 32/265 (12%)

Query: 9   ASSSHRWLKCPIAPT---LESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQK 63
            S    + +CP       L+   P     +A  S G+  HN L    ++ +   T +   
Sbjct: 18  PSKLSAFAECPRRYRMAYLDRPAPVKGPAWAHNSLGSSVHNALRAWWDEPLARRTPTRAA 77

Query: 64  LTFENDTRI-----------VDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGA 112
                                    A  V   +A +     P     E  +   T     
Sbjct: 78  HLVRLLWITDGWRDAEQSTTWRERAAEMVGRYVATLDPAREPRAV--ERQVAARTERLAL 135

Query: 113 TGTADILIFNSTQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQYGDIFGRPEALTL 170
           +G  D L     + + VD+K G   P    A  +  L LYA            R E   L
Sbjct: 136 SGRVDRLDDRDGELVAVDYKTGRRPPTDDDARVSPALALYALAVSRTLRRPCWRVELHHL 195

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE----HYGVNDD 226
                       +         L  + +  +     A                       
Sbjct: 196 --------PTGTVASAEHDEASLGRQLRRAEALADDAERAAEALRGGAGPDTAFPPQPGR 247

Query: 227 SCRFCRAKVRCPALSRHVLLEATKD 251
            C +C  +  CP         A  D
Sbjct: 248 LCSWCDYRRHCPEGRAAAPDRAPWD 272


>gi|291447589|ref|ZP_06586979.1| ATP-dependent DNA helicase [Streptomyces roseosporus NRRL 15998]
 gi|291350536|gb|EFE77440.1| ATP-dependent DNA helicase [Streptomyces roseosporus NRRL 15998]
          Length = 371

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/262 (14%), Positives = 78/262 (29%), Gaps = 30/262 (11%)

Query: 7   LSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
           LS S+  +    C +   L  ++      +     G   H L     ++     T +   
Sbjct: 108 LSPSALDQLANTCTLQWFLGREVKADAPATAAQGFGNVVHVLA----DEVASGRTPADLD 163

Query: 64  LTFEN--------------DTRIVDTEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFT- 107
           +  E                +     +  +++   L + V    G   + +E   +    
Sbjct: 164 VLMERLDSVWNGLAFDAPWKSEQEKDQARAALERFLHWHVLDRGGRTPTASEHDFDVTLE 223

Query: 108 ---TEPGATGTADILIFN-STQWIIVDFKYGAGVP--VKAENNTQLMLYACGALH-QYGD 160
                    G+ D +  +   +  +VDFK G G P   +   + QL +Y          +
Sbjct: 224 AGEYAVRIRGSMDRVEEDAEGRAYVVDFKTGKGAPTKDEVAAHPQLAVYQLAVREGAVDE 283

Query: 161 IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
           +F             ++R  +P  E   +   +  +     E  +  L+  +K+ +    
Sbjct: 284 VFDGRRPEPGGAELVQLRQPAPKKEGGDAFPKVQAQEPLAGEWVSDLLATAAKKVLDERF 343

Query: 221 YGVNDDSCRFCRAKVRCPALSR 242
                  C  C  +  C A   
Sbjct: 344 TPTTGTHCSHCAFRASCSAQPE 365


>gi|314966447|gb|EFT10546.1| UvrD/REP helicase [Propionibacterium acnes HL082PA2]
 gi|315103756|gb|EFT75732.1| UvrD/REP helicase [Propionibacterium acnes HL050PA2]
 gi|327327269|gb|EGE69045.1| putative ATP-dependent DNA helicase [Propionibacterium acnes
            HL103PA1]
          Length = 1061

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/266 (17%), Positives = 89/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 781  MAGEIELSASHVGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAENMDQWSLPEA 840

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 841  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 899

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 900  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEVIGP 959

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I   + +    I+       V   D+  E           ++    + 
Sbjct: 960  ASVSGAELVHLRIGAGKGQANPKIDYQSGLVDVPWPDE-AEPVNGCCNWIEASVDKALRI 1018

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1019 VTSGEYPAIANRGCGHCPARAGCPAL 1044


>gi|296270957|ref|YP_003653589.1| hypothetical protein Tbis_2998 [Thermobispora bispora DSM 43833]
 gi|296093744|gb|ADG89696.1| hypothetical protein Tbis_2998 [Thermobispora bispora DSM 43833]
          Length = 306

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/275 (14%), Positives = 71/275 (25%), Gaps = 56/275 (20%)

Query: 9   ASSSHRWLKCPIAPT---LESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQK 63
            S  + WL C        L+   P     +A  S G   HN LA       +  T +   
Sbjct: 18  PSRLNTWLDCRRRYRFTYLDRPAPPKGPPWAHNSLGASVHNALAAWWRAPYERRTPATAA 77

Query: 64  LTFENDT-----------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGA 112
                                       V+  ++ +     P     E  +   T     
Sbjct: 78  ELVAGVWITDGFRDAEQSAQWRERARRMVAAYVSTLDPACEP--VGVERVVATRTEVITV 135

Query: 113 TGTADILIFNSTQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFGRPEALTL 170
           +G  D +     + ++VD+K G   P    A ++  L +YA  A         R E   +
Sbjct: 136 SGRVDRIDHRDGELVVVDYKTGRRPPTEQDARSSLALAIYAISASRMLRLPCSRVELHHV 195

Query: 171 TIIQPRVRTGSPINEWVISADDLLE---------KAKEFKERGTLALSLKSKRAVSLE-- 219
                       +  W  + D L           +     +    A + ++ R  + E  
Sbjct: 196 --------PTGAVAAWEHTEDSLARHLRRAEEIAEEAAAADEAYRAWAGRAPRRRAGERP 247

Query: 220 -----------------HYGVNDDSCRFCRAKVRC 237
                                    C +C  +  C
Sbjct: 248 ARDGGTAAGVPPEIDRLFPPNPGPLCSWCDFRRHC 282


>gi|315092776|gb|EFT64752.1| UvrD/REP helicase [Propionibacterium acnes HL060PA1]
          Length = 1058

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/266 (17%), Positives = 89/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 778  MAGEIELSASHVGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAENMDQWSLPEA 837

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 838  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 896

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENN--TQLMLYAC-----GALHQYG 159
                  G+ D L  +    + +VD K G     + + +   Q+ +Y       G      
Sbjct: 897  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEVIGP 956

Query: 160  DIFGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I   + +    I+       V   D+  E           ++    + 
Sbjct: 957  ASVSGAELVHLRIGAGKGQANPKIDYQSGLVDVPWPDE-AEPVNGCCNWIEASVDKALRI 1015

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C A+  CPAL
Sbjct: 1016 VTSGEYPAIANRGCGHCPARAGCPAL 1041


>gi|295836626|ref|ZP_06823559.1| ATP-dependent DNA helicase [Streptomyces sp. SPB74]
 gi|295826114|gb|EDY46535.2| ATP-dependent DNA helicase [Streptomyces sp. SPB74]
          Length = 1174

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/260 (16%), Positives = 78/260 (30%), Gaps = 34/260 (13%)

Query: 7    LSASSSHRWLK-CPIAPTLESKI--PQTTSIYASEGTFAHNLLAHCLEQGVDAETVS--- 60
            LSAS+  + +  C +   L  ++      S     G   H +LA  +  G     +    
Sbjct: 919  LSASALGQLVDVCALQWFLGREVRAEAPASTAQGFGNVVH-VLADEVATGRSPADLDVLM 977

Query: 61   --------HQKLTFENDTRIVDTEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFTT--- 108
                             +        +++   L + V   +G     +E P +       
Sbjct: 978  ERLDTVWDGLAFDAPWKSAQERENARAALERFLRWHVLDRAGRTPVASEHPFDVTLPAGE 1037

Query: 109  -EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALHQY--GDIF 162
             E    GT D +  ++  +  +VDFK G   P  AE  ++ QL +Y              
Sbjct: 1038 HEIRIRGTMDRVDADAAGRAYVVDFKTGKNAPTAAEVAHHPQLAVYQRAVAEGAVGPLTP 1097

Query: 163  GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            G  E + L +        SP  +     +          +     L+  + R +      
Sbjct: 1098 GGAELVHLRLEASSKDPLSPKVQPQEPPE---------GDWLPGLLTEAAARVLDERFRP 1148

Query: 223  VNDDSCRFCRAKVRCPALSR 242
                 C  C  +  C A + 
Sbjct: 1149 TPGSHCDHCAFRASCSAKAE 1168


>gi|311898255|dbj|BAJ30663.1| putative UvrD/REP helicase family protein [Kitasatospora setae
            KM-6054]
          Length = 1090

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/262 (15%), Positives = 72/262 (27%), Gaps = 35/262 (13%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIP--QTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
             LS S   +   C +   LE  +    T S     G   H L     ++     T +   
Sbjct: 829  RLSGSGLEQLETCTLQWFLEKDVKAGTTASAAQGFGNVVHALA----DEVGSGRTPADLA 884

Query: 64   LTFENDTRIVDT--------------EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE 109
            +  E    + D               E  +++   L +           TE   +     
Sbjct: 885  VLMERLDTVWDALAFDAPWKSTQEKGEARAALERFLRWHVLERERATVATEHGFDLTLDV 944

Query: 110  ----PGATGTADILIFN-STQWIIVDFKYGAGVPVKA--ENNTQLMLYACG----ALHQY 158
                    G+ D +  + + +  +VDFK G  VP       + QL +Y       AL   
Sbjct: 945  GGVAVRIRGSMDRVEADAAGRAYVVDFKTGKHVPTDKSLPEHRQLAVYQLAVGNGALDGL 1004

Query: 159  GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
                         ++Q R           +      +  +E        L   + + ++ 
Sbjct: 1005 PGFEHGAVPGGAELVQLRTPDKKDPEAPKVQ----RQLPEESTPWIEDLLVQTAGKVLAE 1060

Query: 219  EHYGVNDDSCRFCRAKVRCPAL 240
                   + C  C  +  C A 
Sbjct: 1061 RFTPTAGEGCGRCAFRGSCSAQ 1082


>gi|331697125|ref|YP_004333364.1| RecB family exonuclease [Pseudonocardia dioxanivorans CB1190]
 gi|326951814|gb|AEA25511.1| RecB family exonuclease [Pseudonocardia dioxanivorans CB1190]
          Length = 371

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/324 (14%), Positives = 71/324 (21%), Gaps = 104/324 (32%)

Query: 7   LSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHN---------LLAH------- 48
           LS S +  +  CP+        ++P+        GT  H                     
Sbjct: 36  LSPSRAVDFRTCPLLYRYRAIDRLPELPGRPQVRGTLVHAVLERLFALPAAERTREAATA 95

Query: 49  -------------------------------------CLEQGVDAETVSHQKLTFENDTR 71
                                                   +   +E V+ Q         
Sbjct: 96  MVGPAWVDLVISSPGLADALFATPDPASVDPAAGGEPLAREPDGSEQVAEQGQDRPVPAD 155

Query: 72  IVDTEMASSVSMVLAYVRTFSGPFLSE---TEVPLEPFTTEPGATGT------------- 115
                  +SV  ++        P   E    E+ +E         G              
Sbjct: 156 AGFARWLASVHDLVEAYFVLEDPAAVEAESVELLVETELGPALLPGRETGPETGPGTGPD 215

Query: 116 ------------------ADILIFNSTQ-WIIVDFKYGAGVPV--KAENNTQLMLYACGA 154
                              D +         +VD+K G       +A    QL  YA   
Sbjct: 216 AGSGAERGPGGGLLLRGFVDRIDVLPGGGLRVVDYKTGRIPQESGEAAAMFQLKFYALAL 275

Query: 155 LHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKR 214
           L   G +      L L   Q           +   AD+L   A+          +     
Sbjct: 276 LQLRGTVPDELRLLYLPAGQW--------LSYSPDADELRRFARVL----DALWTAIRTA 323

Query: 215 AVSLEHYGVNDDSCRFCRAKVRCP 238
               +        CRFCR + RCP
Sbjct: 324 GREGDFPPRRSGMCRFCRHRERCP 347


>gi|320531922|ref|ZP_08032830.1| hypothetical protein HMPREF9057_00697 [Actinomyces sp. oral taxon
           171 str. F0337]
 gi|320135864|gb|EFW27904.1| hypothetical protein HMPREF9057_00697 [Actinomyces sp. oral taxon
           171 str. F0337]
          Length = 447

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/309 (12%), Positives = 61/309 (19%), Gaps = 72/309 (23%)

Query: 6   FLSASSSHRWLKCPIAPTLESKIPQ-TTSIYASEGTFAHNLLAHC---------LEQGVD 55
            +S S       CP+   L         S   + G+  H +             L +  +
Sbjct: 133 RVSPSDVEGLAACPLKWFLTRNGGSAPASDAQALGSLVHEIAERAESEHLRGPALREAFE 192

Query: 56  AETVSHQKLTFENDTRIVDTE--MASSVSMVLAYVRTFSGPFLSETEVPLEPFTT----- 108
                             D    M   +   L+           E  V  +         
Sbjct: 193 ERLTDLGYPATWQGGLAADRARAMIERLDAYLSDCDALGIRADVERPVRSDVDIPLRVLS 252

Query: 109 -------------------EPGATGTADILIF----------------NSTQWIIVDFKY 133
                                  +G  D L                   +    I+D K 
Sbjct: 253 PEVRERAGLRMPMEGPDAVPVRISGRIDRLERLGGSPGDDPDDTAGIGRNGTVRIIDLKT 312

Query: 134 GAGVPVKAENNTQLMLYACG-----------ALHQYGDIFGRPEALTLTIIQPRVRTGSP 182
           G  VP   + + QL  Y              AL   G    +       +  P       
Sbjct: 313 GQRVPQDVQRHPQLATYRLALSAQGLDVVGGALVLLGKEPSKRSGDGYVLAPPGAALDPS 372

Query: 183 INEWVISADDLLEKAKEFKE---------RGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
                 + +                         ++  +   V         + CR CR 
Sbjct: 373 PAATEATDEPTERVEDSEANDGARSSEEYWAEDLVASAAVAGVGPVIEARTGEHCRTCRV 432

Query: 234 KVRCPALSR 242
           K  CP    
Sbjct: 433 KDSCPVQVE 441


>gi|296270933|ref|YP_003653565.1| UvrD/REP helicase [Thermobispora bispora DSM 43833]
 gi|296093720|gb|ADG89672.1| UvrD/REP helicase [Thermobispora bispora DSM 43833]
          Length = 1074

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/253 (18%), Positives = 83/253 (32%), Gaps = 24/253 (9%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQT-TSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
             +S S+  R+ +C +   LE+ +           G   H + A   E G + + V     
Sbjct: 825  RVSPSAVERFTECALRWLLETAVGTGNGGPNQHVGVVVHAIAALAAEGGDETDLVRRLDD 884

Query: 65   TFENDT-------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT-EPGATGTA 116
             ++          R         +     + R      L   E P           TG  
Sbjct: 885  VWDRFDFGGAWFNRKQREAAVGMIERFARWQRERVRE-LVAVEEPFTARVGPGVLITGRV 943

Query: 117  DILIFN-STQWIIVDFKYGAGVP--VKAENNTQLMLYACG----ALHQYGDIFGRPEALT 169
            D L  +   + +IVD K G+G P   + + + QL +Y       A  ++G       A  
Sbjct: 944  DRLERDRQGRPVIVDIKTGSGKPKNDEIDRHPQLGVYQLAALLGAFERHGLARSPGGASL 1003

Query: 170  LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
            L + +   R      +  ++ D     A+         ++  ++           +D CR
Sbjct: 1004 LHVGKAAERGAVEQTQRALADDPDPGWAERL-------VTTVARGMAGSVFTATANDGCR 1056

Query: 230  FCRAKVRCPALSR 242
             C AK+ CP   +
Sbjct: 1057 TCAAKIVCPINDQ 1069


>gi|291437397|ref|ZP_06576787.1| ATP-dependent DNA helicase [Streptomyces ghanaensis ATCC 14672]
 gi|291340292|gb|EFE67248.1| ATP-dependent DNA helicase [Streptomyces ghanaensis ATCC 14672]
          Length = 1126

 Score =  101 bits (251), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/259 (14%), Positives = 75/259 (28%), Gaps = 22/259 (8%)

Query: 6    FLSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHC--------LEQGV 54
             LS S+  +    C +   L  ++      +     G   H L            L+  +
Sbjct: 862  VLSGSALEQLAHTCALQWFLGREVKADAPATAAQGFGNVVHALADEVASGHTPADLDVLM 921

Query: 55   DAETVSHQKLTFENDT--RIVDTEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFT---- 107
            +        L F+              ++   L + V   +G      E   +       
Sbjct: 922  ERLDSVWNALAFDAPWKSAQEKENARVALERFLKWHVMDRAGRTPVAGEHDFDVTLEAGD 981

Query: 108  TEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALH-QYGDIFG 163
             +    G  D +  +   +  +VDFK G   P  AE   + QL +Y          ++FG
Sbjct: 982  YQVRIRGQMDRVETDGDGRAYVVDFKTGKQAPSSAEVARHPQLAVYQLAVREGAVDEVFG 1041

Query: 164  RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
                        ++R G+ + +   +   +  +     E     L+  + + +       
Sbjct: 1042 GTRPEPGGAELVQLRQGAAVRDGGETLPKVQAQQPLEGEWVGDLLATAAGKVLDERFTPT 1101

Query: 224  NDDSCRFCRAKVRCPALSR 242
                C  C  +  C A   
Sbjct: 1102 TGQHCAHCAFRASCSARPE 1120


>gi|314923609|gb|EFS87440.1| UvrD/REP helicase [Propionibacterium acnes HL001PA1]
          Length = 1061

 Score =  101 bits (251), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 90/266 (33%), Gaps = 28/266 (10%)

Query: 1    MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLL-----AHCLEQG 53
            MA    LSAS     L CP    +  +   ++     AS G+  H +         L + 
Sbjct: 781  MAGEIELSASHVGELLTCPRRWFMTRRAGASSGSALRASIGSLVHRICAENMDQWSLPEA 840

Query: 54   VDAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP- 110
            +     +  ++    + +      +  ++V     +++      L  TEV ++   T P 
Sbjct: 841  LAELEAAWPEIELSAEWQRSAELADAKAAVQRFDGWLQ-LRNRQLIGTEVRVDGTITVPS 899

Query: 111  ---GATGTADILIFN-STQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDI----- 161
                  G+ D L  +    + +VD K G     + + + +L +    A+   G +     
Sbjct: 900  GTARVRGSIDRLERDAEGAYYVVDLKTGTSQSDEIKQSHRLQIGVYQAVVASGGVEIIGP 959

Query: 162  --FGRPEALTLTIIQPRVRTGSPIN-----EWVISADDLLEKAKEFKERGTLALSLKSKR 214
                  E + L I   + +    I+       V   D+  E           ++    + 
Sbjct: 960  ASVSGAELVHLRIGAGKGQANPKIDYQSGLVDVPWPDE-AEPVNGCCNWIEASVDKALRI 1018

Query: 215  AVSLEHYGVNDDSCRFCRAKVRCPAL 240
              S E+  + +  C  C  +  CPAL
Sbjct: 1019 VTSGEYPAIANRGCGHCPGRAGCPAL 1044


>gi|297619071|ref|YP_003707176.1| UvrD/REP helicase [Methanococcus voltae A3]
 gi|297378048|gb|ADI36203.1| UvrD/REP helicase [Methanococcus voltae A3]
          Length = 1085

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/249 (16%), Positives = 80/249 (32%), Gaps = 34/249 (13%)

Query: 7    LSASSSHRWLKCPIAPTLES--KIPQTTSIYASEGTFAHNLLAHCLEQGVDAET------ 58
             S S    +  CP+    ++   IP     Y S G   H +     ++ ++ E       
Sbjct: 847  FSPSKIVDYDSCPLMFKYKNVLSIPTPKKSYFSVGNTVHKIFEILGDKKINDERITIEMA 906

Query: 59   ---VSHQKLTFENDTR-IVDTEMASSVSMVLAYVRTFSG---PFLSETEVPLEPFTTEPG 111
               +       + D++   D +M + ++ +L Y   F       +   E           
Sbjct: 907  QNMLLENLKEQDFDSKTEYDEQMTNCLN-MLNYWFEFEKNNVDKIISVEEKFSINLCNHT 965

Query: 112  ATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              G  D +       +I++D+K G       K  NN QL++YA     +YG    +   +
Sbjct: 966  INGIIDRIDKTTDDNYIVLDYKTGKTALSKNKLLNNIQLIIYAIAVKEKYGKYPIQIGHI 1025

Query: 169  TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
               I +  +          I    + E  +  +      ++   +   +         +C
Sbjct: 1026 YPAIAKSVI--------LDIEESKIEEIKQNIESYIDKIMNEDFEVVKNP-------SNC 1070

Query: 229  RFCRAKVRC 237
             FC  K  C
Sbjct: 1071 HFCDYKNIC 1079


>gi|239929060|ref|ZP_04686013.1| ATP-dependent DNA helicase [Streptomyces ghanaensis ATCC 14672]
          Length = 1114

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/259 (14%), Positives = 75/259 (28%), Gaps = 22/259 (8%)

Query: 6    FLSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHC--------LEQGV 54
             LS S+  +    C +   L  ++      +     G   H L            L+  +
Sbjct: 850  VLSGSALEQLAHTCALQWFLGREVKADAPATAAQGFGNVVHALADEVASGHTPADLDVLM 909

Query: 55   DAETVSHQKLTFENDT--RIVDTEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFT---- 107
            +        L F+              ++   L + V   +G      E   +       
Sbjct: 910  ERLDSVWNALAFDAPWKSAQEKENARVALERFLKWHVMDRAGRTPVAGEHDFDVTLEAGD 969

Query: 108  TEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALH-QYGDIFG 163
             +    G  D +  +   +  +VDFK G   P  AE   + QL +Y          ++FG
Sbjct: 970  YQVRIRGQMDRVETDGDGRAYVVDFKTGKQAPSSAEVARHPQLAVYQLAVREGAVDEVFG 1029

Query: 164  RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
                        ++R G+ + +   +   +  +     E     L+  + + +       
Sbjct: 1030 GTRPEPGGAELVQLRQGAAVRDGGETLPKVQAQQPLEGEWVGDLLATAAGKVLDERFTPT 1089

Query: 224  NDDSCRFCRAKVRCPALSR 242
                C  C  +  C A   
Sbjct: 1090 TGQHCAHCAFRASCSARPE 1108


>gi|239944121|ref|ZP_04696058.1| putative ATP-dependent DNA helicase [Streptomyces roseosporus NRRL
           15998]
          Length = 423

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/262 (14%), Positives = 78/262 (29%), Gaps = 30/262 (11%)

Query: 7   LSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
           LS S+  +    C +   L  ++      +     G   H L     ++     T +   
Sbjct: 160 LSPSALDQLANTCTLQWFLGREVKADAPATAAQGFGNVVHVLA----DEVASGRTPADLD 215

Query: 64  LTFEN--------------DTRIVDTEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFT- 107
           +  E                +     +  +++   L + V    G   + +E   +    
Sbjct: 216 VLMERLDSVWNGLAFDAPWKSEQEKDQARAALERFLHWHVLDRGGRTPTASEHDFDVTLE 275

Query: 108 ---TEPGATGTADILIFN-STQWIIVDFKYGAGVP--VKAENNTQLMLYACGALH-QYGD 160
                    G+ D +  +   +  +VDFK G G P   +   + QL +Y          +
Sbjct: 276 AGEYAVRIRGSMDRVEEDAEGRAYVVDFKTGKGAPTKDEVAAHPQLAVYQLAVREGAVDE 335

Query: 161 IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
           +F             ++R  +P  E   +   +  +     E  +  L+  +K+ +    
Sbjct: 336 VFDGRRPEPGGAELVQLRQPAPKKEGGDAFPKVQAQEPLAGEWVSDLLATAAKKVLDERF 395

Query: 221 YGVNDDSCRFCRAKVRCPALSR 242
                  C  C  +  C A   
Sbjct: 396 TPTTGTHCSHCAFRASCSAQPE 417


>gi|302542687|ref|ZP_07295029.1| putative ATP-dependent DNA helicase [Streptomyces hygroscopicus
           ATCC 53653]
 gi|302460305|gb|EFL23398.1| putative ATP-dependent DNA helicase [Streptomyces himastatinicus
           ATCC 53653]
          Length = 499

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/265 (15%), Positives = 79/265 (29%), Gaps = 33/265 (12%)

Query: 7   LSASSSHRWLK-CPIAPTLESKIP-QTTSIYAS-EGTFAHNLLAHCLEQGVDAETVSHQK 63
           LS S+  + +  C +   L  ++     S  A   G   H L     ++     T +   
Sbjct: 233 LSGSALDQLVNTCSLQWFLGREVKADAPSTAAQGFGNVVHVLA----DEVASGRTPADLA 288

Query: 64  LTFENDTRIVD--------------TEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFTT 108
           +  E    + D                  +++   L + V    G     +E   +    
Sbjct: 289 VLMERLDSVWDALAFDAPWKSRQEKEHARAALERFLRWHVMERGGRTAVASEHGFDVTLD 348

Query: 109 ----EPGATGTADILIFN-STQWIIVDFKYGAGVPVK--AENNTQLMLYACGALH-QYGD 160
               +    G+ D +  +   +  +VDFK G     +    ++ QL +Y           
Sbjct: 349 AETYQVRIRGSMDRVEADAEGRAYVVDFKTGKQSVTRGEVAHHPQLAVYQLAVREGAVDG 408

Query: 161 IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFK---ERGTLALSLKSKRAVS 217
           +FG            ++R G+P  E   +   +  +        E     L+  + R + 
Sbjct: 409 LFGDDRPEPGGAELVQLRQGAPKKEGGETVPKVQAQEPPVGPDGEWVGELLATAAGRVLD 468

Query: 218 LEHYGVNDDSCRFCRAKVRCPALSR 242
                     C  C  +  C A + 
Sbjct: 469 ERFAPSTGAHCERCAFRASCSARAE 493


>gi|302553995|ref|ZP_07306337.1| ATP-dependent DNA helicase [Streptomyces viridochromogenes DSM
           40736]
 gi|302471613|gb|EFL34706.1| ATP-dependent DNA helicase [Streptomyces viridochromogenes DSM
           40736]
          Length = 447

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/260 (15%), Positives = 75/260 (28%), Gaps = 24/260 (9%)

Query: 6   FLSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCLEQG--------V 54
            LS S+  +    C +   L  ++      +     G   H +LA  +  G        +
Sbjct: 183 VLSGSALDQLANTCALQWFLGREVKADAPATAAQGFGNVVH-VLADEVASGHTPADLSVL 241

Query: 55  DAETVSHQKLTFENDTRIVDTEMASS---VSMVLAY-VRTFSGPFLSETEVPLEPFTT-- 108
                S       +     D E  ++   +   L + V   +G     +E   +      
Sbjct: 242 MERLDSVWNALAFDAPWKSDQEKDNARVALERFLQWHVMDRTGRTPVASEHDFDVTLDAG 301

Query: 109 --EPGATGTADILIFN-STQWIIVDFKYGAGVPV--KAENNTQLMLYACGALH-QYGDIF 162
             +    G  D +  +   +  +VDFK G   P   + E + QL +Y          D F
Sbjct: 302 DYQVRIRGQMDRVEADGDGRAYVVDFKTGKQAPTGKEVERHPQLAVYQLAVREGAVDDAF 361

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
                         +R G+   +   +   +  +     E     L+  + + +      
Sbjct: 362 DGVRPEPGGAELVHLRQGAAKRDGGETLPKVQAQEPLAGEWVGDLLATAAGKVLDERFTP 421

Query: 223 VNDDSCRFCRAKVRCPALSR 242
                C  C  +  C A   
Sbjct: 422 TAGQHCTHCAFRASCSARQE 441


>gi|297626181|ref|YP_003687944.1| ATP-dependent DNA helicase [Propionibacterium freudenreichii subsp.
            shermanii CIRM-BIA1]
 gi|296921946|emb|CBL56506.1| ATP-dependent DNA helicase [Propionibacterium freudenreichii subsp.
            shermanii CIRM-BIA1]
          Length = 1123

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 46/279 (16%), Positives = 76/279 (27%), Gaps = 40/279 (14%)

Query: 6    FLSASSSHRWLKCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
             LS +   + + CP    L+  ++   T    A  G+  H L  H +   +  + +    
Sbjct: 842  RLSVTGLQKLIACPRQWFLDVAARGATTGGFAAGVGSVIHLLAEHAVTDHLSEDQLHDAL 901

Query: 64   LTFENDTRIVDTEMA---------SSVSMVLAYVRTFSGPFL-SETEVPLEPFTTE--PG 111
                ND  +                 ++    +        L  E  V            
Sbjct: 902  DEAWNDLDVHQQGWRTLIERSRAHEMITRFERWQGGQPTEVLGVEVPVRHTFVIGGQPLE 961

Query: 112  ATGTADILIFN--STQWIIVDFKYGAGVP--VKAENNTQLMLYAC-----GALHQYGDIF 162
              G+ D L  +  S +  I+DFK G+  P   +A +N QL  Y             G   
Sbjct: 962  LVGSIDRLERDRTSGRIRIIDFKTGSRAPSRTEAASNLQLAAYQLAVMRGACRELTGSTP 1021

Query: 163  --GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKE---------------FKERGT 205
                   + L +                  DD    A E                     
Sbjct: 1022 AMDGALLVFLRLPAGARDPLLLKVVGQPGLDDHPYPAAEQLANTWLVRGDVDIQGPTMVD 1081

Query: 206  LALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHV 244
             AL+      V  ++  V    C +C  +  CP  +R  
Sbjct: 1082 DALAFAVHCVVEEDYPAVEGPPCSYCDHRADCPIWAREA 1120


>gi|269796046|ref|YP_003315501.1| DNA/RNA helicase [Sanguibacter keddieii DSM 10542]
 gi|269098231|gb|ACZ22667.1| DNA/RNA helicase, superfamily I [Sanguibacter keddieii DSM 10542]
          Length = 1124

 Score =  100 bits (248), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/248 (16%), Positives = 71/248 (28%), Gaps = 19/248 (7%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQG---VDAETVSH 61
             +S S   +  +C +   LES      S    S G   H++       G   + AE    
Sbjct: 867  PVSPSKVEQVHRCALRWALESAGGTAGSALSQSVGNLVHDIARELPAAGHAELAAELDRR 926

Query: 62   QKLTFENDTRIVDT---EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADI 118
                   D            + V  +  Y    SG      E   E         G+ D 
Sbjct: 927  WHELGMPDGWPATQTRRRADAMVRRLADYYTEISGE--VLVEESFEVQVGRAVLRGSVDR 984

Query: 119  LIFN-STQWIIVDFKYGAGVPVKAEN--NTQLMLYACGALH-QYGDIFGRPEALTLTIIQ 174
            L  +      + D K G G+P  AE   N QL  Y        + ++     ++   ++ 
Sbjct: 985  LERSGEDGVRVTDLKTGRGIPSVAEAATNAQLGAYQLAVESGAFPELGPGVRSVGAQLVF 1044

Query: 175  PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
                             + LE  ++        ++  ++         V +  C  C  +
Sbjct: 1045 VGDGARGATRR----TQEALETGED--SWARTLVTEAAETMAGGRFRAVENSMCATCGVR 1098

Query: 235  VRCPALSR 242
              CP  + 
Sbjct: 1099 RACPVQNE 1106


>gi|29829619|ref|NP_824253.1| ATP-dependent DNA helicase [Streptomyces avermitilis MA-4680]
 gi|29606727|dbj|BAC70788.1| putative ATP-dependent DNA helicase [Streptomyces avermitilis
            MA-4680]
          Length = 1129

 Score =  100 bits (248), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 38/259 (14%), Positives = 75/259 (28%), Gaps = 22/259 (8%)

Query: 6    FLSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHC--------LEQGV 54
             LS S+  +    C +   L  ++      +     G   H L            L+  +
Sbjct: 865  VLSGSALDQLANTCSLQWFLGREVKADAPATAAQGFGNVVHVLADEVASGHTPADLDVLM 924

Query: 55   DAETVSHQKLTFENDT--RIVDTEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFT---- 107
            +        L F+              ++   L + V   +G     +E   +       
Sbjct: 925  ERLDSVWNALAFDAPWKSAQEKENARVALERFLQWHVMDRAGRTPVASEHDFDVTLEAGS 984

Query: 108  TEPGATGTADILIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALH-QYGDIFG 163
             E    G+ D +  +   +  +VDFK G   P  AE   + QL +Y          + F 
Sbjct: 985  YEVRIRGSMDRVEADGEGRAYVVDFKTGKQAPTAAEVGRHPQLAVYQLAVSEGAVDEAFD 1044

Query: 164  RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
                        ++R G+   +   +   +  +     E     L+  + + +       
Sbjct: 1045 GVRPEPGGAELVQLRQGAAKRDGGEALPKVQAQEPLEGEWVGDLLATAAGKVLDERFSPT 1104

Query: 224  NDDSCRFCRAKVRCPALSR 242
                C  C  +  C A + 
Sbjct: 1105 TGQHCTHCAFRASCSARAE 1123


>gi|258593628|emb|CBE69969.1| protein of unknown function [NC10 bacterium 'Dutch sediment']
          Length = 991

 Score =  100 bits (248), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 47/256 (18%), Positives = 80/256 (31%), Gaps = 37/256 (14%)

Query: 6   FLSAS--SSHRWLKCPIAPT----LESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETV 59
            LS S      +L CP+       L   + +  +I    G   H  +     Q +  +T+
Sbjct: 742 PLSLSHYQIDDYLTCPLKYKYVHILRVPVLREHTI--IYGAALHRAVQAYNTQRLTGQTM 799

Query: 60  SHQKLTFENDTRIVDT----------EMASSVSMVLAYVRTFS-GPFLSETEVPLEPFTT 108
           S   L    +   V+            M      +  +    + GP  +  E        
Sbjct: 800 SLDDLIKSFEAHWVNEGFISREHEERRMQEGRDALTRFHAGAAKGPLPTSVEKRFRFQLG 859

Query: 109 EPGATGTADILIFNSTQWIIVDFKY-----GAGVPVKAENNTQLMLYACGALHQYGDIFG 163
           +   TG  D +     + +I+D+K            +A  + QL LYA       G +  
Sbjct: 860 DDLVTGIMDRVDEREGETVIIDYKSSSVRDQKAADKEARESQQLALYALAYRESIGRLPD 919

Query: 164 RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
           R E   LT        G  + + V    DL +  +  +   T   +   +          
Sbjct: 920 RVELHFLT------PGGVIVGQAVKKEKDLDQAVERVRAAATGIRAGLFQA-------TP 966

Query: 224 NDDSCRFCRAKVRCPA 239
           +   C FC  +  CPA
Sbjct: 967 SQWVCSFCAFRTICPA 982


>gi|297571781|ref|YP_003697555.1| UvrD/REP helicase [Arcanobacterium haemolyticum DSM 20595]
 gi|296932128|gb|ADH92936.1| UvrD/REP helicase [Arcanobacterium haemolyticum DSM 20595]
          Length = 1044

 Score = 99.7 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 82/251 (32%), Gaps = 13/251 (5%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLLAHCLEQGVDA-ETVSHQ 62
             +S S+    L CP+   L+S   Q+      A  GT  H +     E  +D       +
Sbjct: 794  RISPSAVENMLTCPLRGVLDSANGQSLGNASLAHVGTLVHQIAEETEEPDLDMMRARLDE 853

Query: 63   KLTFENDTRIVDTE--MASSVSMVLAYVRTFSGPFLSET-EVPLEPFTTEPGATGTADIL 119
                 +    +  +     +V MV    +  +    +E  E+           +G  D L
Sbjct: 854  LWAVFDFGTDLADQQLYERAVGMVTKLHQYLTENPATEQRELYARVERDGLVVSGKIDRL 913

Query: 120  ---IFNSTQWIIVDFKYGAGVPVKAENN--TQLMLYACGALHQYGDIFGRPEALTLTIIQ 174
                 + +   +VDFK G   P K + +   QL++Y          +    +  T ++  
Sbjct: 914  EFSDMDPSAVRVVDFKTGKSSPRKEDADRVPQLLIYQWLVEQGGVIMPEGGQTPTRSLGA 973

Query: 175  PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
              V  G     + ++    L+  +   +     ++  +    S       +  CR C   
Sbjct: 974  RLVHIGKETQGYGLTEQSELDAERT--KEAEQMINRSADIQRSHAIEAQINSGCRSCTYI 1031

Query: 235  VRCPALSRHVL 245
              CPA     +
Sbjct: 1032 TICPAKEGKRI 1042


>gi|302558545|ref|ZP_07310887.1| ATP-dependent DNA helicase [Streptomyces griseoflavus Tu4000]
 gi|302476163|gb|EFL39256.1| ATP-dependent DNA helicase [Streptomyces griseoflavus Tu4000]
          Length = 496

 Score = 99.7 bits (247), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 39/259 (15%), Positives = 75/259 (28%), Gaps = 22/259 (8%)

Query: 6   FLSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHC--------LEQGV 54
            LS S+  +    C +   L  ++      +     G   H L            L+  +
Sbjct: 232 VLSGSALDQLANTCALQWFLGREVKADAPATAAQGFGNVVHVLADEVASGHTPADLDVLM 291

Query: 55  DAETVSHQKLTFENDT--RIVDTEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFTT--- 108
           +        L F+              ++   L + V   +G     +E   +       
Sbjct: 292 ERLDSVWNALAFDAPWKSAQEKENARVALERFLKWHVMDRTGRTPVASEHDFDVTLGAGD 351

Query: 109 -EPGATGTADILIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALH-QYGDIFG 163
            E    G  D +  +   +  +VDFK G   P  AE  ++ QL +Y          + FG
Sbjct: 352 YEVRIRGQMDRVETDGDGRAYVVDFKTGKQAPSSAEVEHHPQLAVYQLAVREGAVDEAFG 411

Query: 164 RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
                       ++R G+   +   +   +  +     E     L+  + + +       
Sbjct: 412 GTRPEPGGAELVQLRQGAAKRDGGETLPKVQAQKPPEGEWVGDLLATAAGKVLDERFTPT 471

Query: 224 NDDSCRFCRAKVRCPALSR 242
               C  C  +  C A   
Sbjct: 472 TGQHCAHCAFRASCSARPE 490


>gi|20091192|ref|NP_617267.1| hypothetical protein MA2359 [Methanosarcina acetivorans C2A]
 gi|19916303|gb|AAM05747.1| hypothetical protein (multi-domain) [Methanosarcina acetivorans
           C2A]
          Length = 487

 Score = 99.7 bits (247), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 35/245 (14%), Positives = 78/245 (31%), Gaps = 13/245 (5%)

Query: 7   LSASSSHRWLKCPIAPTLES--KIPQT----TSIYASEGTFAHNLLAHCLEQGVDAETVS 60
            S S+   +  CP    L+   ++P      ++   ++G+F H +L   +++ V  +   
Sbjct: 239 FSFSALKVYETCPKQYELQEILRMPSRKNADSTGAMTKGSFVHKVLETAVKERVAEKRAL 298

Query: 61  HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFL---SETEVPLEPFTTEPGATGTAD 117
           ++     +           S   +       +   +      E             G  D
Sbjct: 299 YEIAETLHKKPEWMYADLESTLPLFEVFWLRNKDRISNNLMVEKWFSVIIDGFVFKGIID 358

Query: 118 ILIFNS---TQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFG-RPEALTLTII 173
            +        +  I+D+K G       + + QL+LYA G  H Y      +     L + 
Sbjct: 359 RIDLLDPSKKEVEIIDYKTGKYDVNPEDRSRQLLLYAKGFEHMYPGYTAKKLTFDMLAME 418

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
           +PR        E+  +   +    +E  +   +     +           + + C+ C  
Sbjct: 419 KPRSFELQENGEYRGTEGRVSPLDREAIDSMLVTARRIAYDYEHEFEKTADLEVCKECEF 478

Query: 234 KVRCP 238
           ++ C 
Sbjct: 479 RLYCD 483


>gi|300783032|ref|YP_003763323.1| hypothetical protein AMED_1105 [Amycolatopsis mediterranei U32]
 gi|299792546|gb|ADJ42921.1| conserved hypothetical protein [Amycolatopsis mediterranei U32]
          Length = 290

 Score = 99.7 bits (247), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 42/271 (15%), Positives = 65/271 (23%), Gaps = 31/271 (11%)

Query: 6   FLSASSSHRWLKCPIAPTL---ESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVS 60
            +S +    +  CP    L   E   PQ T  +A  + G   HN L    +         
Sbjct: 22  KVSPARLATFDDCPRRYRLAYLERPTPQRTGPWAHSTLGAVVHNALRALFDLPALKRVPQ 81

Query: 61  HQKLTFENDT-----------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE 109
                                          V+  +        P   E  V     +T 
Sbjct: 82  RAVALVAEFWKDAGFETEEQAARYRARAKGWVAEYVEDNDVSHDPVGLERWVSAPVSSTP 141

Query: 110 PG-----ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGR 164
                    G  D +       +IVD+K G   P + E        A  AL  Y     R
Sbjct: 142 GERPSMIIEGRTDRIDARDGSLVIVDYKTGRRPPDEYEAR------ASQALALYAVAAAR 195

Query: 165 PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE----H 220
              +  T ++        I     + + L    +  +E                +     
Sbjct: 196 TLRMPCTTVELHHLPTGTIAAAEHTPESLQRHLQRAEETAGDLRLATDTLDAGGDGDVLF 255

Query: 221 YGVNDDSCRFCRAKVRCPALSRHVLLEATKD 251
               D  C +C  +  C A           D
Sbjct: 256 PPRPDRRCAWCDFRPSCAAGQEAAPQAQPWD 286


>gi|289555475|ref|ZP_06444685.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis KZN 605]
 gi|289440107|gb|EFD22600.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis KZN 605]
          Length = 656

 Score = 99.3 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 75/254 (29%), Gaps = 30/254 (11%)

Query: 7   LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           L+ S+      CP+    E      T    ++ G+  H L     E G     +  +   
Sbjct: 407 LTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHAL---FAEPGRSESQLLAELDR 463

Query: 66  FEND-----TRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE----------- 109
                          E+A   +M+ A+V+  +      TEV +E                
Sbjct: 464 VWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTEVGVEVDIDGALEDGSGQARK 523

Query: 110 PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
               G AD L  +   + +IVD K G        A+ + QL +Y        G +    E
Sbjct: 524 IRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAE--GLVRAGDE 581

Query: 167 ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                ++       + + E               ++     +   +      +     +D
Sbjct: 582 PGGARLVYVGKSGAAGVAERKQDP-----LTPAARDEWRNLVRQLAAATAGPQFIARRND 636

Query: 227 SCRFCRAKVRCPAL 240
            C  C  +  CPA 
Sbjct: 637 GCTHCPLRPGCPAH 650


>gi|145596261|ref|YP_001160558.1| UvrD/REP helicase [Salinispora tropica CNB-440]
 gi|145305598|gb|ABP56180.1| UvrD/REP helicase [Salinispora tropica CNB-440]
          Length = 1144

 Score = 99.3 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 38/249 (15%), Positives = 65/249 (26%), Gaps = 22/249 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLES-KIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH--- 61
             ++ S     L+C +   LE        S     G   H           D   +     
Sbjct: 882  RVTPSGMESALRCSLRWLLERHGGGAPASAAQGVGNLVHAAAMLAENASSDRRALLDYVA 941

Query: 62   --------QKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT 113
                             +     M   +   LA           E  V L+         
Sbjct: 942  ARFDAIELAARWMVGPEQARAEAMVDKLLRWLATNPRRLLAIEHEFAVRLDDSRHPVDLV 1001

Query: 114  GTADILIFN-STQWIIVDFKYGAGVPVKAEN---NTQLMLYACGALHQYGDIFGRPEALT 169
            G  D L  +   + ++VD K G    V A +   + QL  Y   A+          E+  
Sbjct: 1002 GRVDRLEVDSDGRLVVVDLKTGKSTAVTAADLTEHPQLGAYQ-AAVEAGAFAEFGTESGG 1060

Query: 170  LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
             +++Q          +    A +            T  +   ++   +     V +  CR
Sbjct: 1061 ASLVQLGTGAKEAREQAQPPAGEGPAAG-----WATALVRRTAETMAATTFAAVANSKCR 1115

Query: 230  FCRAKVRCP 238
             C  +  CP
Sbjct: 1116 VCPVRTSCP 1124


>gi|329939646|ref|ZP_08288947.1| ATP-dependent DNA helicase [Streptomyces griseoaurantiacus M045]
 gi|329301216|gb|EGG45111.1| ATP-dependent DNA helicase [Streptomyces griseoaurantiacus M045]
          Length = 1158

 Score = 99.3 bits (246), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 36/261 (13%), Positives = 72/261 (27%), Gaps = 25/261 (9%)

Query: 7    LSASSSHRW-LKCPIAPTLESKIP--QTTSIYASEGTFAHNLLAHC--------LEQGVD 55
            LS S+  +    C +   L  ++      +     G   H L            LE  ++
Sbjct: 892  LSGSALDQLARTCALQWFLGREVKADVPATAAQGFGNVVHVLADEVASGRTPADLEVLME 951

Query: 56   AETVSHQKLTFENDTRIVDT------EMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT- 108
                    L F+   +           +   +   +      +G     +E   +     
Sbjct: 952  RLDSVWNALAFDAPWKSAQEKAHARAALERFLKWHVDSGGQRAGRTPVASEQDFDVTLGA 1011

Query: 109  ---EPGATGTADILIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALH-QYGDI 161
               E    G+ D +  +   +  +VDFK G   P  AE   + QL +Y          ++
Sbjct: 1012 GDYEVRIRGSMDRVETDGEGRAYVVDFKTGKQAPSAAEVARHPQLAVYQLAVREGAVDEV 1071

Query: 162  FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHY 221
            F              +R G+   +       +  +     +     L+  + + +     
Sbjct: 1072 FDGTRPEPGGAELVHLRQGAARRDGGEELPKVQAQEPLEGQWVGELLATAAGKVLDERFS 1131

Query: 222  GVNDDSCRFCRAKVRCPALSR 242
                  C  C  +  C A   
Sbjct: 1132 PTAGQHCAHCAFRAACSARPE 1152


>gi|291008803|ref|ZP_06566776.1| RecB family exonuclease [Saccharopolyspora erythraea NRRL 2338]
          Length = 279

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/252 (15%), Positives = 65/252 (25%), Gaps = 27/252 (10%)

Query: 6   FLSASSSHRWLKCPIAPT---LESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVS 60
            ++ +    W +CP       L+   P     +A  + G   HN+L    E      T  
Sbjct: 19  RVTPARLANWAQCPRKYRMTYLDRPTPPRAGAWAHSTLGAVVHNVLRAFFELRPGKRTPE 78

Query: 61  HQKLTFENDT--------RIVDTEMASSVSMVLAYVRTFSGPFL-SETEVPLEPFTTEPG 111
              +                V      +   + +YV            E  +        
Sbjct: 79  QVPVLLRRYWKSDGFADAEQVARHRRRAQEWLTSYVEGLDPDAAPVAVERWVSAPMGSII 138

Query: 112 ATGTADILIFNSTQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEALT 169
           A G  D L     + ++VD+K G        A ++  L LYA  A         R E   
Sbjct: 139 AEGRVDRLDERGGELVVVDYKTGRHALGVDDARDSLALALYALAARKSLHRPCRRVELHH 198

Query: 170 LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE---HYGVNDD 226
           L            +  W  +   L       +                 +      V   
Sbjct: 199 L--------PTGQVAGWEHTEGTLRAHLDRAESLAAGLQDATDAFVAGGDDAAFPAVTGR 250

Query: 227 SCRFCRAKVRCP 238
            C +C  +  CP
Sbjct: 251 HCSWCDFRAHCP 262


>gi|294338118|emb|CBJ93956.1| hypothetical phage protein [Campylobacter phage CP220]
          Length = 237

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 72/235 (30%), Gaps = 21/235 (8%)

Query: 8   SASSSHRWLKCP--IAPTLESKIPQTT-SIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           S S    + KCP         K+P+T  +    +G+  H +L     +  D    S    
Sbjct: 5   SFSKIDTYKKCPKQYYYRYIEKVPETQKNPALKKGSDIHEILEFHNTEKYDIIFNSKDPE 64

Query: 65  TFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT-GTADILIFNS 123
                 R +D+E+   +       R     F    +   EP + +     G  D +    
Sbjct: 65  IQNIALRFIDSELGKEILS-----RKSLREFELFLDSNYEPCSKDTAIFVGYIDRINTTE 119

Query: 124 TQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPI 183
               ++D+K G       ++ TQL+LY+     +      +   +    ++  +      
Sbjct: 120 NGLELIDYKTGKYKEPSYQDFTQLILYSLYMFKRLKLDEIKIRYVY---VEHLLEN---- 172

Query: 184 NEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               +S D  +        +     +       +       +  C +C     CP
Sbjct: 173 -TLSLSQDSAIYWQDNLNNQIKSIENSIESNTWNS----KPNKLCPWCPYAGLCP 222


>gi|315503767|ref|YP_004082654.1| uvrd/rep helicase [Micromonospora sp. L5]
 gi|315410386|gb|ADU08503.1| UvrD/REP helicase [Micromonospora sp. L5]
          Length = 1250

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/249 (14%), Positives = 62/249 (24%), Gaps = 22/249 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQ-TTSIYASEGTFAHNLL----------AHCLE-QG 53
             ++ S+    L+C +   LE        S     G   H                LE   
Sbjct: 991  RVTPSAMESALRCSLRWLLERHGGSGPASAAQGVGNLVHAAAMLAEDASVDREALLEYVA 1050

Query: 54   VDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT 113
               + +           R     M   +   LA           E  V L+  +     T
Sbjct: 1051 ARFDAIELAARWMAGPERQRAEAMVDKLLRWLAGNPRRLLAIEHEFAVRLDDPSRPVELT 1110

Query: 114  GTADILIFNS-TQWIIVDFKYGAGVPVKAE---NNTQLMLYACGALHQYGDIFGRPEALT 169
            G  D L  +   + +++D K G    V       + QL  Y           FG      
Sbjct: 1111 GRVDRLEVDDEGRLVVIDLKTGKSTAVTEREVAEHPQLGAYQAAVEAGGFAEFGEEPGGA 1170

Query: 170  LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
              +        +       + +             T  +   +    +     V +  CR
Sbjct: 1171 ALVQLGTGARDAKEQTQAAAGEGPEA------GWATALVRRTADTMAASTFAAVANSKCR 1224

Query: 230  FCRAKVRCP 238
             C  +  CP
Sbjct: 1225 VCPVRTSCP 1233


>gi|290957555|ref|YP_003488737.1| ATP-dependent DNA helicase [Streptomyces scabiei 87.22]
 gi|260647081|emb|CBG70180.1| putative ATP-dependent DNA helicase [Streptomyces scabiei 87.22]
          Length = 1121

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/259 (13%), Positives = 70/259 (27%), Gaps = 22/259 (8%)

Query: 6    FLSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCL------EQGVDA 56
             LS S+  +    C +   L  ++      +     G   H L           +  V  
Sbjct: 857  VLSGSALDQLANTCALQWFLGREVKADAPATAAQGFGNVVHVLADEVASGRTPADLDVLM 916

Query: 57   ETVSHQKLTFENDTRIVDTEMASSVSMVLAY-----VRTFSGPFLSETEVPLEPFT---- 107
            E +         D      +      + L       V   +G     +E   +       
Sbjct: 917  ERLDSVWNALAFDAPWKSEQEKQHARVALERFLKWHVMDRTGRTPVASEHDFDVTLEAGD 976

Query: 108  TEPGATGTADILIFN-STQWIIVDFKYGAGVPV--KAENNTQLMLYACGALH-QYGDIFG 163
             E    G+ D +  +   +  +VDFK G       +   + QL +Y          + FG
Sbjct: 977  YEVRIRGSMDRVETDTEGRAYVVDFKTGKQAVSSGEVTRHPQLAVYQLAVREGAVDEPFG 1036

Query: 164  RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
                        ++R G+       +   +  +     E     L+  + + +       
Sbjct: 1037 GVRPEAGGAELVQLRQGAARKNGGETVPKVQAQEPLQGEWVGDLLATAAGKVLDERFSPT 1096

Query: 224  NDDSCRFCRAKVRCPALSR 242
                C  C  +  C A + 
Sbjct: 1097 AGQHCAHCAFRASCSARAE 1115


>gi|302869751|ref|YP_003838388.1| UvrD/REP helicase [Micromonospora aurantiaca ATCC 27029]
 gi|302572610|gb|ADL48812.1| UvrD/REP helicase [Micromonospora aurantiaca ATCC 27029]
          Length = 1240

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/249 (14%), Positives = 62/249 (24%), Gaps = 22/249 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQ-TTSIYASEGTFAHNLL----------AHCLE-QG 53
             ++ S+    L+C +   LE        S     G   H                LE   
Sbjct: 981  RVTPSAMESALRCSLRWLLERHGGSGPASAAQGVGNLVHAAAMLAEDASVDREALLEYVA 1040

Query: 54   VDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT 113
               + +           R     M   +   LA           E  V L+  +     T
Sbjct: 1041 ARFDAIELAARWMAGPERQRAEAMVDKLLRWLAGNPRRLLAIEHEFAVRLDDPSRPIELT 1100

Query: 114  GTADILIFNS-TQWIIVDFKYGAGVPVKAE---NNTQLMLYACGALHQYGDIFGRPEALT 169
            G  D L  +   + +++D K G    V       + QL  Y           FG      
Sbjct: 1101 GRVDRLEVDDEGRLVVIDLKTGKSTAVTEREVAEHPQLGAYQAAVEAGGFAEFGEEPGGA 1160

Query: 170  LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
              +        +       + +             T  +   +    +     V +  CR
Sbjct: 1161 ALVQLGTGARDAKEQTQAAAGEGPEA------GWATALVRRTADTMAASTFAAVANSKCR 1214

Query: 230  FCRAKVRCP 238
             C  +  CP
Sbjct: 1215 VCPVRTSCP 1223


>gi|289763385|ref|ZP_06522763.1| hypothetical ATP-dependent DNA helicase [Mycobacterium tuberculosis
           GM 1503]
 gi|289710891|gb|EFD74907.1| hypothetical ATP-dependent DNA helicase [Mycobacterium tuberculosis
           GM 1503]
          Length = 540

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 75/254 (29%), Gaps = 30/254 (11%)

Query: 7   LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           L+ S+      CP+    E      T    ++ G+  H L     E G     +  +   
Sbjct: 291 LTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHAL---FAEPGRSESQLLAELDR 347

Query: 66  FEND-----TRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE----------- 109
                          E+A   +M+ A+V+  +      TEV +E                
Sbjct: 348 VWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTEVGVEVDIDGALEDGSGQARK 407

Query: 110 PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
               G AD L  +   + +IVD K G        A+ + QL +Y        G +    E
Sbjct: 408 IRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAE--GLVRAGDE 465

Query: 167 ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                ++       + + E               ++     +   +      +     +D
Sbjct: 466 PGGARLVYVGKSGAAGVAERKQDP-----LTPAARDEWRNLVRQLAAATAGPQFIARRND 520

Query: 227 SCRFCRAKVRCPAL 240
            C  C  +  CPA 
Sbjct: 521 GCTHCPLRPGCPAH 534


>gi|239982164|ref|ZP_04704688.1| ATP-dependent DNA helicase [Streptomyces albus J1074]
          Length = 1079

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/259 (15%), Positives = 75/259 (28%), Gaps = 22/259 (8%)

Query: 6    FLSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHC--------LEQGV 54
             LS S+  +    C +   L  ++      S     G   H L            L+  +
Sbjct: 815  VLSGSALDQLANTCALQWFLGREVKADAPASAAQGFGNVVHVLADEVASGRTPADLDVLM 874

Query: 55   DAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVR-TFSGPFLSETEVPLEPFTT--- 108
            +        L F+   + V        ++   L +     +G     +E   +       
Sbjct: 875  ERLDSVWDALAFDAPWKSVQEKENARQALERFLEWHTLDRAGRTPVASEHDFDITLGAGP 934

Query: 109  -EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALH-QYGDIFG 163
             E    G+ D +  +   +  +VDFK G   P  AE  ++ QL +Y           +F 
Sbjct: 935  YEVRIRGSMDRVEQDPRGRAYVVDFKTGKQAPTAAEVAHHPQLAVYQLAVTEGAVDPLFD 994

Query: 164  RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
                         +R  +P  E   +   +  +     E     L+  + + +       
Sbjct: 995  GVRPEPGGAELVHLRQPAPKKEGGDALPRVQHQPSPEGEWVGDLLATAAGKVLDERFTPT 1054

Query: 224  NDDSCRFCRAKVRCPALSR 242
                C  C  +  C A   
Sbjct: 1055 TGQHCAHCSFRSSCSAREE 1073


>gi|134097652|ref|YP_001103313.1| hypothetical protein SACE_1056 [Saccharopolyspora erythraea NRRL
           2338]
 gi|133910275|emb|CAM00388.1| hypothetical protein SACE_1056 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 276

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/252 (15%), Positives = 65/252 (25%), Gaps = 27/252 (10%)

Query: 6   FLSASSSHRWLKCPIAPT---LESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVS 60
            ++ +    W +CP       L+   P     +A  + G   HN+L    E      T  
Sbjct: 16  RVTPARLANWAQCPRKYRMTYLDRPTPPRAGAWAHSTLGAVVHNVLRAFFELRPGKRTPE 75

Query: 61  HQKLTFENDT--------RIVDTEMASSVSMVLAYVRTFSGPFL-SETEVPLEPFTTEPG 111
              +                V      +   + +YV            E  +        
Sbjct: 76  QVPVLLRRYWKSDGFADAEQVARHRRRAQEWLTSYVEGLDPDAAPVAVERWVSAPMGSII 135

Query: 112 ATGTADILIFNSTQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEALT 169
           A G  D L     + ++VD+K G        A ++  L LYA  A         R E   
Sbjct: 136 AEGRVDRLDERGGELVVVDYKTGRHALGVDDARDSLALALYALAARKSLHRPCRRVELHH 195

Query: 170 LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE---HYGVNDD 226
           L            +  W  +   L       +                 +      V   
Sbjct: 196 L--------PTGQVAGWEHTEGTLRAHLDRAESLAAGLQDATDAFVAGGDDAAFPAVTGR 247

Query: 227 SCRFCRAKVRCP 238
            C +C  +  CP
Sbjct: 248 HCSWCDFRAHCP 259


>gi|328907790|gb|EGG27553.1| UvrD/REP helicase [Propionibacterium sp. P08]
          Length = 1093

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 46/265 (17%), Positives = 86/265 (32%), Gaps = 38/265 (14%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
            LSAS     L CP    +  +   ++     AS G+  H + A    + +   ++     
Sbjct: 819  LSASHIGELLTCPRRWFMTRRAGASSGSAFQASIGSLVHRICA----ENMGHWSLPGALT 874

Query: 65   TFENDTRIVD-----------TEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP--- 110
              E     +D            +  ++V     ++++     L  TEV ++     P   
Sbjct: 875  ELEEAWPEIDVTAEWQRNAKLADAKAAVQRFDGWLQSRHRQ-LIGTEVRVDGTIEVPSGT 933

Query: 111  -GATGTADILIFN-STQWIIVDFKY--GAGVPVKAENNTQLMLYAC-----GALHQYGDI 161
                G+ D L  +      +VD K         K  +  Q+ +Y       G        
Sbjct: 934  ARVRGSIDRLERDAEGACYVVDLKTGASQSEETKRSHRLQIGVYQAVVASGGVKTIGPKP 993

Query: 162  FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEF------KERGTLALSLKSKRA 215
                E + L I   + +    ++     AD  +    E       +     ++    +  
Sbjct: 994  VSGAELVHLQIGAGKGKLSPKVDHQSGLAD--VPWPNEIDPVDGCRNWIEASVDKALRIV 1051

Query: 216  VSLEHYGVNDDSCRFCRAKVRCPAL 240
            +S ++  V +  C  C AK  CPAL
Sbjct: 1052 ISGDYPAVVNRGCGHCPAKAGCPAL 1076


>gi|9625499|ref|NP_039733.1| predicted 33.2Kd protein [Mycobacterium phage L5]
 gi|465349|sp|Q05283|VG69_BPML5 RecName: Full=Gene 69 protein; AltName: Full=Gp69
 gi|579143|emb|CAA79445.1| gene 69 [Mycobacterium phage L5]
          Length = 290

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/290 (13%), Positives = 70/290 (24%), Gaps = 73/290 (25%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYASE--GTFAHNLLAHCLEQGVDAETVSHQK-- 63
           S S  +++ +CP A  L           A    GT  H +     +   +   +S ++  
Sbjct: 12  SVSQLNQYTRCPQAYKLARIDKVWARPAAWLPQGTAFHTVAEVYEKALAEGREMSLERAQ 71

Query: 64  ----------------LTFENDTRIVDTEM-------------ASSVSMVLAYVR----- 89
                            T   +                        V   +A+ +     
Sbjct: 72  EIFREEYAKDIGALCDETPNFEWWFWSGPYNGERDIERRFHLGLEQVEKFIAWRKDKGQQ 131

Query: 90  --------------------TFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIV 129
                                         E+P           G  D ++  + +  + 
Sbjct: 132 IWTTPGRGICSTEAWKDTNCKECEQPKPAIELPFNIELDGIRVRGFIDAVVVVNGELRVR 191

Query: 130 DFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVIS 189
           D+K G        ++ QL +YA      Y     +     +            I     +
Sbjct: 192 DYKTGNSPG----DDFQLGVYALAVAMTYDVEAPKTGDYFMA-------GKKGIKAKPTA 240

Query: 190 ADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG-VNDDSCRFCRAKVRCP 238
             DL +  +   ER T        R  + +       D C FC     CP
Sbjct: 241 PYDLTDWTR---ERITERFHEVEARIQAGDFEPLPEPDKCGFCDVNYSCP 287


>gi|215447498|ref|ZP_03434250.1| putative ATP-dependent DNA helicase [Mycobacterium tuberculosis
           T85]
          Length = 745

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 71/254 (27%), Gaps = 30/254 (11%)

Query: 7   LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           L+ S+      CP+    E      T    ++ G+  H L     E G     +  +   
Sbjct: 496 LTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHAL---FAEPGRSESQLLAELDR 552

Query: 66  FENDTRIVDTEM--------ASSVSMVLAY-VRTFSGPFLSETEVPLEPFTTE------- 109
                                + +   + +  ++ S       EV ++    +       
Sbjct: 553 VWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTKVGVEVDIDGALEDGSGQARK 612

Query: 110 PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
               G AD L  +   + +IVD K G        A+ + QL +Y        G +    E
Sbjct: 613 IRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAE--GLVRAGDE 670

Query: 167 ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                ++       + + E               ++     +   +      +     +D
Sbjct: 671 PGGARLVYVGKSGAAGVAERKQDP-----LTPAARDEWRNLVRQLAAATAGPQFIARRND 725

Query: 227 SCRFCRAKVRCPAL 240
            C  C  +  CPA 
Sbjct: 726 GCTHCPLRPGCPAH 739


>gi|291454012|ref|ZP_06593402.1| ATP-dependent DNA helicase [Streptomyces albus J1074]
 gi|291356961|gb|EFE83863.1| ATP-dependent DNA helicase [Streptomyces albus J1074]
          Length = 1125

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 40/259 (15%), Positives = 75/259 (28%), Gaps = 22/259 (8%)

Query: 6    FLSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHC--------LEQGV 54
             LS S+  +    C +   L  ++      S     G   H L            L+  +
Sbjct: 861  VLSGSALDQLANTCALQWFLGREVKADAPASAAQGFGNVVHVLADEVASGRTPADLDVLM 920

Query: 55   DAETVSHQKLTFENDTRIVDT--EMASSVSMVLAYVR-TFSGPFLSETEVPLEPFTT--- 108
            +        L F+   + V        ++   L +     +G     +E   +       
Sbjct: 921  ERLDSVWDALAFDAPWKSVQEKENARQALERFLEWHTLDRAGRTPVASEHDFDITLGAGP 980

Query: 109  -EPGATGTADILIFNS-TQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALH-QYGDIFG 163
             E    G+ D +  +   +  +VDFK G   P  AE  ++ QL +Y           +F 
Sbjct: 981  YEVRIRGSMDRVEQDPRGRAYVVDFKTGKQAPTAAEVAHHPQLAVYQLAVTEGAVDPLFD 1040

Query: 164  RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
                         +R  +P  E   +   +  +     E     L+  + + +       
Sbjct: 1041 GVRPEPGGAELVHLRQPAPKKEGGDALPRVQHQPSPEGEWVGDLLATAAGKVLDERFTPT 1100

Query: 224  NDDSCRFCRAKVRCPALSR 242
                C  C  +  C A   
Sbjct: 1101 TGQHCAHCSFRSSCSAREE 1119


>gi|109392528|ref|YP_655657.1| gp78 [Mycobacterium phage Che12]
 gi|91980678|gb|ABE67397.1| gp78 [Mycobacterium phage Che12]
          Length = 297

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/297 (12%), Positives = 71/297 (23%), Gaps = 80/297 (26%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYASE--GTFAHNLLAHCLEQGVDAETVSHQK-- 63
           S S  +++ +CP+A  L           A    GT  H +     +   +   +S ++  
Sbjct: 12  SVSQLNQYTRCPMAYKLARIDKVWARPAAWLPQGTAFHTVAEVYEKALAEGREMSLERAQ 71

Query: 64  ----------------LTFENDTRIVDTEM-------------ASSVSMVLAYVR----- 89
                            T   +                        V+  +A+ +     
Sbjct: 72  EIFKEEYSKDIGALCEETPNFEWWFWSGPYNGERDIERRYEVGLEQVAKFIAWRQDKGQQ 131

Query: 90  -----------------TFSGPFLSE----------TEVPLEPFTTEPGATGTADILIFN 122
                                    E           E+            G  D ++  
Sbjct: 132 IWMTPEVRDRRCITGDDEAVQEHHVEDCDCQPSKPAIELSFSIELDGIKVRGFIDAVVVV 191

Query: 123 STQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSP 182
             +  + D+K G        ++ QL +YA      +G    +     +       +    
Sbjct: 192 DGELRVRDYKTGNKPG----DDFQLGVYALAISMLFGIDPPKTGDYYMA----GKKGKKA 243

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG-VNDDSCRFCRAKVRCP 238
           +        DL E  +   E+ T           + +       D C FC     CP
Sbjct: 244 VITDPY---DLTEWTR---EKITARFHEVEAGIQAGDFEPLPEPDKCGFCDVNYSCP 294


>gi|297202229|ref|ZP_06919626.1| ATP-dependent DNA helicase [Streptomyces sviceus ATCC 29083]
 gi|297148065|gb|EDY54288.2| ATP-dependent DNA helicase [Streptomyces sviceus ATCC 29083]
          Length = 1152

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/259 (14%), Positives = 73/259 (28%), Gaps = 22/259 (8%)

Query: 6    FLSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCL------EQGVDA 56
             LS S+  +    C +   L  ++      ++    G   H L           +  V  
Sbjct: 888  VLSGSALDQLANTCALQWFLGREVKADAPATVAQGFGNVVHVLADEVASGHTPADLAVLM 947

Query: 57   ETVSHQKLTFENDTRIVDTEMASSVSMVLAY-----VRTFSGPFLSETEVPLEPFTT--- 108
            E +         D      +   +  + L       V   +G     +E   +       
Sbjct: 948  ERLDSVWNALAFDAPWKSAQEKENARVALERFLKWHVMDRTGRTPVASEHDFDVTLEAGE 1007

Query: 109  -EPGATGTADILIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALH-QYGDIFG 163
             E    G  D +  +   +  +VDFK G      AE  ++ QL +Y          + F 
Sbjct: 1008 VEVRIRGQMDRVEADAEGRAYVVDFKTGKQPVSSAEVEHHPQLAVYQLAVREGAVDEAFD 1067

Query: 164  RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
                        ++R G+P  +   +   +  +     E     L+  + + +       
Sbjct: 1068 GVRPEPGGAELVQLRQGAPKRDGGETLPKVQAQEPLQGEWVGDLLATAAGKVLDERFTPN 1127

Query: 224  NDDSCRFCRAKVRCPALSR 242
                C  C  +  C A   
Sbjct: 1128 AGQHCTHCAFRASCSARPE 1146


>gi|288561642|ref|YP_003429048.1| hypothetical protein BpOF4_20804 [Bacillus pseudofirmus OF4]
 gi|288548274|gb|ADC52156.1| hypothetical protein BpOF4_20804 [Bacillus pseudofirmus OF4]
          Length = 376

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 48/287 (16%), Positives = 89/287 (31%), Gaps = 9/287 (3%)

Query: 6   FLSASSSHRWLKCPIAP--TLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
             S S    + +C  +         P  +S     G   H  +   + +G   +      
Sbjct: 19  VWSYSRLTSFERCQRSFYHKYVEGRPTPSSAPMMTGKIFHLAIQLMITEGYSPDEAISYA 78

Query: 64  LTFENDTRIVDTE-MASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
           +  E +    + +     +   +  +          +E+ LE  T +    G  DI+I +
Sbjct: 79  VYQEGELPHGEKQTFIEWMLYRVYDILPKDSYVDVTSELHLEVKTAKGLVQGYLDIIIDD 138

Query: 123 S--TQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
                  I DFK G     KAE + QL +YA         + G    +   I        
Sbjct: 139 PRTNTTEIWDFKTGWTT-TKAEKSRQLKVYAYLFHQMRRGM-GGKNFIGKLIFPRIKEEK 196

Query: 181 SPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPAL 240
             I+  VI+ DD+ E AKE+ E     + +K+              +C+ C     C   
Sbjct: 197 EMISSLVITQDDMTE-AKEWLEDTITTIEMKNALNRLDWEKTKERSNCQTCPFVSLCAGD 255

Query: 241 SRHVLLEATKDPSTNTTVELSK-AYSSISLIKSYVKACEDEMFKRLN 286
             H L        +     +         ++++     +  +    N
Sbjct: 256 YIHDLPSDGIPKDSLEAELIGSFILEQEQVLRNLKSGLKKWVKAEGN 302


>gi|313837605|gb|EFS75319.1| UvrD/REP helicase [Propionibacterium acnes HL037PA2]
 gi|314972544|gb|EFT16641.1| UvrD/REP helicase [Propionibacterium acnes HL037PA3]
          Length = 1069

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/265 (17%), Positives = 86/265 (32%), Gaps = 38/265 (14%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
            LSAS     L CP    +  +   ++     AS G+  H + A    + +   ++     
Sbjct: 795  LSASHIGELLTCPRRWFMTRRAGASSGSAFQASIGSLVHRICA----ENMGHWSLPGALT 850

Query: 65   TFENDTRIVD-----------TEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP--- 110
              E     +D            +  ++V     ++++     L  TEV ++     P   
Sbjct: 851  ELEEAWPEIDVTAEWQRNAKLADAKAAVQRFDGWLQSRHRQ-LIGTEVRVDGTIEVPSGT 909

Query: 111  -GATGTADILIFN-STQWIIVDFKY--GAGVPVKAENNTQLMLYAC-----GALHQYGDI 161
                G+ D L  +      +VD K         K  +  Q+ +Y       G        
Sbjct: 910  ARVRGSIDRLERDAEGACYVVDLKTGASQSEETKRSHRLQIGVYQAVVASGGVKTIGPKP 969

Query: 162  FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEF------KERGTLALSLKSKRA 215
                E + L I   + +    ++     AD  +    E       +     ++    +  
Sbjct: 970  VSGAELVHLQIGAGKGKLSPKVDHQSGLAD--VPWPNEIDPVDGCRNWIEASVDKALRIV 1027

Query: 216  VSLEHYGVNDDSCRFCRAKVRCPAL 240
            +S ++  V +  C  C AK  CPAL
Sbjct: 1028 ISGDYPAVVNRGCGHCPAKAGCPAL 1052


>gi|289759337|ref|ZP_06518715.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis T85]
 gi|289714901|gb|EFD78913.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis T85]
          Length = 729

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 71/254 (27%), Gaps = 30/254 (11%)

Query: 7   LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           L+ S+      CP+    E      T    ++ G+  H L     E G     +  +   
Sbjct: 480 LTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHAL---FAEPGRSESQLLAELDR 536

Query: 66  FENDTRIVDTEM--------ASSVSMVLAY-VRTFSGPFLSETEVPLEPFTTE------- 109
                                + +   + +  ++ S       EV ++    +       
Sbjct: 537 VWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTKVGVEVDIDGALEDGSGQARK 596

Query: 110 PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
               G AD L  +   + +IVD K G        A+ + QL +Y        G +    E
Sbjct: 597 IRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAE--GLVRAGDE 654

Query: 167 ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                ++       + + E               ++     +   +      +     +D
Sbjct: 655 PGGARLVYVGKSGAAGVAERKQDP-----LTPAARDEWRNLVRQLAAATAGPQFIARRND 709

Query: 227 SCRFCRAKVRCPAL 240
            C  C  +  CPA 
Sbjct: 710 GCTHCPLRPGCPAH 723


>gi|289747015|ref|ZP_06506393.1| UvrD/Rep family helicase [Mycobacterium tuberculosis 02_1987]
 gi|289687543|gb|EFD55031.1| UvrD/Rep family helicase [Mycobacterium tuberculosis 02_1987]
          Length = 489

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 71/254 (27%), Gaps = 30/254 (11%)

Query: 7   LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           L+ S+      CP+    E      T    ++ G+  H L     E G     +  +   
Sbjct: 240 LTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHAL---FAEPGRSESQLLAELDR 296

Query: 66  FENDTRIVDTEM--------ASSVSMVLAY-VRTFSGPFLSETEVPLEPFTTE------- 109
                                + +   + +  ++ S       EV ++    +       
Sbjct: 297 VWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTKVGVEVDIDGALEDGSGQARK 356

Query: 110 PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
               G AD L  +   + +IVD K G        A+ + QL +Y        G +    E
Sbjct: 357 IRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAE--GLVRAGDE 414

Query: 167 ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                ++       + + E               ++     +   +      +     +D
Sbjct: 415 PGGARLVYVGKSGAAGVAERKQDP-----LTPAARDEWRNLVRQLAAATAGPQFIARRND 469

Query: 227 SCRFCRAKVRCPAL 240
            C  C  +  CPA 
Sbjct: 470 GCTHCPLRPGCPAH 483


>gi|215405208|ref|ZP_03417389.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis 02_1987]
          Length = 498

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 71/254 (27%), Gaps = 30/254 (11%)

Query: 7   LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           L+ S+      CP+    E      T    ++ G+  H L     E G     +  +   
Sbjct: 249 LTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHAL---FAEPGRSESQLLAELDR 305

Query: 66  FENDTRIVDTEM--------ASSVSMVLAY-VRTFSGPFLSETEVPLEPFTTE------- 109
                                + +   + +  ++ S       EV ++    +       
Sbjct: 306 VWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTKVGVEVDIDGALEDGSGQARK 365

Query: 110 PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
               G AD L  +   + +IVD K G        A+ + QL +Y        G +    E
Sbjct: 366 IRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAE--GLVRAGDE 423

Query: 167 ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                ++       + + E               ++     +   +      +     +D
Sbjct: 424 PGGARLVYVGKSGAAGVAERKQDP-----LTPAARDEWRNLVRQLAAATAGPQFIARRND 478

Query: 227 SCRFCRAKVRCPAL 240
            C  C  +  CPA 
Sbjct: 479 GCTHCPLRPGCPAH 492


>gi|314927514|gb|EFS91345.1| UvrD/REP helicase [Propionibacterium acnes HL044PA1]
          Length = 1066

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/265 (17%), Positives = 86/265 (32%), Gaps = 38/265 (14%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSIY--ASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
            LSAS     L CP    +  +   ++     AS G+  H + A    + +   ++     
Sbjct: 792  LSASHIGELLTCPRRWFMTRRAGASSGSAFQASIGSLVHRICA----ENMGHWSLPGALT 847

Query: 65   TFENDTRIVD-----------TEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP--- 110
              E     +D            +  ++V     ++++     L  TEV ++     P   
Sbjct: 848  ELEEAWPEIDVTAEWQRNAKLADAKAAVQRFDGWLQSRHRQ-LIGTEVRVDGTIEVPSGT 906

Query: 111  -GATGTADILIFN-STQWIIVDFKY--GAGVPVKAENNTQLMLYAC-----GALHQYGDI 161
                G+ D L  +      +VD K         K  +  Q+ +Y       G        
Sbjct: 907  ARVRGSIDRLERDAEGACYVVDLKTGASQSEETKRSHRLQIGVYQAVVASGGVKTIGPKP 966

Query: 162  FGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEF------KERGTLALSLKSKRA 215
                E + L I   + +    ++     AD  +    E       +     ++    +  
Sbjct: 967  VSGAELVHLQIGAGKGKLSPKVDHQSGLAD--VPWPNEIDPVDGCRNWIEASVDKALRIV 1024

Query: 216  VSLEHYGVNDDSCRFCRAKVRCPAL 240
            +S ++  V +  C  C AK  CPAL
Sbjct: 1025 ISGDYPAVVNRGCGHCPAKAGCPAL 1049


>gi|260206547|ref|ZP_05774038.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis K85]
 gi|289575917|ref|ZP_06456144.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis K85]
 gi|289540348|gb|EFD44926.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis K85]
          Length = 1055

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 75/254 (29%), Gaps = 30/254 (11%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
            L+ S+      CP+    E      T    ++ G+  H L     E G     +  +   
Sbjct: 806  LTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHAL---FAEPGRSESQLLAELDR 862

Query: 66   FEND-----TRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE----------- 109
                           E+A   +M+ A+V+  +      TEV +E                
Sbjct: 863  VWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTEVGVEVDIDGALEDGSGQARK 922

Query: 110  PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
                G AD L  +   + +IVD K G        A+ + QL +Y        G +    E
Sbjct: 923  IRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAE--GLVRAGDE 980

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                 ++       + + E               ++     +   +      +     +D
Sbjct: 981  PGGARLVYVGKSGAAGVAERKQDP-----LTPAARDEWRNLVRQLAAATAGPQFIARRND 1035

Query: 227  SCRFCRAKVRCPAL 240
             C  C  +  CPA 
Sbjct: 1036 GCTHCPLRPGCPAH 1049


>gi|260188245|ref|ZP_05765719.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis CPHL_A]
 gi|289448885|ref|ZP_06438629.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis CPHL_A]
 gi|289421843|gb|EFD19044.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis CPHL_A]
          Length = 1055

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 75/254 (29%), Gaps = 30/254 (11%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
            L+ S+      CP+    E      T    ++ G+  H L     E G     +  +   
Sbjct: 806  LTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHAL---FAEPGRSESQLLAELDR 862

Query: 66   FEND-----TRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE----------- 109
                           E+A   +M+ A+V+  +      TEV +E                
Sbjct: 863  VWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTEVGVEVDIDGALEDGSGQARK 922

Query: 110  PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
                G AD L  +   + +IVD K G        A+ + QL +Y        G +    E
Sbjct: 923  IRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAE--GLVRAGDE 980

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                 ++       + + E               ++     +   +      +     +D
Sbjct: 981  PGGARLVYVGKSGAAGVAERKQDP-----LTPAARDEWRNLVRQLAAATAGPQFIARRND 1035

Query: 227  SCRFCRAKVRCPAL 240
             C  C  +  CPA 
Sbjct: 1036 GCTHCPLRPGCPAH 1049


>gi|15610338|ref|NP_217718.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis H37Rv]
 gi|15842788|ref|NP_337825.1| UvrD/Rep family helicase [Mycobacterium tuberculosis CDC1551]
 gi|148663061|ref|YP_001284584.1| UvrD/Rep family helicase [Mycobacterium tuberculosis H37Ra]
 gi|148824398|ref|YP_001289152.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis F11]
 gi|167968317|ref|ZP_02550594.1| hypothetical ATP-dependent DNA helicase [Mycobacterium tuberculosis
            H37Ra]
 gi|253800238|ref|YP_003033239.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis KZN 1435]
 gi|254233813|ref|ZP_04927138.1| hypothetical protein TBCG_03137 [Mycobacterium tuberculosis C]
 gi|254365825|ref|ZP_04981870.1| hypothetical ATP-dependent DNA helicase [Mycobacterium tuberculosis
            str. Haarlem]
 gi|254552299|ref|ZP_05142746.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis '98-R604
            INH-RIF-EM']
 gi|297635849|ref|ZP_06953629.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis KZN 4207]
 gi|297732845|ref|ZP_06961963.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis KZN R506]
 gi|306777524|ref|ZP_07415861.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu001]
 gi|306786069|ref|ZP_07424391.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu003]
 gi|306790436|ref|ZP_07428758.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu004]
 gi|306794957|ref|ZP_07433259.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu005]
 gi|306805002|ref|ZP_07441670.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu008]
 gi|306969292|ref|ZP_07481953.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu009]
 gi|306973643|ref|ZP_07486304.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu010]
 gi|307081352|ref|ZP_07490522.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu011]
 gi|313660178|ref|ZP_07817058.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis KZN V2475]
 gi|3242281|emb|CAA16669.1| POSSIBLE ATP-DEPENDENT DNA HELICASE [Mycobacterium tuberculosis
            H37Rv]
 gi|13883114|gb|AAK47639.1| helicase, UvrD/Rep family [Mycobacterium tuberculosis CDC1551]
 gi|124599342|gb|EAY58446.1| hypothetical protein TBCG_03137 [Mycobacterium tuberculosis C]
 gi|134151338|gb|EBA43383.1| hypothetical ATP-dependent DNA helicase [Mycobacterium tuberculosis
            str. Haarlem]
 gi|148507213|gb|ABQ75022.1| UvrD/Rep family helicase [Mycobacterium tuberculosis H37Ra]
 gi|148722925|gb|ABR07550.1| hypothetical ATP-dependent DNA helicase [Mycobacterium tuberculosis
            F11]
 gi|253321741|gb|ACT26344.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis KZN 1435]
 gi|308214072|gb|EFO73471.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu001]
 gi|308329222|gb|EFP18073.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu003]
 gi|308333054|gb|EFP21905.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu004]
 gi|308336740|gb|EFP25591.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu005]
 gi|308348311|gb|EFP37162.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu008]
 gi|308353145|gb|EFP41996.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu009]
 gi|308356887|gb|EFP45738.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu010]
 gi|308360887|gb|EFP49738.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis SUMu011]
 gi|323718066|gb|EGB27248.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis CDC1551A]
 gi|328459973|gb|AEB05396.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis KZN 4207]
          Length = 1055

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 75/254 (29%), Gaps = 30/254 (11%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
            L+ S+      CP+    E      T    ++ G+  H L     E G     +  +   
Sbjct: 806  LTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHAL---FAEPGRSESQLLAELDR 862

Query: 66   FEND-----TRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE----------- 109
                           E+A   +M+ A+V+  +      TEV +E                
Sbjct: 863  VWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTEVGVEVDIDGALEDGSGQARK 922

Query: 110  PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
                G AD L  +   + +IVD K G        A+ + QL +Y        G +    E
Sbjct: 923  IRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAE--GLVRAGDE 980

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                 ++       + + E               ++     +   +      +     +D
Sbjct: 981  PGGARLVYVGKSGAAGVAERKQDP-----LTPAARDEWRNLVRQLAAATAGPQFIARRND 1035

Query: 227  SCRFCRAKVRCPAL 240
             C  C  +  CPA 
Sbjct: 1036 GCTHCPLRPGCPAH 1049


>gi|31794379|ref|NP_856872.1| ATP-dependent DNA helicase [Mycobacterium bovis AF2122/97]
 gi|121639087|ref|YP_979311.1| putative ATP-dependent DNA helicase [Mycobacterium bovis BCG str.
            Pasteur 1173P2]
 gi|215432161|ref|ZP_03430080.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis EAS054]
 gi|219559254|ref|ZP_03538330.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis T17]
 gi|224991579|ref|YP_002646268.1| putative ATP-dependent DNA helicase [Mycobacterium bovis BCG str.
            Tokyo 172]
 gi|260202355|ref|ZP_05769846.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis T46]
 gi|289444773|ref|ZP_06434517.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis T46]
 gi|289571424|ref|ZP_06451651.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis T17]
 gi|289755321|ref|ZP_06514699.1| UvrD/Rep family helicase [Mycobacterium tuberculosis EAS054]
 gi|31619975|emb|CAD95319.1| POSSIBLE ATP-DEPENDENT DNA HELICASE [Mycobacterium bovis AF2122/97]
 gi|121494735|emb|CAL73216.1| Possible ATP-dependent DNA helicase [Mycobacterium bovis BCG str.
            Pasteur 1173P2]
 gi|224774694|dbj|BAH27500.1| putative ATP-dependent DNA helicase [Mycobacterium bovis BCG str.
            Tokyo 172]
 gi|289417692|gb|EFD14932.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis T46]
 gi|289545178|gb|EFD48826.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis T17]
 gi|289695908|gb|EFD63337.1| UvrD/Rep family helicase [Mycobacterium tuberculosis EAS054]
          Length = 1055

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 75/254 (29%), Gaps = 30/254 (11%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
            L+ S+      CP+    E      T    ++ G+  H L     E G     +  +   
Sbjct: 806  LTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHAL---FAEPGRSESQLLAELDR 862

Query: 66   FEND-----TRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE----------- 109
                           E+A   +M+ A+V+  +      TEV +E                
Sbjct: 863  VWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTEVGVEVDIDGALEDGSGQARK 922

Query: 110  PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
                G AD L  +   + +IVD K G        A+ + QL +Y        G +    E
Sbjct: 923  IRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAE--GLVRAGDE 980

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                 ++       + + E               ++     +   +      +     +D
Sbjct: 981  PGGARLVYVGKSGAAGVAERKQDP-----LTPAARDEWRNLVRQLAAATAGPQFIARRND 1035

Query: 227  SCRFCRAKVRCPAL 240
             C  C  +  CPA 
Sbjct: 1036 GCTHCPLRPGCPAH 1049


>gi|330469985|ref|YP_004407728.1| UvrD/REP helicase [Verrucosispora maris AB-18-032]
 gi|328812956|gb|AEB47128.1| UvrD/REP helicase [Verrucosispora maris AB-18-032]
          Length = 1190

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/249 (16%), Positives = 67/249 (26%), Gaps = 22/249 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYAS-EGTFAHN---LLAH-------CLE-QG 53
             ++ S     L+C +   LE     T +  A   G   H    L           LE   
Sbjct: 927  RVTPSGMESALRCSLRWLLERHGGSTPASAAQGVGNLVHAAAMLAEDARADRSALLEYVA 986

Query: 54   VDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT 113
               + +           R     M   +   LA           E  V L+         
Sbjct: 987  ARFDAIELAARWMVGPERARAEAMVDKLLRWLAANPRRLLAIEHEFAVRLDDPHRPVDLV 1046

Query: 114  GTADILIFN-STQWIIVDFKYGAGVPVKAE---NNTQLMLYACGALHQYGDIFGRPEALT 169
            G  D L  +   + +++D K G    V       + QL  Y   A+          E+  
Sbjct: 1047 GRVDRLEVDEDGRLVVIDLKTGKSTTVTEREVVEHPQLGAYQ-AAVEAGAFAEFGDESGG 1105

Query: 170  LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
              ++Q          +    A D  E         T  +   +    +     V +  CR
Sbjct: 1106 AALVQLGTGARDAREQSQPPATDGPEAG-----WATALVRRTADTMAASTFAAVANSKCR 1160

Query: 230  FCRAKVRCP 238
             C  +  CP
Sbjct: 1161 VCPVRTSCP 1169


>gi|284047260|ref|YP_003397600.1| UvrD/REP helicase [Conexibacter woesei DSM 14684]
 gi|283951481|gb|ADB54225.1| UvrD/REP helicase [Conexibacter woesei DSM 14684]
          Length = 1052

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/250 (14%), Positives = 71/250 (28%), Gaps = 34/250 (13%)

Query: 7    LSASSSHRWLKCPIAPTLES--KIPQTTSIYASEGTFAHNLLAHCLEQG------VDAET 58
            LSAS    +  CP+        +IPQ  ++    G   H +L             +D   
Sbjct: 817  LSASDIDTYRTCPLKYKFARVFRIPQEPTLNQRFGILVHQVLERFHSDPSRPSQSLDEML 876

Query: 59   VSHQKLTFENDTRIVDTEMA------SSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGA 112
               +           + E+       ++++      +          E            
Sbjct: 877  GLLEFGWRRGGFGGTEQEIQLRGKATAALTRYFERFQEEPSQP-VAFERSFSFRLGPHLL 935

Query: 113  TGTADILI-FNSTQWIIVDFKYGAGV-PVKAENNTQLMLYACGALHQYGDIFGRPEALTL 170
             G  D +       + ++D+K G      + E + QL LYA  A   +       +  + 
Sbjct: 936  RGRVDRVDKLPEGGFELIDYKTGPPKSRAQLEQDVQLSLYAVAAREAW-------QFESA 988

Query: 171  TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD-SCR 229
                  V   + +     + D         ++         ++  +S          +C 
Sbjct: 989  RGAYYYVLDDAKVPVERCAED---------RDWIEEIAMEVAEGILSQGFEPTPSYAACA 1039

Query: 230  FCRAKVRCPA 239
             C  ++ CPA
Sbjct: 1040 ICDYRLVCPA 1049


>gi|215413075|ref|ZP_03421776.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis 94_M4241A]
 gi|294993861|ref|ZP_06799552.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis 210]
 gi|298526679|ref|ZP_07014088.1| hypothetical ATP-dependent DNA helicase [Mycobacterium tuberculosis
            94_M4241A]
 gi|298496473|gb|EFI31767.1| hypothetical ATP-dependent DNA helicase [Mycobacterium tuberculosis
            94_M4241A]
 gi|326902571|gb|EGE49504.1| ATP-dependent DNA helicase [Mycobacterium tuberculosis W-148]
          Length = 1055

 Score = 97.4 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 71/254 (27%), Gaps = 30/254 (11%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
            L+ S+      CP+    E      T    ++ G+  H L     E G     +  +   
Sbjct: 806  LTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHAL---FAEPGRSESQLLAELDR 862

Query: 66   FENDTRIVDTEM--------ASSVSMVLAY-VRTFSGPFLSETEVPLEPFTTE------- 109
                                 + +   + +  ++ S       EV ++    +       
Sbjct: 863  VWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTKVGVEVDIDGALEDGSGQARK 922

Query: 110  PGATGTADILIFNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPE 166
                G AD L  +   + +IVD K G        A+ + QL +Y        G +    E
Sbjct: 923  IRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAE--GLVRAGDE 980

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
                 ++       + + E               ++     +   +      +     +D
Sbjct: 981  PGGARLVYVGKSGAAGVAERKQDP-----LTPAARDEWRNLVRQLAAATAGPQFIARRND 1035

Query: 227  SCRFCRAKVRCPAL 240
             C  C  +  CPA 
Sbjct: 1036 GCTHCPLRPGCPAH 1049


>gi|253576950|ref|ZP_04854274.1| predicted protein [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843681|gb|EES71705.1| predicted protein [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 226

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 66/235 (28%), Gaps = 23/235 (9%)

Query: 8   SASSSHRWLKCPIAP--TLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           S S    +  CP            +  +   + G   H  +   +    + E +    + 
Sbjct: 4   SYSRLSLYETCPYRFYQKYILGKKEPVTKPLALGKAVHKAIELKINGVSEHEAIIEAIIE 63

Query: 66  FENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT-EPGATGTADILIFNST 124
            +    +   E+AS V          +     +TEV             G  D+L     
Sbjct: 64  SDFHPEVTYEEIASLVQ--------RAPEVRGQTEVHFVLPLGDGIQLQGYIDLLEEE-- 113

Query: 125 QWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPIN 184
                D+K     P +A +  QL LYA   +   G        +  T+   R R      
Sbjct: 114 --RFWDWKSNW-RPYRANDTRQLALYAWAIMKMRG-----LRQVMGTLYFLRFRKAESFV 165

Query: 185 EWVISADDLLEKAKEFKERGTLALSLKS--KRAVSLEHYGVNDDSCRFCRAKVRC 237
                A++  E A+   E   +  S         S          C+ C   + C
Sbjct: 166 YNESDANEAREWARGLAEEIEMKKSCLESFPDMASSLFPPTPGSQCKHCPFVLEC 220


>gi|320008692|gb|ADW03542.1| UvrD/REP helicase [Streptomyces flavogriseus ATCC 33331]
          Length = 1156

 Score = 97.0 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 38/262 (14%), Positives = 77/262 (29%), Gaps = 30/262 (11%)

Query: 7    LSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
            LS S+  +    C +   L  ++      +     G   H L     ++     T +   
Sbjct: 893  LSGSALDQLANTCALQWFLGREVKADAPATAAQGFGNVVHVLA----DEVASGRTAADLD 948

Query: 64   LTFENDTRIVD--------------TEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFT- 107
            +  E    + D                  +++   L + V   +G   + +E   +    
Sbjct: 949  VLMERLDSVWDGLVFDAPWKSQQEKDHARAALERFLRWHVMDRAGRTPTASEHDFDVTLE 1008

Query: 108  ---TEPGATGTADILIFN-STQWIIVDFKYGAGVP--VKAENNTQLMLYACGALH-QYGD 160
                     G+ D +  +   +  +VDFK G G P   +   + QL +Y          +
Sbjct: 1009 AGEYAVRIRGSMDRVEQDAEGRAYVVDFKTGKGAPTKDEVAAHPQLAVYQLAVREGAVDE 1068

Query: 161  IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
            +F             ++R  +P  E   +   +  +        +  L+  + R +    
Sbjct: 1069 VFDGRRPDAGGAELVQLRQPAPKKEGGDALPKVQAQEPLSGAWVSDLLATAAGRVLDERF 1128

Query: 221  YGVNDDSCRFCRAKVRCPALSR 242
                   C  C  K  C A   
Sbjct: 1129 TPTTGQHCTHCAFKASCSAQPE 1150


>gi|253576025|ref|ZP_04853358.1| predicted protein [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251844600|gb|EES72615.1| predicted protein [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 227

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 65/235 (27%), Gaps = 23/235 (9%)

Query: 8   SASSSHRWLKCPIAP--TLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           S S    +  CP            +  +   + G   H  +   +    + E +    + 
Sbjct: 4   SYSRLSLYETCPYRFYQKYILGKKEPVTKPLALGKAVHKAIELKINGISEHEAIIEAIIE 63

Query: 66  FENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT-EPGATGTADILIFNST 124
            +    +   E+AS V          +     +TEV             G  D+L     
Sbjct: 64  SDFHPEVTYEEIASLVQ--------RAPEVRGQTEVHFVLPLGDGIQLQGYIDLLEEE-- 113

Query: 125 QWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPIN 184
                D+K     P +A +  QL LYA   +   G        +  T+   R R      
Sbjct: 114 --RFWDWKSNW-RPYRAYDTRQLALYAWAIMKMRG-----LRQVMGTLYFLRFRKAESFV 165

Query: 185 EWVISADDLLEKAKEFKERGTLALSLKS--KRAVSLEHYGVNDDSCRFCRAKVRC 237
                A++  E A    E   +  S         S          C+ C   + C
Sbjct: 166 YNESDANEAREWAHGLAEEIEMKKSCLESFPDMASSLFPPTPGSHCKHCPFVLEC 220


>gi|284992637|ref|YP_003411191.1| hypothetical protein Gobs_4258 [Geodermatophilus obscurus DSM
           43160]
 gi|284065882|gb|ADB76820.1| conserved hypothetical protein [Geodermatophilus obscurus DSM
           43160]
          Length = 287

 Score = 96.7 bits (239), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/249 (14%), Positives = 64/249 (25%), Gaps = 28/249 (11%)

Query: 9   ASSSHRWLKCPIAPT---LESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQK 63
            S    +  CP       ++   P     +A  S G+  H  L    E  +   T    +
Sbjct: 20  PSKLAAFSDCPRRYRHAYVDRPTPARGPAWAHNSVGSAVHAALRSFWELPLAGRTAGSAR 79

Query: 64  LTFENDT-------RIVDTEMASSVSMVLAYVRTFSGPFL--SETEVPLEPFTTEPGATG 114
                                 +  +  L    T   P      TE  +   T     +G
Sbjct: 80  QLLYGVWSTAGFRDAEQSERWRARAAGWLTDYVTGLDPADEPVGTERQVAATTERLALSG 139

Query: 115 TADILIFNSTQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEALTLTI 172
             D +     + ++VD+K G  V    +A  +  L  Y  G          R E   L  
Sbjct: 140 RVDRIDQRGDELVVVDYKTGRSVCTDDEARGSPALAAYVLGVRRTLRRPCSRVELHHL-- 197

Query: 173 IQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE----HYGVNDDSC 228
                     +  +  +   L    +  ++      +  +      +            C
Sbjct: 198 ------PTGTVAAFEHTDRSLANHVRRAEDVAADIAAATAAVDGGEDPDVAFPAAPGRQC 251

Query: 229 RFCRAKVRC 237
            +C  +  C
Sbjct: 252 GWCDFRPSC 260


>gi|282866609|ref|ZP_06275651.1| UvrD/REP helicase [Streptomyces sp. ACTE]
 gi|282558511|gb|EFB64071.1| UvrD/REP helicase [Streptomyces sp. ACTE]
          Length = 1137

 Score = 96.7 bits (239), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 37/263 (14%), Positives = 76/263 (28%), Gaps = 30/263 (11%)

Query: 6    FLSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
             LS S+  +    C +   L  ++      +     G   H L     ++     T +  
Sbjct: 873  VLSGSALDQLANTCALQWFLGREVKADAPATAAQGFGNVVHVLA----DEVASGRTPADL 928

Query: 63   KLTFEN--------------DTRIVDTEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFT 107
             +  E                ++    +   ++   L + V   +G      E   +   
Sbjct: 929  DVLMERLDSVWNGLVFDAPWKSQQEKDQARDALERFLRWHVMDRAGRTPVAGEHAFDVTL 988

Query: 108  ----TEPGATGTADILIFN-STQWIIVDFKYGAGVP--VKAENNTQLMLYACGALH-QYG 159
                      G+ D +  +   +  +VDFK G   P   +   + QL +Y          
Sbjct: 989  EAGEYAVRIRGSMDRVEQDTEGRAYVVDFKTGKAAPTKDEVAAHPQLAVYQLAIREGAVD 1048

Query: 160  DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
            ++F      +      ++R G+P  E   +   +  +     E     L+  + R +   
Sbjct: 1049 EVFDGRRPESGGAELVQLRQGAPKKEGGDALPKVQSQEPLSGEWVPDLLATAAGRVLDER 1108

Query: 220  HYGVNDDSCRFCRAKVRCPALSR 242
                    C  C  +  C A   
Sbjct: 1109 FTPSTGQHCAHCAFRASCSAQPE 1131


>gi|294338317|emb|CBJ94356.1| hypothetical phage protein [Campylobacter phage CPt10]
          Length = 230

 Score = 96.7 bits (239), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/235 (14%), Positives = 70/235 (29%), Gaps = 21/235 (8%)

Query: 8   SASSSHRWLKCP--IAPTLESKIPQ-TTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           S S    + KCP         K+P+   +    +G+  H +L     +  D    S    
Sbjct: 5   SFSKIDTYKKCPKQYYYRYIEKVPEIQKNPALKKGSDIHEILEFHNTEKYDIIFNSKDPE 64

Query: 65  TFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT-GTADILIFNS 123
                 R +D+E+   +       R     F    +   EP   +     G  D +    
Sbjct: 65  IQNIALRFIDSELGKEILS-----RKSLREFELFLDSNYEPCGKDTAIFVGYIDRINTTE 119

Query: 124 TQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPI 183
               ++D+K G       ++ TQL+LY+     +      +   +    ++  +      
Sbjct: 120 NGLELIDYKTGKYKDPSYQDFTQLILYSLYMFKRLKLNEIKIRYVY---VEHLLEN---- 172

Query: 184 NEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
               ++ D ++        +             S       +  C +C     CP
Sbjct: 173 -TLSLTQDSVIYWQDNLNNQIKS----IENSVESNTWNSKPNKLCPWCPYAELCP 222


>gi|158340067|ref|YP_001521237.1| hypothetical protein AM1_B0203 [Acaryochloris marina MBIC11017]
 gi|158310308|gb|ABW31923.1| hypothetical protein AM1_B0203 [Acaryochloris marina MBIC11017]
          Length = 262

 Score = 96.3 bits (238), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 45/274 (16%), Positives = 78/274 (28%), Gaps = 38/274 (13%)

Query: 7   LSASSSHRWLKCPIAP--TLESKIPQTT---SIYASEGTFAHNLLAHCLEQGVDAETVSH 61
           LSA+    + +CP +     E K+P  T   S     G   H  LA+  +    A     
Sbjct: 5   LSATKLKTYGQCPKSYQFRYEHKLPSPTIFGST--KLGNALHAALANVYKDWNYA-YPLP 61

Query: 62  QKLTFENDTRIVDTEM------------ASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE 109
               F    +   +E+                   ++ +     P   ET+V        
Sbjct: 62  SLDWFAVCWQQHTSELTPTQVHEGWVALQLYYERYISSLPQIRKPLGIETKVRANLQVRN 121

Query: 110 PG--ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEA 167
                +G  D L +      ++D+K    V      + QL  Y       Y     R   
Sbjct: 122 IEFTLSGRYDRLDYIDDGLELIDYKTSKSVNPPPSVDIQLGFYYLILEQIYKKALKRLSL 181

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + L          +    + ++ D   +     ++                E   V    
Sbjct: 182 IYLR--------SNEKLTYEVTPDHHQQAQSLIEDMAMKL-------RCDQEWKPVTGQH 226

Query: 228 CRFCRAKVRCPALSRHVLLEATKDPSTNTTVELS 261
           C  C  +  CPA++         D    T V+L+
Sbjct: 227 CDRCGYQKYCPAITTRPEPLPQ-DAREVTQVQLA 259


>gi|170079560|ref|YP_001736193.1| hypothetical protein SYNPCC7002_F0007 [Synechococcus sp. PCC 7002]
 gi|169887229|gb|ACB00938.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
          Length = 889

 Score = 96.3 bits (238), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 38/270 (14%), Positives = 70/270 (25%), Gaps = 47/270 (17%)

Query: 7   LSASSSHRWLKCPIAPTLESKI-------PQTTSIYASEGTFAHNLLAHCLEQGVDAETV 59
            SAS   +  +CP        +       P+TT   +  G   H +L   L    +   +
Sbjct: 632 FSASQLLQLGQCPFKWFAGKVLKLAALDEPETTLEPSQRGILYHKVLELALNAYRENPDL 691

Query: 60  SHQKLTFENDT----------RIVDTEMASSVSMVLAYVRTFSGPFLS-------ETEVP 102
                                  +          +    R  + P            E  
Sbjct: 692 DLTDFEQLKAWFIEAEDVLKLPELSAWERQCTEHIQTLQRAIAAPEFLPEGRHVFRLEDK 751

Query: 103 LEPFTTEPGATGTADILIFNSTQ--WIIVDFKYGAGVPVKAEN-------NTQLMLYACG 153
           ++    +   TG  D +   S     +I+D+K  +  P   ++       + QL +Y   
Sbjct: 752 IQFTWQDFRITGYIDRIDQISGTNELVIMDYKTSSSPPKGIQDESGLLKIDLQLPIYEAS 811

Query: 154 ALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSK 213
             HQY +   +            +  G  ++       DL       K          + 
Sbjct: 812 VQHQYPEFQVKQNL------YYSLTKGKKLSSKSPDEKDLQAAGDRLKIHLEEGSYPVAP 865

Query: 214 RAVSLEHYGVNDDSCRFCRAKVRCPALSRH 243
                       D+C++C  K  C      
Sbjct: 866 D--------KKYDACKYCDFKSVCRINQEE 887


>gi|326776761|ref|ZP_08236026.1| UvrD/REP helicase [Streptomyces cf. griseus XylebKG-1]
 gi|326657094|gb|EGE41940.1| UvrD/REP helicase [Streptomyces cf. griseus XylebKG-1]
          Length = 1208

 Score = 95.9 bits (237), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 36/262 (13%), Positives = 79/262 (30%), Gaps = 30/262 (11%)

Query: 7    LSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
            LS S+  +    C +   L  ++      +     G   H L     ++   + T +   
Sbjct: 945  LSGSALDQLANTCALQWFLGREVKADAPATAAQGFGNVVHVLA----DEVASSRTPADLD 1000

Query: 64   LTFEN--------------DTRIVDTEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFT- 107
            +  E                +     +  +++   L + V    G   + +E   +    
Sbjct: 1001 VLMERLDSVWNGLAFDAPWKSEQEKDQARAALERFLHWHVLDRGGRTPTASEHDFDVTLE 1060

Query: 108  ---TEPGATGTADILIFN-STQWIIVDFKYGAGVP--VKAENNTQLMLYACGALH-QYGD 160
                     G+ D +  +   +  +VDFK G G P   +  ++ QL +Y          +
Sbjct: 1061 AGEYAVRIRGSMDRVEQDAEGRAYVVDFKTGKGAPTKDEVASHPQLAVYQLAVREGAVDE 1120

Query: 161  IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEH 220
            +F             ++R  +P  E   +   +  +     E  +  L+  + + +    
Sbjct: 1121 VFDGRRPEPGGAELVQLRQPAPKKEGGDAFPKVQAQEPLAGEWVSDLLATAAGKVLDERF 1180

Query: 221  YGVNDDSCRFCRAKVRCPALSR 242
                   C  C  +  C A   
Sbjct: 1181 TPTTGTHCSHCAFRASCSAQPE 1202


>gi|467028|gb|AAA17213.1| u2126v [Mycobacterium leprae]
          Length = 212

 Score = 95.9 bits (237), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 36/197 (18%), Positives = 61/197 (30%), Gaps = 19/197 (9%)

Query: 49  CLEQGVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT 108
              Q + AE     +L  +  T+++D               T   P   E  V +E    
Sbjct: 1   MWNQMIAAERDLDGELDAKQRTQLLDEARTLLSGYYRLEDPTRFNPQSCEQRVEVEL-AD 59

Query: 109 EPGATGTADILIFNS-TQWIIVDFKYGAGVPV-----KAENNTQLMLYACGALHQYGDIF 162
                G  D +   +  +  +VD+K G   P      + +   Q+  YA   LH  G + 
Sbjct: 60  GLLLRGFIDRIDVAATGELRVVDYKTGKAPPAAQALAEFKAMFQMKFYALTLLHSRGVLP 119

Query: 163 GRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
            R   + L          S + ++    D+LL   K                  + +   
Sbjct: 120 ARLRLIYLA--------DSQLLDYAPDRDELLRFGKTLM----AIWRTIQFSGETGDFRP 167

Query: 223 VNDDSCRFCRAKVRCPA 239
                C +C  +  CPA
Sbjct: 168 NPSRLCGWCPHQEHCPA 184


>gi|82548269|gb|ABB82960.1| hypothetical protein [uncultured organism HF70_19B12]
          Length = 402

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/282 (14%), Positives = 72/282 (25%), Gaps = 66/282 (23%)

Query: 6   FLSASSSHRWLKCPIAPTL-ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSH--- 61
            LS SS  R+ +CP    L   ++P+  S+ A+ G   HN +       +          
Sbjct: 26  RLSPSSWSRYEQCPRKYWLSRQRLPRKASMPAALGNAVHNSVEDICNLDIADRDDDEIGW 85

Query: 62  ----QKLTFENDT--------------RIVDTEMASSVSMVLAYVRTFSGPFLSET---- 99
                K   +                 R  D  +  +   ++  +       L       
Sbjct: 86  MPPTAKAILDRHWKIEKDGFMATPRHPRWKDELITQAHDGLVGALNILCSKSLLPQTKLS 145

Query: 100 EVPLEPFTTEP---------------GATGTADILIFN------STQWIIVDFKYGAGVP 138
           E+ +  +                      G  D+L+ +      S  WI+ D K G    
Sbjct: 146 ELTISDWKYVQSIVLANEGTLVSECGRLMGRLDLLVADLDENGQSKGWIVADLKTGRPPI 205

Query: 139 --VKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEK 196
             +  + + QL  Y         D          +  Q                      
Sbjct: 206 GGLDPKVSRQLRFYRDLLKRNNPDHPPIRAEGWYSANQTIH----------------EAT 249

Query: 197 AKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
            +   +   +A        +        + +C FC  K  CP
Sbjct: 250 GENVIDDAFIAWEGMRPS-LKPLEATPGEQTCGFCEWKAWCP 290


>gi|203463426|ref|YP_002224009.1| gp68 [Mycobacterium phage Solon]
 gi|197312613|gb|ACH62967.1| gp68 [Mycobacterium phage Solon]
          Length = 274

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/270 (12%), Positives = 71/270 (26%), Gaps = 59/270 (21%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQ--- 62
           S S   ++ KCP +  L           A   +GT  H +    +   +    ++ +   
Sbjct: 19  SVSQLSQFDKCPFSWKLARHERVWKRPAAWLQQGTGVHAVAEKYMLSKLAGSPLTREECY 78

Query: 63  ---KLTFENDTRIVDTE----------------------------MASSVSMVLAYVRTF 91
              K  + +       E                                    +   ++ 
Sbjct: 79  EIFKAEYADGINEATEETPNLGWWFSSGPYRGADDIERRWGIGLQQVDKTLDWIDNHQSL 138

Query: 92  S----GPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQL 147
                       E+ +E         G  D ++    + ++VD+K G        ++ QL
Sbjct: 139 EVWHTPDGTPGIELAIEFELDGIEIRGYIDAVLVLDGEVLVVDWKTGLKPG----DDFQL 194

Query: 148 MLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLA 207
            +YA      YG        +T  +                   DL +  +   E+ +  
Sbjct: 195 AVYALALKQLYGV------EITRGVYFMAKTGKPTYPY------DLTDWTR---EKVSAR 239

Query: 208 LSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
                ++  + +       SC  C   + C
Sbjct: 240 FHEMERKLEAGDFTPKPGASCARCDVALSC 269


>gi|282721349|gb|ADA83798.1| gp76 [Mycobacterium phage SkiPole]
          Length = 267

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/270 (12%), Positives = 71/270 (26%), Gaps = 59/270 (21%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQ--- 62
           S S   ++ KCP +  L           A   +G+  H +    +   +    ++ +   
Sbjct: 12  SVSQLSQFDKCPFSWKLARHERVWRRPAAWLQQGSAVHAVAEKYMLSKLAGSPLTREECY 71

Query: 63  ---KLTFENDTRIVDTE----------------------------MASSVSMVLAYVRTF 91
              K  + +       E                                    +   ++ 
Sbjct: 72  EIFKAEYADGINEATEETPNLGWWFASGPYRGADDIERRWGIGLQQVDKTLDWIDNHQSL 131

Query: 92  S----GPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQL 147
                       E+ +E         G  D ++    + ++VD+K G        ++ QL
Sbjct: 132 EVWHTPDGTPGIELAIEFELDGIEIRGYIDAVLVLDGEVLVVDWKTGLKPG----DDFQL 187

Query: 148 MLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLA 207
            +YA      YG        +T  +                   DL +  +   E+ +  
Sbjct: 188 AVYALALKQLYGV------EITRGVYFMAKTGKPTYPY------DLTDWTR---EKVSAR 232

Query: 208 LSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
                ++  + +       SC  C   + C
Sbjct: 233 FHEMERKLEAGDFTPKPGASCARCDVALSC 262


>gi|182436135|ref|YP_001823854.1| putative ATP-dependent DNA helicase [Streptomyces griseus subsp.
            griseus NBRC 13350]
 gi|178464651|dbj|BAG19171.1| putative ATP-dependent DNA helicase [Streptomyces griseus subsp.
            griseus NBRC 13350]
          Length = 1184

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 77/258 (29%), Gaps = 22/258 (8%)

Query: 7    LSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCL--EQGVDAETVSH 61
            LS S+  +    C +   L  ++      +     G   H L           D + +  
Sbjct: 921  LSGSALDQLANTCALQWFLGREVKADAPATAAQGFGNVVHVLADEVASSRTPADLDVLME 980

Query: 62   QKLTFEN--------DTRIVDTEMASSVSMVLAY-VRTFSGPFLSETEVPLEPFT----T 108
            +  +  N         +     +  +++   L + V    G   + +E   +        
Sbjct: 981  RLDSVWNGLAFDAPWKSEQEKDQARAALERFLHWHVLDRGGRTPTASEHDFDVTLEAGEY 1040

Query: 109  EPGATGTADILIFN-STQWIIVDFKYGAGVP--VKAENNTQLMLYACGALH-QYGDIFGR 164
                 G+ D +  +   +  +VDFK G G P   +   + QL +Y          ++F  
Sbjct: 1041 AVRIRGSMDRVEQDAEGRAYVVDFKTGKGAPTKDEVATHPQLAVYQLAVREGAVDEVFDG 1100

Query: 165  PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVN 224
                       ++R  +P  E   +   +  +     E  +  L+  + + +        
Sbjct: 1101 RRPEPGGAELVQLRQPAPKKEGGDAFPKVQAQEPLAGEWVSDLLATAAGKVLDERFTPTT 1160

Query: 225  DDSCRFCRAKVRCPALSR 242
               C  C  +  C A   
Sbjct: 1161 GTHCSHCAFRASCSAQPE 1178


>gi|298346778|ref|YP_003719465.1| RecB family exonuclease [Mobiluncus curtisii ATCC 43063]
 gi|298236839|gb|ADI67971.1| RecB family exonuclease [Mobiluncus curtisii ATCC 43063]
          Length = 234

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/219 (13%), Positives = 61/219 (27%), Gaps = 33/219 (15%)

Query: 42  AHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDT---------------EMASSVSMVLA 86
            H +L    +           + T +     V                 E+ ++   ++ 
Sbjct: 1   MHKVLEDMFDLPPAERQAPTVRETVDRAWEKVTDGAYKLSEVLAQTSEQELKAAARQLID 60

Query: 87  YVRTFSGPFLS---ETEVPLE-PFTTEPGATGTADILIFNS-TQWIIVDFKYGAGVPVKA 141
              +   P        E+ +E   ++     G  D +         I+D+K G    ++ 
Sbjct: 61  AYFSLEDPRRLHPSGRELGVETVLSSGLKLRGFIDRVEQAGNGDVRIIDYKTGKAPDMRF 120

Query: 142 ENN--TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKE 199
                 Q+ +YA     QY     R + L L            +  +  +  ++ E A E
Sbjct: 121 TGEYVFQMRMYALLYREQYQVTPKRTQLLFL-------GGNPQVLTFDPTDANVDEFAAE 173

Query: 200 FKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
                    S  +    +          C +C  +  CP
Sbjct: 174 I----NALWSDIAAHLHANRFETRKSRLCDWCYFQNLCP 208


>gi|192823882|ref|YP_001994800.1| gp69 [Mycobacterium phage DD5]
 gi|192824154|ref|YP_001994709.1| gp68 [Mycobacterium phage Lockley]
 gi|190610384|gb|ACE79905.1| gp68 [Mycobacterium phage Lockley]
 gi|190610660|gb|ACE80178.1| gp69 [Mycobacterium phage DD5]
          Length = 272

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/270 (12%), Positives = 71/270 (26%), Gaps = 59/270 (21%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQ--- 62
           S S   ++ KCP +  L           A   +GT  H +    +   +    ++ +   
Sbjct: 17  SVSQLSQFDKCPFSWKLARHERVWKRPAAWLQQGTGVHAVAEKYMLSKLAGSPLTREECY 76

Query: 63  ---KLTFENDTRIVDTE----------------------------MASSVSMVLAYVRTF 91
              K  + +       E                                    +   ++ 
Sbjct: 77  EIFKAEYADGINEATEETPNLGWWFSSGPYRGADDIERRWGIGLQQVDKTLDWIDNHQSL 136

Query: 92  S----GPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQL 147
                       E+ +E         G  D ++    + ++VD+K G        ++ QL
Sbjct: 137 EVWHTPDGAPGIELAIEFELDGIEIRGYIDAVLVLDGEVLVVDWKTGLKPG----DDFQL 192

Query: 148 MLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLA 207
            +YA      YG        +T  +                   DL +  +   E+ +  
Sbjct: 193 AVYALALKQLYGV------EITRGVYFMAKTGKPTYPY------DLTDWTR---EKISAR 237

Query: 208 LSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
                ++  + +       SC  C   + C
Sbjct: 238 FHEMERKLEAGDFTPKPGASCARCDVALSC 267


>gi|88856786|ref|ZP_01131440.1| ATP-dependent DNA helicase [marine actinobacterium PHSC20C1]
 gi|88813954|gb|EAR23822.1| ATP-dependent DNA helicase [marine actinobacterium PHSC20C1]
          Length = 1086

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 58/204 (28%), Gaps = 15/204 (7%)

Query: 6    FLSASSSHRWLKCPIAPTL--ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
             + AS    ++  P A  L     +P+        GT  H  +         AET+    
Sbjct: 878  RIPASRFKDYIADPEAVALSLRRPMPEKPYRATRLGTQFHEWVEARFGTSASAETLDALS 937

Query: 64   LTFEN---DTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            L  +    D      +++   +           P   E E+ +             D + 
Sbjct: 938  LEIDGADVDGAADAEKLSQLQATFERSAWATRKPVDVEIEIHVPFGDRVIIC--KIDAVY 995

Query: 121  FNSTQWIIVDFKYGAGVPVKAE---NNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRV 177
             +  ++ IVD+K G      A+      QL LY        G    R +           
Sbjct: 996  ADGDRYEIVDWKTGRAPRDAADLEAKQLQLALYRLAYAQWKGIAPERID----AAFYFVA 1051

Query: 178  RTGSPINEWVISADDL-LEKAKEF 200
                   E + S  +L    A+  
Sbjct: 1052 DDTVIRPEHIYSETELREAWARSV 1075


>gi|328884880|emb|CCA58119.1| ATP-dependent DNA helicase [Streptomyces venezuelae ATCC 10712]
          Length = 1088

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/258 (16%), Positives = 77/258 (29%), Gaps = 22/258 (8%)

Query: 7    LSASSSHRWLK-CPIAPTLESKIPQTTSIY--ASEGTFAHNLLAHC--------LEQGVD 55
            LS SS    +  C +   L  ++            G   H L            L+  + 
Sbjct: 825  LSPSSLDNLVSTCSLQWFLGREVKAAAPATAAQGFGNVVHVLADEVASGRTPADLDVLMA 884

Query: 56   AETVSHQKLTFENDTRIVDT--EMASSVSMVLAY-VRTFSGPFLSETE----VPLEPFTT 108
                    L F+   +          ++   L++ V    G   + +E    V LE    
Sbjct: 885  RLDSVWDALAFDAPWKSAQEKQHARVALERFLSWHVMDRGGRTPAASEHGFDVTLEAGEY 944

Query: 109  EPGATGTADILIFNS-TQWIIVDFKYGAGVP--VKAENNTQLMLYACGALH-QYGDIFGR 164
            E    G+ D +  +   +  +VDFK G   P   +  ++ QL +Y          ++F  
Sbjct: 945  EVRIRGSMDRVETDEHGRAYVVDFKTGKSAPTKDEVAHHPQLAVYQLAVREGALDEVFDG 1004

Query: 165  PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVN 224
                       ++R  +P  E   +   +  +     E     L+  + R +        
Sbjct: 1005 RRPEPGGAELVQLRQAAPQKEGGDALPKVQAQEPLAGEWVGELLATAAGRVLDERFTPTT 1064

Query: 225  DDSCRFCRAKVRCPALSR 242
               C  C  +  C A   
Sbjct: 1065 GQHCATCSFRASCSARPE 1082


>gi|158339268|ref|YP_001520445.1| hypothetical protein AM1_6194 [Acaryochloris marina MBIC11017]
 gi|158309509|gb|ABW31126.1| hypothetical protein AM1_6194 [Acaryochloris marina MBIC11017]
          Length = 262

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/274 (16%), Positives = 77/274 (28%), Gaps = 38/274 (13%)

Query: 7   LSASSSHRWLKCPIAP--TLESKIPQTT---SIYASEGTFAHNLLAHCLEQGVDAETVSH 61
           LSA+    + +CP +     E K+P  T   S     G   H  LA+  +    A     
Sbjct: 5   LSATKLKTYGQCPKSYQFRYEHKLPSPTIFGST--KLGNALHAALANVYKDWNYA-YPLP 61

Query: 62  QKLTFENDTRIVDTEM------------ASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE 109
               F    +   +E+                   ++ +     P   ET+V        
Sbjct: 62  SLDWFAVCWQQHTSELTPTQVHEGWVALQLYYERYISSLPQIRKPLGIETKVRANLQVRN 121

Query: 110 PG--ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEA 167
                +G  D L +      ++D+K    V      + QL  Y       Y     R   
Sbjct: 122 IEFTLSGRYDRLDYIDDGLELIDYKTSKSVNPPPSVDIQLGFYYLILEQIYKKALKRLSL 181

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + L          +    + ++ D   +     ++                E   V    
Sbjct: 182 IYLR--------SNEKLTYEVTPDHHQQAQSLIEDMAMKL-------RCDQEWKPVTGQH 226

Query: 228 CRFCRAKVRCPALSRHVLLEATKDPSTNTTVELS 261
           C  C  +  CPA +         +    T V+L+
Sbjct: 227 CDRCGYQKYCPAKNTRPEPLPQ-EAKEVTQVQLA 259


>gi|325298045|ref|YP_004257962.1| hypothetical protein Bacsa_0897 [Bacteroides salanitronis DSM
           18170]
 gi|324317598|gb|ADY35489.1| hypothetical protein Bacsa_0897 [Bacteroides salanitronis DSM
           18170]
          Length = 957

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 48/301 (15%), Positives = 76/301 (25%), Gaps = 68/301 (22%)

Query: 5   AFLSASSSHRWLKCPIAPTL----ESKIPQTTSI---YASEGTFAHNLLAHCLE------ 51
           A LS S+ + +L CP+            P   S     A  G+  H    H  +      
Sbjct: 656 AVLSPSALNTYLDCPLKFYYKYVARLNTPDEVSPEIDAAKFGSIFHYAAEHIYKDLTAHG 715

Query: 52  ---------QGVDAETVSHQ------KLTFENDTRIVDTEM-----------ASSVSMVL 85
                    + +  ET          K  F + +     E               +  +L
Sbjct: 716 KVINKETLEKLLKDETRLQTYVDNGFKELFFHLSPEEKPEYNGIQLINSAVILRYIKQLL 775

Query: 86  AYVRTFSGPFLSETEVPLEPFTT--------EPGATGTADILIFNSTQWIIVDFKYGAGV 137
                ++      +E P++            +    GT D +      + IVD+K G   
Sbjct: 776 NKDIKYAPFTFIGSEQPVQEDIEIHSTTGVFQSRIGGTIDRIDMKDNIFRIVDYKTGGHA 835

Query: 138 PVKA-------------ENNTQLMLYACGALHQYGDIFG--RPEALTLTIIQPRVRTGSP 182
                                Q  LYA              +     L I Q      +P
Sbjct: 836 DTPPSIQSLFTPSAKRSNYVFQTFLYAAIVCRMLQQKHDERQVAPSLLYIHQAASEDYTP 895

Query: 183 I-----NEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
           +            +D      EF+E     L+      +         D C FC  K  C
Sbjct: 896 VIRMGEPRKTEPVEDFARYESEFRENLDQLLTHIFSPEI-PFAQTDETDVCAFCDFKELC 954

Query: 238 P 238
            
Sbjct: 955 K 955


>gi|157786545|ref|YP_001491721.1| gp69 [Mycobacterium phage Bethlehem]
 gi|40769484|gb|AAR89790.1| gp69 [Mycobacterium phage Bethlehem]
          Length = 266

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/270 (12%), Positives = 66/270 (24%), Gaps = 59/270 (21%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYA--SEGTFAHNLLAHC---------------- 49
           S S   ++ KCP +  L           A   +GT  H +                    
Sbjct: 11  SVSQLSQFDKCPFSWKLARHERVWKRPAAWLQQGTGVHAVAEKYILSKLAGSPLTREECY 70

Query: 50  --LEQGVDAETVSHQKLTFENDTRIVDTEMA-------------SSVSMVLAYVRTFS-- 92
              +           + T                            V   L ++      
Sbjct: 71  EIFKSEYADGINEATEETPNLGWWFASGRYRGQEDIERRWDIGLQQVDKTLDWIDNHPSL 130

Query: 93  -----GPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQL 147
                       E+ +E         G  D ++    + ++VD+K G        ++ QL
Sbjct: 131 EVWHTPDGTPGIELAIEFELDGIEIRGYIDAVLVLDGEVLVVDWKTGLKPG----DDFQL 186

Query: 148 MLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLA 207
            +YA      YG        +T  +                   DL +  +   E+ +  
Sbjct: 187 AVYALALKQLYGV------EITRGVYFMAKTGKPTYPY------DLTDWTR---EKISAR 231

Query: 208 LSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
                ++  + +       SC  C   + C
Sbjct: 232 FHDMERKLEAGDFTPKPGASCARCDVALSC 261


>gi|329946359|ref|ZP_08293926.1| UvrD/REP helicase [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328527335|gb|EGF54333.1| UvrD/REP helicase [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 1207

 Score = 94.3 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/309 (12%), Positives = 64/309 (20%), Gaps = 72/309 (23%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQ-TTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
             +S S       CP+   L         S   + G+  H +      + +    +     
Sbjct: 893  RVSPSDVEGLAACPLKWFLNRNGGSAPASDAQALGSLIHEIAERAESEHLRGAALRAAFE 952

Query: 65   TFENDT-----------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT----- 108
                D                  M   +   L            E  V  +         
Sbjct: 953  ERLGDLGYPDTWLGGLAAERARAMIERLDAYLTECDALGVRADVEHPVRADVDIPLQVLS 1012

Query: 109  -------------------EPGATGTADILIFNST----------------QWIIVDFKY 133
                                   +G  D L                        ++D K 
Sbjct: 1013 PEVRGRVGVRMSVGGLDAVPVRISGRIDRLEHLGDHAGQDLDDPAAPAGNSSARVIDLKT 1072

Query: 134  GAGVPVKAENNTQLMLYACG-----------ALHQYGDIFGRPEALTLTIIQPRVRTGSP 182
            G  VP   + + QL  Y              AL   G    +       ++ P       
Sbjct: 1073 GQRVPKDVQRHPQLATYRLALASQGRDVTGGALVLLGKEPSKRSGDGYVLVPPGAALDPS 1132

Query: 183  INEWVISA-------DDLLEKAKEFKE--RGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
                  +        D   + + E +E       L+  +   +         + CR C  
Sbjct: 1133 PASQEPADRPGDEPNDGDPDASAEVREEYWAEDLLAGAAVSGLGPLLEARTGEHCRTCMV 1192

Query: 234  KVRCPALSR 242
            K  CP    
Sbjct: 1193 KDSCPVQIE 1201


>gi|256374999|ref|YP_003098659.1| UvrD/REP helicase [Actinosynnema mirum DSM 43827]
 gi|255919302|gb|ACU34813.1| UvrD/REP helicase [Actinosynnema mirum DSM 43827]
          Length = 1050

 Score = 94.3 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 39/253 (15%), Positives = 74/253 (29%), Gaps = 21/253 (8%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQTTSI-YASEGTFAHNLLAHC--------LEQGVDA- 56
            +S S+     KCP+   +E    Q  +   +  GT  H L            L++ +D  
Sbjct: 794  VSPSTVETLSKCPVRWVVERHGGQDPAELASITGTLVHALAQAAASGAGEAELKEKLDEA 853

Query: 57   -ETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEP----FTTEPG 111
               V      F    R+    M  +    L+  R        E E+ ++           
Sbjct: 854  WTAVDAGAPWFSRRERMRVERMLDAFLAWLSASRGQLTQVSVEEEISVDLPKVEGGPRLK 913

Query: 112  ATGTADILIFN-STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEAL 168
              G  D L  +   + ++VD K          A+ + QL +Y   +        G     
Sbjct: 914  VRGRVDRLETDRDGRPVVVDIKTAKTPVSRKDAQEHPQLAVYQLASALGGFTHLGLATDP 973

Query: 169  TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
                +    +         +    L    ++        +   +  +V   +    +  C
Sbjct: 974  GGAALLYVAKENKKTGAAQLEQTPLD---EQGVRVWLERVQEAAGSSVGPGYRAEENPDC 1030

Query: 229  RFCRAKVRCPALS 241
              C A+  CP  +
Sbjct: 1031 DRCPARTSCPVHA 1043


>gi|289769236|ref|ZP_06528614.1| ATP-dependent DNA helicase [Streptomyces lividans TK24]
 gi|289699435|gb|EFD66864.1| ATP-dependent DNA helicase [Streptomyces lividans TK24]
          Length = 1165

 Score = 94.3 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/261 (14%), Positives = 73/261 (27%), Gaps = 25/261 (9%)

Query: 7    LSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCL------EQGVDAE 57
            LS S+  +    C +   L  ++      +     G   H L           +  V  E
Sbjct: 899  LSGSALDQLANTCALQWFLGREVKADAPATTAQGFGNVVHVLADEVASGHTPADLAVLME 958

Query: 58   TVSHQKLTFENDTRIVDTEMASSVSMVLAY-----VRTFSGPFLSETEVPLEPFT----T 108
             +         D      +  ++  + L       V   +G     +E   +        
Sbjct: 959  RLDSVWNALAFDAPWKSAQEKANARVALERFLKWHVMDRAGRTPVASEHDFDVTLEAGEY 1018

Query: 109  EPGATGTADILIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALH-QYGDIFGR 164
            E    G  D +  +   +  +VDFK G   P  +E   + QL +Y          + F  
Sbjct: 1019 EVRIRGQMDRVETDADGRAYVVDFKTGKQAPTSSEVARHPQLAVYQLAVREGAVDEAFDG 1078

Query: 165  PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFK---ERGTLALSLKSKRAVSLEHY 221
                        +R G+P  +   +   +  +  +     E     L+  + + +     
Sbjct: 1079 VRPQPGGAELVHLRQGAPKRDGGETLPKVQAQESQEGPEGEWVGDLLATAAGKVLDERFT 1138

Query: 222  GVNDDSCRFCRAKVRCPALSR 242
                  C  C  +  C A   
Sbjct: 1139 PTAGQHCTHCSFRASCSARPE 1159


>gi|21223552|ref|NP_629331.1| ATP-dependent DNA helicase [Streptomyces coelicolor A3(2)]
 gi|9714471|emb|CAC01313.1| putative ATP-dependent DNA helicase [Streptomyces coelicolor A3(2)]
          Length = 1159

 Score = 94.3 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/261 (14%), Positives = 73/261 (27%), Gaps = 25/261 (9%)

Query: 7    LSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCL------EQGVDAE 57
            LS S+  +    C +   L  ++      +     G   H L           +  V  E
Sbjct: 893  LSGSALDQLANTCALQWFLGREVKADAPATTAQGFGNVVHVLADEVASGHTPADLAVLME 952

Query: 58   TVSHQKLTFENDTRIVDTEMASSVSMVLAY-----VRTFSGPFLSETEVPLEPFT----T 108
             +         D      +  ++  + L       V   +G     +E   +        
Sbjct: 953  RLDSVWNALAFDAPWKSAQEKANARVALERFLKWHVMDRAGRTPVASEHDFDVTLEAGEY 1012

Query: 109  EPGATGTADILIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALH-QYGDIFGR 164
            E    G  D +  +   +  +VDFK G   P  +E   + QL +Y          + F  
Sbjct: 1013 EVRIRGQMDRVETDADGRAYVVDFKTGKQAPTSSEVARHPQLAVYQLAVREGAVDEAFDG 1072

Query: 165  PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFK---ERGTLALSLKSKRAVSLEHY 221
                        +R G+P  +   +   +  +  +     E     L+  + + +     
Sbjct: 1073 VRPQPGGAELVHLRQGAPKRDGGETLPKVQAQESQEGPEGEWVGDLLATAAGKVLDERFT 1132

Query: 222  GVNDDSCRFCRAKVRCPALSR 242
                  C  C  +  C A   
Sbjct: 1133 PTAGQHCTHCSFRASCSARPE 1153


>gi|158312758|ref|YP_001505266.1| hypothetical protein Franean1_0904 [Frankia sp. EAN1pec]
 gi|158108163|gb|ABW10360.1| conserved hypothetical protein [Frankia sp. EAN1pec]
          Length = 276

 Score = 94.3 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/248 (17%), Positives = 66/248 (26%), Gaps = 24/248 (9%)

Query: 9   ASSSHRWLKCPIAPT---LESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQK 63
            S    +  CP       L+   P     +A  S G   HN L    +  + A T     
Sbjct: 18  PSRLASFEDCPRRYRMTYLDRPAPPKGPPWAHTSVGVSVHNALHRWWDVPLPARTPERAG 77

Query: 64  LTFENDT-----------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGA 112
                                    A  V    A +   + P     E  +   T     
Sbjct: 78  TLLRTSWVEDGFRDGAQSAAWRERAAGMVEAYTAGIDPAAEPRAV--ERQVATRTDMLAF 135

Query: 113 TGTADILIFNSTQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQYGDIFGRPEALTL 170
            G  D L     + ++VD+K G   P    A  ++ L LYA  A         R E   L
Sbjct: 136 HGRVDRLDERGGELVVVDYKTGRRAPTDDDARGSSALALYALAAGRMLRRPCRRVELHHL 195

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRF 230
               P        +    +A  +       ++       L++               C +
Sbjct: 196 ----PTGTVAVAEHTEESTARHVRRAESVARDAAEATERLRAGADGDTAFPPSPGPLCSW 251

Query: 231 CRAKVRCP 238
           C  +  CP
Sbjct: 252 CDFRRHCP 259


>gi|298711633|emb|CBJ32689.1| RecB family exonuclease [Ectocarpus siliculosus]
          Length = 337

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 68/305 (22%), Gaps = 84/305 (27%)

Query: 7   LSASSSHRWLKCPIA--PTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETV----- 59
           +S S+   + +CP          +    +    +G   H +L+        +  +     
Sbjct: 37  ISPSAVAAFQQCPQLFYYRYILGLKSPPTRETLKGIAVHEVLSLFFTLEEGSRDIGHLHE 96

Query: 60  --------------------SHQKLTFENDTRIVDTEMASSVSMVL-----AYVRTFSGP 94
                                 +    + + +    E    V+  +     A       P
Sbjct: 97  LFRKVMTGLIAQDKEDPSRGYGKLFETQEEEKKWVVECLDLVANFVRVESDARDDGEGDP 156

Query: 95  FLSETEVPLEPFTTEP-----------------------------GATGTADILIFN-ST 124
              E  +  E    E                                TG  D L      
Sbjct: 157 EHVELRMTHEFGGGETAAGRHIVEEEGEGGQAGDGVAASNTAWSMNVTGIVDRLDRCPDG 216

Query: 125 QWIIVDFKYGAGV----------PVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQ 174
              +VD+K G              +  E   QL +YA       G+  G    + L    
Sbjct: 217 TLRVVDYKTGKIPNLKYSEATNQRIMDEKFFQLQIYALLVERVLGEAPGEMRLVYL---- 272

Query: 175 PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
                G       I    L     E +          +               C +C  +
Sbjct: 273 ----KGPASVTRKIEPAALPSVEGELR----STWDEIAGSVRRDSFPPRTSRLCDWCSFQ 324

Query: 235 VRCPA 239
            RCPA
Sbjct: 325 DRCPA 329


>gi|256785339|ref|ZP_05523770.1| ATP-dependent DNA helicase [Streptomyces lividans TK24]
          Length = 1121

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/261 (14%), Positives = 73/261 (27%), Gaps = 25/261 (9%)

Query: 7    LSASSSHRWLK-CPIAPTLESKIPQ--TTSIYASEGTFAHNLLAHCL------EQGVDAE 57
            LS S+  +    C +   L  ++      +     G   H L           +  V  E
Sbjct: 855  LSGSALDQLANTCALQWFLGREVKADAPATTAQGFGNVVHVLADEVASGHTPADLAVLME 914

Query: 58   TVSHQKLTFENDTRIVDTEMASSVSMVLAY-----VRTFSGPFLSETEVPLEPFT----T 108
             +         D      +  ++  + L       V   +G     +E   +        
Sbjct: 915  RLDSVWNALAFDAPWKSAQEKANARVALERFLKWHVMDRAGRTPVASEHDFDVTLEAGEY 974

Query: 109  EPGATGTADILIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALH-QYGDIFGR 164
            E    G  D +  +   +  +VDFK G   P  +E   + QL +Y          + F  
Sbjct: 975  EVRIRGQMDRVETDADGRAYVVDFKTGKQAPTSSEVARHPQLAVYQLAVREGAVDEAFDG 1034

Query: 165  PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFK---ERGTLALSLKSKRAVSLEHY 221
                        +R G+P  +   +   +  +  +     E     L+  + + +     
Sbjct: 1035 VRPQPGGAELVHLRQGAPKRDGGETLPKVQAQESQEGPEGEWVGDLLATAAGKVLDERFT 1094

Query: 222  GVNDDSCRFCRAKVRCPALSR 242
                  C  C  +  C A   
Sbjct: 1095 PTAGQHCTHCSFRASCSARPE 1115


>gi|158340371|ref|YP_001521727.1| endonuclease [Acaryochloris marina MBIC11017]
 gi|158310612|gb|ABW32226.1| RecB family exonuclease, putative [Acaryochloris marina MBIC11017]
          Length = 262

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 44/268 (16%), Positives = 74/268 (27%), Gaps = 37/268 (13%)

Query: 6   FLSASSSHRWLKCPIAP--TLESKIPQTT---SIYASEGTFAHNLLAHCLEQG------- 53
            LSA+    + +CP A     E  +   +   S     G   H  LA   +         
Sbjct: 4   PLSATKLITYQQCPKAYNFRYERGLSSPSAFGSPA--FGIALHKTLADIYKDWNYGYPLP 61

Query: 54  -VDAETVSHQKLTFENDTRIVDTEMAS---SVSMVLAYVRTFSGPFLSETEVPLEPFTTE 109
            +D   V  Q  T E     +     +        +A +     P   E ++        
Sbjct: 62  SLDWFAVCWQAHTGELKPAQIHEGWMALQIYYEKYVAPLPQIRKPLGVEGKIKASFQVNN 121

Query: 110 PG--ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEA 167
                TG  D L +      ++D+K    +      + QL LY       Y +       
Sbjct: 122 IEFSITGRYDRLDYTDNGLELIDYKTSKTIGPSDGIDLQLGLYFLILEQIYPEALETLSL 181

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + L               + ++ D   +  +   +                E      + 
Sbjct: 182 IYLR--------QGQKVTFDVTPDHHQQVRELIGDIAVKL-------RADDEWKPEVGEY 226

Query: 228 CRFCRAKVRCPALSR--HVLLEATKDPS 253
           C  C  +  CPA S     L E TK+  
Sbjct: 227 CNHCGYQKYCPAKSEKPEPLPEGTKEAR 254


>gi|288921385|ref|ZP_06415665.1| hypothetical protein FrEUN1fDRAFT_5363 [Frankia sp. EUN1f]
 gi|288347237|gb|EFC81534.1| hypothetical protein FrEUN1fDRAFT_5363 [Frankia sp. EUN1f]
          Length = 273

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/252 (15%), Positives = 65/252 (25%), Gaps = 32/252 (12%)

Query: 9   ASSSHRWLKCPIAPT---LESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQK 63
            S    +  CP       L+   P     +A  S G   HN L    +  + A T     
Sbjct: 15  PSRLAAFEDCPRRYRMTYLDRPAPPKGPPWAHTSVGVSVHNALHRWWDVPLPARTPERAG 74

Query: 64  LTFENDT-----------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGA 112
                                    A+ V    A +   + P     E  +   T +   
Sbjct: 75  GLLRTAWVTDGFRDREQSAAWRERAAAMVEGYTAGLDPAAEPRAV--ERQVATRTEQLAF 132

Query: 113 TGTADILIFNSTQWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFGRPEALTL 170
            G  D L     + ++VD+K G        A  ++ L LYA  A         R E   L
Sbjct: 133 HGRVDRLDQRDGELVVVDYKTGRRPLTEADARGSSALALYALAAGRMLRTPCRRVELHHL 192

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE----HYGVNDD 226
                       +     +   L    +  +   +       +     +           
Sbjct: 193 --------PSGTVAVAEHTDASLQRHVQRAESVASDITEATDRLRAGADADAVFAPSPGP 244

Query: 227 SCRFCRAKVRCP 238
            C +C  +  CP
Sbjct: 245 LCSWCDFRRHCP 256


>gi|258648077|ref|ZP_05735546.1| conserved hypothetical protein [Prevotella tannerae ATCC 51259]
 gi|260851938|gb|EEX71807.1| conserved hypothetical protein [Prevotella tannerae ATCC 51259]
          Length = 905

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 35/286 (12%), Positives = 77/286 (26%), Gaps = 54/286 (18%)

Query: 6   FLSASSSHRWLKCPIAP---TLESKIPQTTSIYAS----EGTFAHNLLAHCLEQGVDAET 58
            LS SS ++++ CP+      +    P   +  A      G   H L     +       
Sbjct: 612 PLSPSSINKYIDCPLQFYYHRVARLTPHEDTDAALDNRIFGNVFHQLAEDFYKPFEGKGK 671

Query: 59  VSHQKLTFENDTRIVDTEMAS--------------------SVSMVLAYVRTFSGPFLSE 98
           +  Q+L + ++       +                          +LAY    +   +  
Sbjct: 672 IDPQRLAYYHEHPERLNPLIEEAFAKNNAPYRLVDATIVRNLFRRMLAYDYRLADLEIVR 731

Query: 99  TE--------VPLEPFTTEPGATGTADILIFN---ST--QWIIVDFKYGA---------- 135
            E        + ++         G  D L      S      +VD+K G           
Sbjct: 732 LECDVDISLPLKIDGTVRPFNVGGRIDRLDIACTPSGLRTLRVVDYKTGTKEQKANKMED 791

Query: 136 ---GVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADD 192
                  +     Q  LYA     +  +  G    ++  +    +   +       + + 
Sbjct: 792 LFIPKKSRPYYIFQTFLYALAVQDKVCEFTGEDLPVSTVLFHIPLINEAYDPWIPFAKER 851

Query: 193 LLEKAKEFKERGTLALSLKSKRAVSLEHYGVND-DSCRFCRAKVRC 237
           + +      +    ++ L  +   +      +D + C  C  +  C
Sbjct: 852 VYDFGPLAADFREQSIELLQRMMDTPTFRQTDDLNVCAHCDFQQLC 897


>gi|167041227|gb|ABZ05984.1| hypothetical protein ALOHA_HF4000001N02ctg1g23 [uncultured marine
           microorganism HF4000_001N02]
          Length = 471

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 42/281 (14%), Positives = 63/281 (22%), Gaps = 66/281 (23%)

Query: 7   LSASSSHRWLKCPIAPTL-ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
           LS SS  R+ +CP    L    +P+  S+ A+ G   HN +       +           
Sbjct: 70  LSPSSWSRFEECPRKYWLSRQGLPRKASMPAAMGNAVHNSVEDICNLDISDREDDEVGWL 129

Query: 66  FENDTRIVDTEMASSVSMVLAYVRTFSGPFLS---------------------------- 97
                 I+D          L   R                                    
Sbjct: 130 PPTAKEILDRHWQIEKDNFLGTPRHPRWKNELITKAHDGLVGALNILFSKSTVGVQKLSE 189

Query: 98  -----ETEV-------PLEPFTTEPGATGTADILIFNSTQ------WIIVDFKYGAGVPV 139
                  EV            +      G  D+L+ +  +      WI+ D K G     
Sbjct: 190 VTVGTWREVQTIVLANEGTLVSECGRLMGRLDLLVADIDENGESQGWIVADLKTGRPPSP 249

Query: 140 KAEN--NTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKA 197
             +   + QL  Y         +          +  Q       P               
Sbjct: 250 SLDEKVSRQLRFYRDLLKQNNPNHPTVTAEGWYSANQTIHVADGP--------------- 294

Query: 198 KEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
                   +A          LE     D  C +C  K  CP
Sbjct: 295 -SVIPAALVAWEGMRPSLTPLE-ATPGDRQCGWCEWKAWCP 333


>gi|145294939|ref|YP_001137760.1| hypothetical protein cgR_0885 [Corynebacterium glutamicum R]
 gi|140844859|dbj|BAF53858.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 1070

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 30/175 (17%), Positives = 46/175 (26%), Gaps = 12/175 (6%)

Query: 23   TLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVS 82
             +   +P   + YA  GT  H  L         +  +  +      D    D        
Sbjct: 901  RMRRPVPFKPNTYAKRGTLFHQWLEDRF----GSTALLDETELPGIDEDYSDDAFIELRD 956

Query: 83   MVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGV--PVK 140
              L        P     E P E    E    G  D +      W++VD+K G     P  
Sbjct: 957  AFLGSTWENRTPEFV--EHPFEVTIGEHVIRGRMDAVFHTDGTWMVVDWKTGRTPTGPEM 1014

Query: 141  AENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLE 195
                 QL +Y        G      E +               N+   + ++L  
Sbjct: 1015 DAAIIQLAVYRLAWARLKGLEP---EEVRAAFHYVAHDHTFEPNDL-PTQEELAR 1065


>gi|21323542|dbj|BAB98169.1| Superfamily I DNA and RNA helicases [Corynebacterium glutamicum ATCC
            13032]
          Length = 1073

 Score = 93.6 bits (231), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/175 (17%), Positives = 46/175 (26%), Gaps = 12/175 (6%)

Query: 23   TLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVS 82
             +   +P   + YA  GT  H  L         +  +  +      D    D        
Sbjct: 904  RMRRPVPFKPNTYAKRGTLFHQWLEDRF----GSTALLDETELPGIDEDYSDDAFIELRD 959

Query: 83   MVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGV--PVK 140
              L        P     E P E    E    G  D +      W++VD+K G     P  
Sbjct: 960  AFLGSTWENRTPEFV--EHPFEVTIGEHVIRGRMDAVFHTDGTWMVVDWKTGRTPTGPEM 1017

Query: 141  AENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLE 195
                 QL +Y        G      E +               N+   + ++L  
Sbjct: 1018 DAAIIQLAVYRLAWARLKGLEP---EEVRAAFHYVAHDHTFEPNDL-PTQEELAR 1068


>gi|258591644|emb|CBE67945.1| protein of unknown function [NC10 bacterium 'Dutch sediment']
          Length = 387

 Score = 93.6 bits (231), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 38/259 (14%), Positives = 64/259 (24%), Gaps = 42/259 (16%)

Query: 8   SASSSHRWLKCPIAPTLE---SKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           SAS    +  CP+               SI A  G+  H  L             S   L
Sbjct: 19  SASRLSTYESCPLQYRFRYIDRIHRTEESIEAYLGSRVHEALNALYRTLQLGGEPSLSDL 78

Query: 65  TFENDTRI-------------------VDTEMASSVSMVLAYVRTFSGPFLSETEVPLEP 105
             E   +                            +       + F+   +   E  +  
Sbjct: 79  LKEYHWQWGQRWHNQVKIVKQDRSIDSYKELGERCLVNYYQAHQPFNHGQILGLEYHVAT 138

Query: 106 FTTEPG---ATGTADILI-FNSTQWIIVDFKYGAGVPVK--AENNTQLMLYACGALHQYG 159
                G     G  D L+   S ++ I D+K    +P +   + + QL LY       + 
Sbjct: 139 SLDPHGCYKIQGYIDRLVSVGSGRYEIHDYKTSGRLPSQGDLDVDRQLALYQLAIEGIWP 198

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
           D     E +                    + D L    +          +         E
Sbjct: 199 DA-KEIELV------WHYLAFGRELRSRRTPDALERLKRSTIAVIDRIEA-------DSE 244

Query: 220 HYGVNDDSCRFCRAKVRCP 238
              +  + C +C  +  CP
Sbjct: 245 FKPIKSNLCHWCTYQNICP 263


>gi|154174406|ref|YP_001407580.1| hypothetical protein CCV52592_0909 [Campylobacter curvus 525.92]
 gi|112803770|gb|EAU01114.1| conserved hypothetical protein [Campylobacter curvus 525.92]
          Length = 783

 Score = 93.6 bits (231), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 39/249 (15%), Positives = 72/249 (28%), Gaps = 45/249 (18%)

Query: 7   LSASSSHRWLKCPIAPTLES--KIPQT----TSIYASEGTFAH-NLLAHC----LEQGV- 54
           LS S+ + +L CP          IP+     T+  +  G   H  L  +       +   
Sbjct: 560 LSFSTLNLYLSCPRKYYYAKILAIPEPKTIGTAPASRLGEAVHKALCEYYQGEFFRRSQR 619

Query: 55  ----DAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLE-PFTTE 109
               D +    +      +  I+  +            R   G  + E E  +       
Sbjct: 620 FDVTDFKKCLGKFALSSLEFEILTVKFDIYAQ--YENERLKEGVRVLECEKNVSGVEFEG 677

Query: 110 PGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALT 169
               G  D +   S Q +I+D+K G       + + QL  Y      +    +       
Sbjct: 678 VKIRGVIDRVDELSGQKMIIDYKSGK----FEDKSLQLPFYQALLGERCEAFYYDL-GGE 732

Query: 170 LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
           +T++  R            S ++L    +  K      ++                  CR
Sbjct: 733 MTLVPSRS-----------SLEELRAAIERLKNINKTRIN----------FAPNPGQQCR 771

Query: 230 FCRAKVRCP 238
           +C  K+ C 
Sbjct: 772 YCAYKILCK 780


>gi|325295714|ref|YP_004282228.1| hypothetical protein Dester_1542 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325066162|gb|ADY74169.1| hypothetical protein Dester_1542 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 268

 Score = 93.6 bits (231), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/260 (15%), Positives = 75/260 (28%), Gaps = 32/260 (12%)

Query: 3   HHAF-LSASSSHRWLKCPIAPT---LESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAET 58
            H    S S   +  +C        +E K P   + +   G+  H +L + L    + E 
Sbjct: 11  KHLRPWSFSKVQKAKRCQYEFYWNYVEKKEPLERADFLVLGSGVHFVLENALNAVFERER 70

Query: 59  VSHQKLTFENDTRIVDTEMASSVSMVLAYV-----------RTFSGPFLSETEVPL---- 103
              + L F         E  + V+ +  +            R  S      +E+ L    
Sbjct: 71  PLSRDLLFYFAETFKREEPLAEVNKIAEFFPNILKYVNGQLRRASESKFIASELELAVDK 130

Query: 104 ------EPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQ 157
                 +  +      G  D +        IVD K         +  TQL  YA  A  +
Sbjct: 131 DFNLLSDFCSERVFLRGKLDFVFSKGDTLYIVDHKTSRSKNFNNKIKTQLRWYALLANVK 190

Query: 158 YGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVS 217
           + +       +              +N ++ + +DL                    ++ S
Sbjct: 191 FPEFKRFALEVHNVRY-------GTVNRFIFTENDLKLFKLRLLPIIENIEGELLGKSFS 243

Query: 218 LEHYGVNDDSCRFCRAKVRC 237
                  + +CR+C  +  C
Sbjct: 244 ELIPSPCESNCRWCDFRHIC 263


>gi|19552002|ref|NP_600004.1| putative helicase [Corynebacterium glutamicum ATCC 13032]
 gi|62389665|ref|YP_225067.1| DNA helicase II protein [Corynebacterium glutamicum ATCC 13032]
 gi|41325000|emb|CAF19481.1| PROBABLE DNA HELICASE II PROTEIN [Corynebacterium glutamicum ATCC
            13032]
          Length = 1070

 Score = 93.6 bits (231), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/175 (17%), Positives = 46/175 (26%), Gaps = 12/175 (6%)

Query: 23   TLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVS 82
             +   +P   + YA  GT  H  L         +  +  +      D    D        
Sbjct: 901  RMRRPVPFKPNTYAKRGTLFHQWLEDRF----GSTALLDETELPGIDEDYSDDAFIELRD 956

Query: 83   MVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGV--PVK 140
              L        P     E P E    E    G  D +      W++VD+K G     P  
Sbjct: 957  AFLGSTWENRTPEFV--EHPFEVTIGEHVIRGRMDAVFHTDGTWMVVDWKTGRTPTGPEM 1014

Query: 141  AENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLE 195
                 QL +Y        G      E +               N+   + ++L  
Sbjct: 1015 DAAIIQLAVYRLAWARLKGLEP---EEVRAAFHYVAHDHTFEPNDL-PTQEELAR 1065


>gi|218130935|ref|ZP_03459739.1| hypothetical protein BACEGG_02537 [Bacteroides eggerthii DSM 20697]
 gi|317476246|ref|ZP_07935497.1| hypothetical protein HMPREF1016_02480 [Bacteroides eggerthii
           1_2_48FAA]
 gi|217987279|gb|EEC53610.1| hypothetical protein BACEGG_02537 [Bacteroides eggerthii DSM 20697]
 gi|316907657|gb|EFV29360.1| hypothetical protein HMPREF1016_02480 [Bacteroides eggerthii
           1_2_48FAA]
          Length = 963

 Score = 93.2 bits (230), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 46/302 (15%), Positives = 76/302 (25%), Gaps = 66/302 (21%)

Query: 3   HH--AFLSASSSHRWLKCPIAPTLES----KIPQTTS---IYASEGTFAHNL-------- 45
            H  A  S S+ + +L C +          K P   S     A  GT  H          
Sbjct: 663 QHPNALFSPSALNTYLDCRLKFYYRYVAGLKAPDEVSAEIDSALFGTIFHRSAELVYQDL 722

Query: 46  -----------LAHCLEQGVDAETVSHQKLTFENDTRIVDTE-------------MASSV 81
                      L   L   V  +T        E      + +             +AS +
Sbjct: 723 TTNGKEIRKEDLEQLLRNDVKLQTYVDNAFKEELFHVQANEQPEYNGTQLIHSKVIASYL 782

Query: 82  SMVLA-------YVRTFSGPFLSE-TEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKY 133
             +L        +        ++E  E+            GT D +        IVD+K 
Sbjct: 783 RQLLRNDLHYAPFHMEAMEQKVTETVEIETPLGILPLNIGGTIDRMDSKDDTLRIVDYKT 842

Query: 134 GAGVPVK--------AENNTQLMLYA--CGALHQYGDIFGRPEALTLTIIQPRVRTGSPI 183
           G                +N    ++     A         +     L I +      SP+
Sbjct: 843 GGTPRTPENIEQLFVPADNRPNYIFQTFLYAAIMCRKQTLKVAPSLLYIHRAASENYSPV 902

Query: 184 ------NEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
                  +  I   +      EF+ER +  L               ++  C +C  +  C
Sbjct: 903 IEMGAPRQPKIPVSNFAFYEDEFRERLSALLKEI-YNPEETFSQTEDNGKCEYCDFRSLC 961

Query: 238 PA 239
             
Sbjct: 962 KK 963


>gi|158340173|ref|YP_001521343.1| hypothetical protein AM1_B0310 [Acaryochloris marina MBIC11017]
 gi|158310414|gb|ABW32029.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
          Length = 262

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 46/261 (17%), Positives = 75/261 (28%), Gaps = 37/261 (14%)

Query: 6   FLSASSSHRWLKCPIAP--TLESKIPQTT---SIYASEGTFAHNLLAHCLEQGVDAETVS 60
            LSA+    + +CP +     E K+P  T   S     G   H  LA   +    A    
Sbjct: 4   PLSATKLKTYGQCPQSYQFRYEHKLPSPTLFGST--KLGNALHAALATIYKDWNYA-YPL 60

Query: 61  HQKLTFENDTRIVDTEM------------ASSVSMVLAYVRTFSGPFLSETEVPLEPFTT 108
                F    +  + E+                   ++ +     P   ET+V       
Sbjct: 61  PSLDWFAVCWQQHNGELTPTQIHEGWAALQLYYERYISPLPEIRKPLGIETKVRANLQVR 120

Query: 109 EPG--ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPE 166
                 +G  D L +      ++D+K    V      + QL  Y       Y     R  
Sbjct: 121 NIEFTLSGRYDRLDYIDDGLELIDYKTSKSVNPPPSVDIQLGFYYLILEQIYKKALKRLS 180

Query: 167 ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDD 226
            + L          +    + ++ DD  ++A+   E   + L          E   V   
Sbjct: 181 LIYLR--------SNEKLTYEVN-DDHHQQARSLIEDMAMKLRCDQ------EWKPVTGQ 225

Query: 227 SCRFCRAKVRCPALSRHVLLE 247
            C  C  +  CPA S      
Sbjct: 226 HCDRCGYQKYCPAKSGEPEPL 246


>gi|158340761|ref|YP_001521929.1| hypothetical protein AM1_D0120 [Acaryochloris marina MBIC11017]
 gi|158311002|gb|ABW32615.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
          Length = 262

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 37/260 (14%), Positives = 67/260 (25%), Gaps = 37/260 (14%)

Query: 7   LSASSSHRWLKCPIAP--TLESKIPQTT---SIYASEGTFAHNLLAHCLEQGVDAETVSH 61
           LSA+    + +CP A     E  +   +   S     G   H  LA   +   + +    
Sbjct: 5   LSATKLITYQQCPKAYNFRYERGLSSPSAFGSPA--FGIALHKTLADIYKDW-NYDYPLP 61

Query: 62  QKLTFENDTRIVDTEM------------ASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE 109
               F    +    E+                   +A +     P   E ++        
Sbjct: 62  SLDWFAMCWQHHTGELKPAQIHEGWMALQLYYEKYVAPLPQIRKPIGVEGKIKASFQVNN 121

Query: 110 PG--ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEA 167
                TG  D L +      ++D+K    +      + QL LY       Y +       
Sbjct: 122 IEFSITGRYDRLDYTDNGLELIDYKTSKTIGPSDGIDLQLGLYFLILEQIYPEALDTLSL 181

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + L               + ++ D   +  +   +                E        
Sbjct: 182 IYLR--------QGQKVSFDVTPDHHQQVRELIGDIAVKL-------RADDEWKPEVGGH 226

Query: 228 CRFCRAKVRCPALSRHVLLE 247
           C  C  +  CPA S+     
Sbjct: 227 CNHCGYQKYCPAKSKKPEPL 246


>gi|192823972|ref|YP_001994618.1| gp71 [Mycobacterium phage Jasper]
 gi|190610567|gb|ACE80086.1| gp71 [Mycobacterium phage Jasper]
          Length = 274

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 37/270 (13%), Positives = 73/270 (27%), Gaps = 59/270 (21%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQ--- 62
           S S   ++ KCP +  L           A   +GT  H +    +   +    ++ +   
Sbjct: 19  SVSQLSQFDKCPFSWKLARHERVWKRPAAWLQQGTGVHAVAEKYMLSKLAGSPLTREECY 78

Query: 63  ---KLTFENDTRIVDTEMAS-------------------------SVSMVLAYVRTFS-- 92
              K  + +       E  +                          V   L ++      
Sbjct: 79  EIFKAEYADGINEATEETPNLGWWFASGPYRGADDIERRWGIGLQQVDKTLDWIDNHPSL 138

Query: 93  -----GPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQL 147
                       E+ +E         G  D ++    +  +VD+K GA       ++ QL
Sbjct: 139 EVWHTPDGTPGIELAIEFELDGIEIRGYIDAVLVLDGEVQVVDWKSGAKPG----DDFQL 194

Query: 148 MLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLA 207
            +YA      YG        +T  +                   DL +  +   E+ +  
Sbjct: 195 AVYALALKQLYGV------EITRGVYFMAKTGKPTYPY------DLTDWTR---EKISAR 239

Query: 208 LSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
                ++  + +       SC  C   + C
Sbjct: 240 FHEMERKLEAGDFTPKPGASCARCDVALSC 269


>gi|305679610|ref|ZP_07402420.1| phage prohead protease, HK97 family [Corynebacterium matruchotii ATCC
            14266]
 gi|305660230|gb|EFM49727.1| phage prohead protease, HK97 family [Corynebacterium matruchotii ATCC
            14266]
          Length = 1095

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 38/190 (20%), Positives = 55/190 (28%), Gaps = 19/190 (10%)

Query: 25   ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVSMV 84
               +P   + YA  GT  H+ L         A T+  +      D  I   ++       
Sbjct: 923  RRPVPFKPNRYAKRGTEFHSWLEQRF----GAPTLLDESELPGMDEEITPGQLQELKDKF 978

Query: 85   LAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGA--GVPVKAE 142
            +A       P     E P E         G  D +  + + W IVD+K G          
Sbjct: 979  VAGQFADRTPMFV--EQPFEVSIDGIVIRGRMDAVFRDESGWHIVDWKTGQLPSRADMRY 1036

Query: 143  NNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKE 202
               QL +Y        G        +  +    R    S       SAD+L    +E  E
Sbjct: 1037 LMMQLAVYRIAWAQLQGIDPDE---IHASFYYVRYDKLS-------SADNLPS-EREIAE 1085

Query: 203  RGTLALSLKS 212
               LA     
Sbjct: 1086 TLRLAAQPIE 1095


>gi|225020702|ref|ZP_03709894.1| hypothetical protein CORMATOL_00709 [Corynebacterium matruchotii ATCC
            33806]
 gi|224946648|gb|EEG27857.1| hypothetical protein CORMATOL_00709 [Corynebacterium matruchotii ATCC
            33806]
          Length = 1095

 Score = 92.8 bits (229), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 38/190 (20%), Positives = 55/190 (28%), Gaps = 19/190 (10%)

Query: 25   ESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVSMV 84
               +P   + YA  GT  H+ L         A T+  +      D  I   ++       
Sbjct: 923  RRPVPFKPNRYAKRGTEFHSWLEQRF----GAPTLLDESELPGMDEEITPGQLQELKDKF 978

Query: 85   LAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGA--GVPVKAE 142
            +A       P     E P E         G  D +  + + W IVD+K G          
Sbjct: 979  VAGQFADRTPMFV--EQPFEVSIDGIVIRGRMDAVFRDESGWHIVDWKTGQLPSRADMRY 1036

Query: 143  NNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKE 202
               QL +Y        G        +  +    R    S       SAD+L    +E  E
Sbjct: 1037 LMMQLAVYRIAWAQLQGIDPDE---IHASFYYVRYDKLS-------SADNLPS-EREIAE 1085

Query: 203  RGTLALSLKS 212
               LA     
Sbjct: 1086 TLRLAAQPIE 1095


>gi|158341049|ref|YP_001522216.1| hypothetical protein AM1_E0133 [Acaryochloris marina MBIC11017]
 gi|158311290|gb|ABW32902.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
          Length = 262

 Score = 92.8 bits (229), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 46/274 (16%), Positives = 77/274 (28%), Gaps = 38/274 (13%)

Query: 7   LSASSSHRWLKCPIAP--TLESKIPQTT---SIYASEGTFAHNLLAHCLEQGVDAETVSH 61
           LSA+    + +CP +     E K+P  T   S     G   H  LA+  +    A     
Sbjct: 5   LSATKLKTYGQCPKSYQFRYEHKLPSPTIFGST--KLGNALHAALANVYKDWNYA-YPLP 61

Query: 62  QKLTFENDTRIVDTEM------------ASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE 109
               F    +   +E+                   +A +     P   ET+V        
Sbjct: 62  SLDWFAVCWQHHTSELTPTQIHEGWAALQLYYERYIAPLPQIRKPLGIETKVRATLQVRN 121

Query: 110 PG--ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEA 167
                +G  D L +      ++D+K    V      + QL  Y       Y     R   
Sbjct: 122 IEFTLSGRYDRLDYIDDGLELIDYKTSKSVNPPPSVDIQLGFYYLILEQIYKKALKRLSL 181

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + L          +    + ++ D   +     ++                E   V    
Sbjct: 182 IYLR--------SNEKLIYEVTPDHHQQAQSLIEDMAMKL-------RCDQEWKPVAGQH 226

Query: 228 CRFCRAKVRCPALSRHVLLEATKDPSTNTTVELS 261
           C  C  +  CPA +         D    T V+L+
Sbjct: 227 CDRCGYQKYCPAKNTRPEPLPQ-DAKEVTQVQLA 259


>gi|291531227|emb|CBK96812.1| Superfamily I DNA and RNA helicases [Eubacterium siraeum 70/3]
          Length = 949

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/251 (13%), Positives = 67/251 (26%), Gaps = 30/251 (11%)

Query: 10  SSSHRWLKCPIAPTLESKIPQTTSI--YASEGTFAHNLLAHCLEQGVDAETVSHQKLTFE 67
           S    + +CP       +         + S GT  H  L   L +   A           
Sbjct: 703 SHISVYDECPSRYLYFKEYKFAPCEILHTSVGTLIHATLED-LNRFAIASRYDEITEVLI 761

Query: 68  NDT-----------------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP 110
                                         V       +      + + E  +E    E 
Sbjct: 762 KKWFALNYAKMQESTGLMLSEERRKSALGQVLNYFDKRKEHI-RKVWKAEEKVELVLPEY 820

Query: 111 GATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLY--ACGALHQYGDIFGRPEAL 168
              G  D++  +  +  IVD+K G   P   E + Q+  Y               +    
Sbjct: 821 ILQGVIDLIEDDDGKIEIVDYKTGR-KPDSPEKSAQVEHYRKQLEIYAYLISERYKKNVS 879

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
            + +       G+P+  +  S + + ++ ++  +        +       ++      SC
Sbjct: 880 RMHLYYTNEAEGNPLVTFEYSKNCVDKEIEDVSQTVRKIEGKRFDAKAENDY------SC 933

Query: 229 RFCRAKVRCPA 239
           R+C  K  C  
Sbjct: 934 RYCDMKYMCKK 944


>gi|111225411|ref|YP_716205.1| hypothetical protein FRAAL6067 [Frankia alni ACN14a]
 gi|111152943|emb|CAJ64691.1| hypothetical protein FRAAL6067 [Frankia alni ACN14a]
          Length = 269

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/251 (15%), Positives = 62/251 (24%), Gaps = 32/251 (12%)

Query: 9   ASSSHRWLKCPIAPT---LESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQK 63
            S    +  CP       L+   P     +A  S G   HN L    E+     T     
Sbjct: 10  PSRLAAFEDCPRRYRMIYLDRPRPPKGPPWAHTSFGVSVHNALRRWWEEPHQRRTPLRAA 69

Query: 64  LTFENDT-----------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGA 112
                             +         V   +  +   + P     E  +   T     
Sbjct: 70  ELLRLGWIDEGFRDPEQSQHWRERAVGMVRGYVEGLDPAAEPRGV--ERSVAARTEALAF 127

Query: 113 TGTADILIFNSTQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQYGDIFGRPEALTL 170
           +G  D L     + ++VD+K G        A  +  L LYA  A         R E   +
Sbjct: 128 SGRIDRLDDRDGELVVVDYKTGRRPVTDDDARTSRALALYALAAGRMLRQPCRRVELHHV 187

Query: 171 TIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE----HYGVNDD 226
                       +     + D +    +  +     A+          E           
Sbjct: 188 --------PSGRVAVAEHTEDSIARHVRRAESVAADAVEATEALRGGGEPDRAFPPRPGS 239

Query: 227 SCRFCRAKVRC 237
            C +C  +  C
Sbjct: 240 LCSWCDFRRLC 250


>gi|159036342|ref|YP_001535595.1| hypothetical protein Sare_0683 [Salinispora arenicola CNS-205]
 gi|157915177|gb|ABV96604.1| conserved hypothetical protein [Salinispora arenicola CNS-205]
          Length = 302

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 43/258 (16%), Positives = 68/258 (26%), Gaps = 32/258 (12%)

Query: 9   ASSSHRWLKCPIAPTLE---SKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQK 63
            S    +  CP            P     +A  S G   H  L +     VD    +   
Sbjct: 36  PSRLGAYADCPRRYRYSYVDRPAPSKGPPWAHNSLGASVHTALKNWYALPVDRRRSAALA 95

Query: 64  LTFENDT--------RIVDTEMASSVSMVLAYVRTFSGPFL-SETEVPLEPFTTEPGATG 114
              +                    ++  + +YV T          E  +   T      G
Sbjct: 96  TLLKGTWVRDGYRDPEQERAAFRRALGWLESYVATLDPETEPLGVERVVAVKTGVLAFNG 155

Query: 115 TADILIFNST----QWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFGRPEAL 168
            AD +         +  IVD+K G        A  +  L LYA  A   +     R E  
Sbjct: 156 RADRIDSRPGPAGAELAIVDYKTGRAGLDTDDARGSQALALYAYAAERVFRKPCRRVELH 215

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE----HYGVN 224
            L            I     S   L  +    +E     ++ +   A   +         
Sbjct: 216 HL--------PTGTIAAHEHSPQSLTRQVSRAEETARDIMAAERSVADGSDPDQAFPTAP 267

Query: 225 DDSCRFCRAKVRCPALSR 242
              C +C  +  CPA ++
Sbjct: 268 GPRCGWCDYRRTCPAGAQ 285


>gi|238060936|ref|ZP_04605645.1| UvrD/REP helicase [Micromonospora sp. ATCC 39149]
 gi|237882747|gb|EEP71575.1| UvrD/REP helicase [Micromonospora sp. ATCC 39149]
          Length = 1095

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 41/249 (16%), Positives = 65/249 (26%), Gaps = 22/249 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQ-TTSIYASEGTFAHN---LLAH-------CLE-QG 53
             ++ S     L+C +   LE        S     G   H    L           LE   
Sbjct: 833  RVTPSGMESALRCSLRWLLERHGGSGPASAAQGVGNLVHAAAMLAEDASADRSALLEYVA 892

Query: 54   VDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT 113
               + +           R     M   +   LA           E  V L+        T
Sbjct: 893  ARFDAIELAARWMVGPERERAEAMVDKLLRWLAGNPRRLLAIEHEFAVRLDDPHRPVELT 952

Query: 114  GTADILIFN-STQWIIVDFKYGAGVPVKAE---NNTQLMLYACGALHQYGDIFGRPEALT 169
            G  D L  +   + ++VD K G    V       + QL  Y   A+          E+  
Sbjct: 953  GRVDRLEVDADGRLVVVDLKTGKSTVVTEREIGEHPQLGAYQ-AAVEAGAFAEFGDESGG 1011

Query: 170  LTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCR 229
              ++Q          +   +A              T  +   +    +     V +  CR
Sbjct: 1012 AALVQLGTGARDAREQSQPAAGQGPAAG-----WATALVRRTADTMAAATFAAVANSKCR 1066

Query: 230  FCRAKVRCP 238
             C  +  CP
Sbjct: 1067 VCPVRTSCP 1075


>gi|209523273|ref|ZP_03271829.1| ATP-dependent nuclease subunit B-like protein [Arthrospira maxima
           CS-328]
 gi|209496424|gb|EDZ96723.1| ATP-dependent nuclease subunit B-like protein [Arthrospira maxima
           CS-328]
          Length = 883

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/275 (13%), Positives = 73/275 (26%), Gaps = 59/275 (21%)

Query: 6   FLSASSSHRWLKCPIAPT----LESKIPQTTSIY------ASEGTFAHNLLAHCLEQGVD 55
             SAS      +CP        L  K     S        +  G   H  L   L+  + 
Sbjct: 616 IFSASQLTALGQCPFKWFATYLLCLK---EPSEAEAEITGSLRGRLYHRCLEILLKD-IK 671

Query: 56  AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPF-------------------- 95
            +T   +    + +  +   E A      + + +                          
Sbjct: 672 TQTDLRRLDIQDINQALSQAEAALQAEENVNFDKFIGWEARRLEGLNMLELNLQAEDFLL 731

Query: 96  ----LSETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAEN-------N 144
               +   E   +            D +    T  +++D+K  +  P+  ++       N
Sbjct: 732 ANAEIISRENYFDAEWYGLKVIARVDRIDRTPTGLLVLDYKTTSSSPLGIKDDSGKAKIN 791

Query: 145 TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERG 204
            Q+ LY       + ++      + L  +  +    + + E  I    L   A+E K+R 
Sbjct: 792 IQMPLYQQAIAQNFNEVPEVD--VKLYSLNKQRYLKAKLTEPAI----LEAFAEEVKQRL 845

Query: 205 TLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA 239
                  +               C++C     C  
Sbjct: 846 QQGNYPVAPD--------QKQQVCQYCEFDSVCRK 872


>gi|148272376|ref|YP_001221937.1| putative ATP-dependent DNA helicase/nuclease [Clavibacter
            michiganensis subsp. michiganensis NCPPB 382]
 gi|147830306|emb|CAN01240.1| putative ATP-dependant DNA helicase/nuclease [Clavibacter
            michiganensis subsp. michiganensis NCPPB 382]
          Length = 1089

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 33/241 (13%), Positives = 64/241 (26%), Gaps = 21/241 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHC-------LEQGVDAET 58
             +S S    + + P+   ++     +TS     GT  H ++          L      E 
Sbjct: 835  PVSPSRLEAFERSPLNWFIDQASGGSTSTAMGIGTIVHAVMEEASLDPEADLRPAALEER 894

Query: 59   VSHQKLTFENDTRIVDTEMASSVSMVLA------YVRTFSGPFLSETEVPLEPFTTEPGA 112
            +  +      ++  V          ++A            G  +   E   E        
Sbjct: 895  LDERWGELPFESPWVGERERRQAGELIAGVSGYLRDFEARGGRMLAAEGGFELEVGVARL 954

Query: 113  TGTADILIFN-STQWIIVDFKYGAGVPVKA--ENNTQLMLYACGALHQ-YGDIFGRPEAL 168
             G  D +      Q +IVD K G   P +A    + QL  Y    +      +     + 
Sbjct: 955  RGKIDRIELTEEGQVVIVDLKTGRHFPTRAEIPAHAQLGSYQLAYVEGSLEQVPAGTPSG 1014

Query: 169  TLTIIQ----PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVN 224
               ++      R      + +  ++ ++L        E  T            L      
Sbjct: 1015 GAKLLYVSGGTRGLPYRELPQEPLTREELDGFRARIAEAATGMAGATFNGTPDLGERDPG 1074

Query: 225  D 225
             
Sbjct: 1075 S 1075


>gi|12657916|ref|NP_075329.1| gp62 [Mycobacterium phage Bxb1]
 gi|12584057|gb|AAG59767.1| gp62 [Mycobacterium phage Bxb1]
          Length = 295

 Score = 92.0 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/271 (12%), Positives = 68/271 (25%), Gaps = 61/271 (22%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYA--SEGTFAHNLLAHC---------------- 49
           S S   ++ KCP +  L           A   +GT  H +                    
Sbjct: 40  SVSQLSQFDKCPFSWKLARHERVWRRPAAWLQQGTGVHAVAEKYMLSKLAGSPLTREECY 99

Query: 50  --LEQGVDAETVSHQKLTFENDTRIVDTEMA-------------SSVSMVLAYVRTFSGP 94
              +           + T                            V  V+ ++ +    
Sbjct: 100 EIFKAEYADGINEATEETPNLGWWFASGRYRGQEDIERRWDIGLEQVDKVIDWIDSIPPD 159

Query: 95  FLS-------ETEVPLEPFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQL 147
            +          E+P+E         G  D+++    +  I D K G        ++ QL
Sbjct: 160 GVWHTPDGVPGVELPIEFELDGIEIRGYIDLVLKLGDEIRIRDLKTGLKPG----DDFQL 215

Query: 148 MLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISAD-DLLEKAKEFKERGTL 206
            +Y       YG             ++ R            +   DL +  +   E+ + 
Sbjct: 216 AVYGLALNEIYG-------------VEARTGDYWMAKTGKPTYPYDLTDWTR---EKISA 259

Query: 207 ALSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
                 ++  + +       SC  C   + C
Sbjct: 260 RFHEMERKLEAGDFTPKPGASCARCDVALSC 290


>gi|302869750|ref|YP_003838387.1| UvrD/REP helicase [Micromonospora aurantiaca ATCC 27029]
 gi|302572609|gb|ADL48811.1| UvrD/REP helicase [Micromonospora aurantiaca ATCC 27029]
          Length = 1134

 Score = 91.6 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 51/183 (27%), Gaps = 11/183 (6%)

Query: 24   LESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVSM 83
            L   +P   + YA  GT  H  L      G D      +     ++    D  +A     
Sbjct: 950  LRRPMPTEPNPYARRGTAFHAWLEQRF--GTDRLLDVDELPGAADEDAAPDEALAELQER 1007

Query: 84   VLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI-FNSTQWIIVDFKYGAGVPVKAE 142
             LA           E EVP           G  D +      ++ +VD+K G     +  
Sbjct: 1008 FLAGEWA--DRVPVEVEVPFATVIAGVVIRGRMDAVFARPGGRYDVVDWKTGRQPAGREA 1065

Query: 143  NNT--QLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEF 200
            +    QL +Y        G    R              + +     ++ A+ L       
Sbjct: 1066 DAAAVQLAVYRLAWAELAGVPVDRVG----AAFHYVRDSATVRPADLLDAEGLAALVAAV 1121

Query: 201  KER 203
             E 
Sbjct: 1122 PEI 1124


>gi|258652891|ref|YP_003202047.1| hypothetical protein Namu_2712 [Nakamurella multipartita DSM 44233]
 gi|258556116|gb|ACV79058.1| hypothetical protein Namu_2712 [Nakamurella multipartita DSM 44233]
          Length = 543

 Score = 91.6 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/261 (14%), Positives = 68/261 (26%), Gaps = 43/261 (16%)

Query: 18  CPIAPTLESKIP-----QTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK--------- 63
           C      E  +      +     A  GT AH ++   ++      T    +         
Sbjct: 49  CAARYVGERVLRMGVESEDPFAPAPVGTVAHTVMERLMQLARTKRTPLAARRIMYQLMVD 108

Query: 64  ---LTFENDTR----IVDTEMASSVSMVLAYVRTFSGPFLSET---EVPLE-PFTTEPGA 112
                 +            E  + V      +     P        E+ L+  F      
Sbjct: 109 LTSPNPDKHWPGLPVERTPEWLALVDSAFMGLFGIVDPRKIVVHKTELRLDDVFIGGVPF 168

Query: 113 TGTADIL----IFNSTQWIIVDFKYGAGVPVKAE-----NNTQLMLYACGALHQYGDIFG 163
            G  D++      +     IVD+K GA +P         ++ Q+ +Y  G   + G    
Sbjct: 169 KGFIDMVSQAEDDDGRWLEIVDYKTGARLPYTPFGAVNDHHDQIRMYRIGLAQKLGSDKR 228

Query: 164 RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
              ++  T         +      +   DL    + F      A    +  A        
Sbjct: 229 FRGSVYYT-----RDKLAKSVRVPMRGPDLDATTRRF----QSAWRRMNSYADDAAWPAK 279

Query: 224 NDDSCRFCRAKVRCPALSRHV 244
               C +C     CP  +R  
Sbjct: 280 ATPLCGWCPLVATCPTAARER 300


>gi|158341554|ref|YP_001522718.1| hypothetical protein AM1_H0054 [Acaryochloris marina MBIC11017]
 gi|158311795|gb|ABW33404.1| hypothetical protein AM1_H0054 [Acaryochloris marina MBIC11017]
          Length = 262

 Score = 91.6 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/274 (16%), Positives = 77/274 (28%), Gaps = 38/274 (13%)

Query: 7   LSASSSHRWLKCPIAP--TLESKIPQTT---SIYASEGTFAHNLLAHCLEQGVDAETVSH 61
           LSA+    + +CP +     E K+P  T   S     G   H  LA+  +    A     
Sbjct: 5   LSATKLKTYGQCPKSYQFRYEHKLPSPTIFGST--KLGNALHAALANVYKDWNYA-YPLP 61

Query: 62  QKLTFENDTRIVDTEM------------ASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE 109
               F    +   +E+                   +A +     P   ET+V        
Sbjct: 62  SLDWFAVCWQHHTSELTPTQIHEGWAALQLYYERYIAPLPQIRKPLGIETKVRATLQVRN 121

Query: 110 PG--ATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEA 167
                +G  D L +      ++D+K    V      + QL  Y       Y     R   
Sbjct: 122 IEFTLSGRYDRLDYIDDGLELIDYKTSKSVNPPPSVDIQLGFYYLILEQIYKKALKRLSL 181

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
           + L          +    + ++ D   +     ++                E   V    
Sbjct: 182 IYLR--------SNEKLIYEVTPDHHQQAQSLIEDMAMKL-------RCDQEWKPVAGQH 226

Query: 228 CRFCRAKVRCPALSRHVLLEATKDPSTNTTVELS 261
           C  C  +  CPA +         +    T V+L+
Sbjct: 227 CDRCGYQKYCPAKNTRPEPLPQ-EAKEVTQVQLA 259


>gi|258406097|ref|YP_003198839.1| putative DNA repair protein [Desulfohalobium retbaense DSM 5692]
 gi|257798324|gb|ACV69261.1| putative DNA repair protein [Desulfohalobium retbaense DSM 5692]
          Length = 913

 Score = 91.6 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/265 (13%), Positives = 61/265 (23%), Gaps = 44/265 (16%)

Query: 18  CP----IAPTLESKI---PQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFE--- 67
           CP        L++     P+        G   H  L     +    E +           
Sbjct: 631 CPFQAFGRFRLQAAAVRPPEPGITALERGNLVHKALETFWAEMQTRERLQGASAETIAAT 690

Query: 68  ----------------------NDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEP 105
                                     + +  +   +    A     +   + E E  +E 
Sbjct: 691 ARKGAQKGVEQLAERRPMTLTGRHRELEEDRLTRLLEQWAARELERTPFAVVEREHRVEA 750

Query: 106 FTTEPGATGTADILIF-NSTQWIIVDFKYGAGVPVKAEN----NTQLMLYACGAL-HQYG 159
                      D +   +  +  +VD+K G               QL LYA  A     G
Sbjct: 751 SFAGARLRIVCDRVDRLDDGRLAVVDYKTGEIRVSDWFAPRLLEPQLPLYALLAETEVAG 810

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISA----DDLLEKAKEFKERGTLALSLKSKRA 215
               R +   L            +      +     + L   +  +    L   L S+  
Sbjct: 811 IFVARIKTGHLEYAGVVGDDQVHLRCRACESMKANAEGLTWQELLEVWRGLLTQLVSEYM 870

Query: 216 VSLEHYGV--NDDSCRFCRAKVRCP 238
                        SCRFC  +  C 
Sbjct: 871 RGECAVAPVEEKRSCRFCDLRSLCR 895


>gi|315503768|ref|YP_004082655.1| uvrd/rep helicase [Micromonospora sp. L5]
 gi|315410387|gb|ADU08504.1| UvrD/REP helicase [Micromonospora sp. L5]
          Length = 1134

 Score = 91.6 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 51/183 (27%), Gaps = 11/183 (6%)

Query: 24   LESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVSM 83
            L   +P   + YA  GT  H  L      G D      +     ++    D  +A     
Sbjct: 950  LRRPMPTEPNPYARRGTAFHAWLEQRF--GTDRLLDVDELPGAADEDAAPDEALAELQER 1007

Query: 84   VLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI-FNSTQWIIVDFKYGAGVPVKAE 142
             LA           E EVP           G  D +      ++ +VD+K G     +  
Sbjct: 1008 FLAGEWA--DRVPVEVEVPFATVIAGVVIRGRMDAVFARPGGRYDVVDWKTGRQPAGREA 1065

Query: 143  NNT--QLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEF 200
            +    QL +Y        G    R              + +     ++ A+ L       
Sbjct: 1066 DAAAVQLAVYRLAWAELAGVPVDRVG----AAFHYVRDSATVRPADLLDAEGLAALVAAV 1121

Query: 201  KER 203
             E 
Sbjct: 1122 PEI 1124


>gi|88856785|ref|ZP_01131439.1| ATP-dependent DNA helicase [marine actinobacterium PHSC20C1]
 gi|88813953|gb|EAR23821.1| ATP-dependent DNA helicase [marine actinobacterium PHSC20C1]
          Length = 1033

 Score = 91.6 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/240 (12%), Positives = 66/240 (27%), Gaps = 25/240 (10%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLA---HCLEQGVDAETVSHQ 62
             +S S    +  CP+   ++     T++  ++ GT  H +         + +        
Sbjct: 782  RVSPSRMESFESCPLHWAIDQLGGSTSNTASNLGTLIHGVAETATDFNAEALFKAVEDRW 841

Query: 63   KLTFENDTRIVDTEMASSVSMVLAYV-----RTFSGPFLSETEVPLEPFTTEPGATGTAD 117
                   +   + E   +  +           T +G  L   E+       +   +G  D
Sbjct: 842  SEMSFEASWQSEAEKLRAKKLTQHLATYLRDFTANGGELISNEMGFTLPLEQALLSGKID 901

Query: 118  ILIFNST-QWIIVDFKYGAGVPVKAE---NNTQLMLYACG-ALHQYGDIFGRPEALTLTI 172
             +        +IVD K G   P   +   ++ QL  Y    A      +    E     +
Sbjct: 902  RVEMYGGTTAVIVDLKTGKNEPSTDKAVADHPQLAAYQLAFASGAVEGVPEGLENGGAKL 961

Query: 173  IQ----PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSC 228
            +      + R      +  ++ ++L    +   E          +              C
Sbjct: 962  VVLSPSAKTRDYVDPKQQPMNDEELELFRQRVIEDA--------RGMAGSVFVARVSSHC 1013


>gi|229175134|ref|ZP_04302650.1| UvrD/REP helicase [Bacillus cereus MM3]
 gi|228608270|gb|EEK65576.1| UvrD/REP helicase [Bacillus cereus MM3]
          Length = 957

 Score = 91.6 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/254 (12%), Positives = 61/254 (24%), Gaps = 38/254 (14%)

Query: 10  SSSHRWLKCPIAPTLESKI---PQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTF 66
           S  + +  C +      ++   P         GT  H  +    +  +  E     +   
Sbjct: 714 SHINLFETCALQYKFYKELGFAPVRQG-ATIFGTLVHQTIEDIHKSALKNEAYLITEENI 772

Query: 67  ENDT----------------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP 110
           E+                            V   +         ++ E EV +     + 
Sbjct: 773 EDWFNTNYQHLSKRERVYLAPQTQEAALKQVKSYVEKQNG-DWSYIQEAEVDVSLVKDKY 831

Query: 111 GATGTADILIFNSTQWIIVDFKYGAGV------PVKAENNTQLMLYACGALHQYGDIFGR 164
              GT D++  +     IVDFK                   QL +YA     +       
Sbjct: 832 ILKGTIDLVKGDGDTVEIVDFKSEKKPDLVKEQDALYRYKRQLEVYAHLVEERTNY---- 887

Query: 165 PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVN 224
            +   + +     + G+P   +      + +  K F        S               
Sbjct: 888 -KVSKMHLYYTGEKDGNPYVTFKKDKSVINQTIKSFDRIVDRIESH------DYTIKQRP 940

Query: 225 DDSCRFCRAKVRCP 238
              C  C  +  C 
Sbjct: 941 KKHCGNCDMRFYCD 954


>gi|256396909|ref|YP_003118473.1| UvrD/REP helicase [Catenulispora acidiphila DSM 44928]
 gi|256363135|gb|ACU76632.1| UvrD/REP helicase [Catenulispora acidiphila DSM 44928]
          Length = 1134

 Score = 91.6 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/269 (14%), Positives = 70/269 (26%), Gaps = 31/269 (11%)

Query: 6    FLSASSSHRWLKCPIAPTL--ESKIPQTTSIYASEGTFAHNLLAHCLEQ----------G 53
             LSAS      +C +   L  E+   +  ++    G   H L     +            
Sbjct: 870  LLSASQVAAIDECSLRWFLDHEAAAHEQKTVALGFGNVVHVLADEVAKGDTPARLDVLME 929

Query: 54   VDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEP-------- 105
                         +  +     E  +++   LA+  T  G  L  +E   +         
Sbjct: 930  RLDRVWDRLSFEAQWQSPQQKEEARAALERFLAWHVTDRGRLLHSSEQEFDVRLNVGAGD 989

Query: 106  ----FTTEPGATGTADILIFNS-TQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQY 158
                   +    G+ D +  +      +VDFK G  VP   +A+ + QL +Y        
Sbjct: 990  SEDGEGFDLRIRGSFDRVETDEAGLVYVVDFKTGKNVPTKNEAQEHPQLAVYQLVVREGA 1049

Query: 159  GDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSL 218
                         +                    L    +   E+    +   + R +  
Sbjct: 1050 IQGVSNESGGAELVFLREGDAAGLPKTAEQDPS-LELPGETPIEKKLATM---AARVLDE 1105

Query: 219  EHYGVNDDSCRFCRAKVRCPALSRHVLLE 247
                  +  C  C  +  CP       L 
Sbjct: 1106 NFAAYGEKQCGTCVFRKCCPKQPEGKQLL 1134


>gi|257075423|ref|ZP_05569784.1| UvrD/REP helicase [Ferroplasma acidarmanus fer1]
          Length = 924

 Score = 91.6 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 52/254 (20%), Positives = 75/254 (29%), Gaps = 35/254 (13%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYASEG--TFAHNLLAHCLEQGVDAETVSH---- 61
           S S    +L+CP    L +       + A  G  T  HN+L       +  E V      
Sbjct: 686 SYSELTSYLRCPNDFLLRNVYGYNAGVPAGFGYGTNIHNVLNMIHRDYIRNEKVPDMDEV 745

Query: 62  -----QKLTFENDTRIVDTEMASSVSMVLA-YVRTFSGPF--LSETEVPLEPFTTEPGAT 113
                +       T  +   M  +   V+  YV   S  F  + ETE   E    E    
Sbjct: 746 VAMVDRMFHLRYATDAMSDNMKKAAERVVRSYVAEHSKDFSRILETEKRFEFVLGEALIA 805

Query: 114 GTADILIFNS-----TQWIIVDFKYGAGVPVK-AENNTQLMLYACGALHQYGDIFGRPEA 167
           G  D+L   +      +  I+DFK      V  A+ + QL  YA   L        +   
Sbjct: 806 GQIDLLKKTNPDGSLKEVEIIDFKTEKIDGVYSADYDRQLRYYALACLKSLNLKPQKAIV 865

Query: 168 LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
             L            I +  IS  +L +   E  +     L  K                
Sbjct: 866 HHL--------DDDSITQVDISDVELTKTVAEVGKTVDNILKKK-------FPPSPESKK 910

Query: 228 CRFCRAKVRCPALS 241
           C  C  +  C   S
Sbjct: 911 CDGCDYRKLCSYRS 924


>gi|317508165|ref|ZP_07965848.1| hypothetical protein HMPREF9336_02220 [Segniliparus rugosus ATCC
           BAA-974]
 gi|316253576|gb|EFV12963.1| hypothetical protein HMPREF9336_02220 [Segniliparus rugosus ATCC
           BAA-974]
          Length = 265

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 47/281 (16%), Positives = 68/281 (24%), Gaps = 61/281 (21%)

Query: 1   MAHHA---FLSASSSHRWLKCPIAPTLESKIPQTTSIYASE--GTFAHNLLAHC------ 49
           M  HA    LS S    + +CP +  L           A    G+  H            
Sbjct: 1   MT-HAAKRTLSVSQYKTYERCPYSWYLSRVEKAWQRPAAWLPQGSAVHEAAEAYERSGRT 59

Query: 50  --LEQGVDAETVSHQKLTFE--------------------NDTRIVDTEMASSVSMVLAY 87
             L+Q  D    S+ +   E                     D           V   L Y
Sbjct: 60  LTLDQAQDVYRESYARHVGEYCEITPNFNWWFRSGSYGGKEDLERRFKLGLEQVGRYLDY 119

Query: 88  VRTFSGPFLS-------ETEVPLEPFTTEPGATGTADILIFN--STQWIIVDFKYGAGVP 138
             T     +          E+            G  D +I N    + ++ D K G    
Sbjct: 120 YETHPAEVIWIAPDGTPGIELEFNIDLDGVAVRGFIDAVIPNGCGDEVLVRDNKTGNSPG 179

Query: 139 VKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAK 198
               ++ QL  Y      Q+G      +           RTG P   + IS   +    +
Sbjct: 180 ----DDFQLGTYGVALSEQFGVFAPVGD-------YWMGRTGKPTKAYDISKWTVERVTE 228

Query: 199 EFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPA 239
           EF                  +        C FC     C  
Sbjct: 229 EFHRLADN----IEAERFDPDPEP---SKCMFCDVAYSCDY 262


>gi|115379646|ref|ZP_01466729.1| hypothetical protein STIAU_7080 [Stigmatella aurantiaca DW4/3-1]
 gi|115363356|gb|EAU62508.1| hypothetical protein STIAU_7080 [Stigmatella aurantiaca DW4/3-1]
          Length = 355

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/258 (12%), Positives = 70/258 (27%), Gaps = 31/258 (12%)

Query: 38  EGTFAHNLLAHCLEQGVDAE-----TVSHQKLTFENDTRI-------VDTEMASSVSMVL 85
            G   H +L   L++ +D E     +       +             +  +    +   +
Sbjct: 6   FGKALHAVLERLLQEVIDTEYAGALSEERALQLYREAWAASGLSGLDLFQQGLGILQDFV 65

Query: 86  AYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI-FNSTQWIIVDFKYGAG--VPVKAE 142
                     +   E             G  D +   +     ++D+K         + +
Sbjct: 66  RQQGRVDSRDILAVEKEFRLPVGPFTVLGFIDRVDWVDEETIAVIDYKSNHQLFTREELD 125

Query: 143 NNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKE 202
           ++ QL LYA  A   +       + + L++   R              D  L   +   +
Sbjct: 126 SSLQLSLYALAARRMWPW----AKKVRLSMWMLRHGVRQETTRTEEQLDAALAYVETLGQ 181

Query: 203 RGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSK 262
           +   A                 + +C +C  +  CPA ++   LE  +D     T +L  
Sbjct: 182 QMEKA----------ESFPARLNPNCVYCDHRRNCPAYAQA--LEGQRDVVCEDTSDLES 229

Query: 263 AYSSISLIKSYVKACEDE 280
                  +    K     
Sbjct: 230 VARERQEVAHLAKILGAR 247


>gi|229149252|ref|ZP_04277491.1| UvrD/REP helicase [Bacillus cereus m1550]
 gi|228634224|gb|EEK90814.1| UvrD/REP helicase [Bacillus cereus m1550]
          Length = 957

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/254 (12%), Positives = 59/254 (23%), Gaps = 38/254 (14%)

Query: 10  SSSHRWLKCPIAPTLESKI---PQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTF 66
           S  + +  C +      ++   P         GT  H  +    +  +  E     +   
Sbjct: 714 SHINLFETCSLQYKFYKELGFAPVRQG-ATIFGTLVHQTIEDIHKSALKNEAYLITEANI 772

Query: 67  ENDT----------------RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP 110
           E+                            V   +          + E EV +     + 
Sbjct: 773 EDWFNTNYRHLSKRERVYLAPQTQEAALKQVKSYVEKQYG-DWSHIQEAEVDVSLVKDKY 831

Query: 111 GATGTADILIFNSTQWIIVDFKYGAGV------PVKAENNTQLMLYACGALHQYGDIFGR 164
              GT D++  +     IVDFK                   QL +YA     +       
Sbjct: 832 ILKGTIDLVKGDGDTVEIVDFKSEKKPDLVKEQDALYRYKRQLEVYAHLVEERTNY---- 887

Query: 165 PEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVN 224
            +   + +     +  +P   +      + +  K F        S               
Sbjct: 888 -KVSKMHLYYTGEKDSNPYVTFEKDTSVINQTIKSFDRIVDRIESH------DYTIKQRP 940

Query: 225 DDSCRFCRAKVRCP 238
              C  C  +  C 
Sbjct: 941 KKHCGNCDMRFYCD 954


>gi|86742479|ref|YP_482879.1| UvrD/REP helicase [Frankia sp. CcI3]
 gi|86569341|gb|ABD13150.1| UvrD/REP helicase [Frankia sp. CcI3]
          Length = 1103

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 39/266 (14%), Positives = 67/266 (25%), Gaps = 40/266 (15%)

Query: 17   KCPIAPTLE--SKIPQTTSIYASEGTFAHNLLAHCLEQ-------GVDAETVSHQKLTFE 67
             C +   LE  +      S     G   H L               +DA   +  +    
Sbjct: 832  ACSLRWFLEHEAYAVTPASTAQGFGKVVHALADEVTTGRTPADLAALDARLDTVWRQLDF 891

Query: 68   NDTRIVDTEMASSVSM---VLAYVRTFSGPFLSETEVPLEPFTT----EPGATGTADILI 120
            +     D E A++       L +     G  + + EV           +    G  D L 
Sbjct: 892  DARWRSDQERAAAREALARFLDWHAAERGRRVIDAEVRFSCDLRVAGRDVQLRGFIDRLE 951

Query: 121  FNS-TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGD----------------- 160
             +   +  ++DFK G     P +   + QL  Y         D                 
Sbjct: 952  LDEAGRVHVIDFKTGRTAVAPAELATHPQLGSYQLAVRAGALDDVLAAAAPDQPGADQPR 1011

Query: 161  -IFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKE---FKERGTLALSLKSKRAV 216
             + G  E + L         G  +        ++  ++             L    +   
Sbjct: 1012 AVPGGAELVQLRRDAGAAAAGPRLPGERPGPPEVQAQSALPPHGATWMDEVLDAAVRTID 1071

Query: 217  SLEHYGVNDDSCRFCRAKVRCPALSR 242
            +        D C  C  +  CPA   
Sbjct: 1072 AEAFRPTPGDHCTLCTFQTSCPARPE 1097


>gi|76803478|ref|YP_327747.1| hypothetical protein NP6244A [Natronomonas pharaonis DSM 2160]
 gi|76559293|emb|CAI50902.2| conserved hypothetical protein [Natronomonas pharaonis DSM 2160]
          Length = 307

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/243 (14%), Positives = 72/243 (29%), Gaps = 28/243 (11%)

Query: 8   SASSSHRWLKCPIAPTLES---KIPQ--------TTSIYAS-EGTFAHNLLAHCLEQGVD 55
           S +S   + +CP    LE      P            +     G   H+     + QGV+
Sbjct: 64  SYTSLAAYEECPRNHYLEYVVNAFPDYQETTSNTGDGVSQRTIGLLFHDTAEQAVNQGVE 123

Query: 56  AETVSHQKLTFENDTRIVDTEMASSVSMVLAYVR-TFSGPFLSETEVPLEPFTTEPGATG 114
                +         R  +  + ++   +  Y         + + E   E         G
Sbjct: 124 RREEWYGICERLASQRRAEDALPAARQCIDRYFELDLPSYEIIDAEREFELDIDGHELVG 183

Query: 115 TADILIFN-STQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTII 173
             D +      + +++D+K         E+N QL +Y       Y       E +T    
Sbjct: 184 YIDAVYRTPDDELLVIDYKATERHRDL-EDNKQLPIYLLACRDLYD------EPVTRAGY 236

Query: 174 QPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRA 233
                 G  +     S  DL       ++  T +++  ++ +          + C++C+ 
Sbjct: 237 AYVGEIGPKVEARTFSDGDLAA----VRDDVTASMTRIAEFSFG---RYTAGEHCQWCQH 289

Query: 234 KVR 236
              
Sbjct: 290 NQL 292


>gi|212702576|ref|ZP_03310704.1| hypothetical protein DESPIG_00600 [Desulfovibrio piger ATCC 29098]
 gi|212674017|gb|EEB34500.1| hypothetical protein DESPIG_00600 [Desulfovibrio piger ATCC 29098]
          Length = 993

 Score = 90.5 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 44/294 (14%), Positives = 84/294 (28%), Gaps = 59/294 (20%)

Query: 5   AFLSASSSHRWLKCPIAP------TLESKIP-QTTSIYASEGTFAHNLLAHCLE----QG 53
           A +S ++   +L+CP++                     A  G+  H++L         + 
Sbjct: 700 APISPTALDTYLRCPLSFVWKHLCRFRPVQEVNEKDDPAEVGSVLHDVLQQLYRPYRGKP 759

Query: 54  VDAETVSHQKLTFENDTRIVDTEMASSV-------------SMVLAYVRTFSGPFLSETE 100
           V A T     +  E   +I   ++ + +               +  Y+       + E E
Sbjct: 760 VGAGTFDMAVMRAELQHQIEKHDLRTQLPPDSLMMFSMAAPRRLEEYLCNQPAATILELE 819

Query: 101 VPLEPFTT----EPGATGTADILIFNSTQWIIVDFKYGA-GVPVKAENNTQLMLYACG-- 153
            PL         E    G  D L        IVD+K G    P  A  + + +       
Sbjct: 820 YPLTQVIRCNGREYTFKGRLDRLDRREDGLCIVDYKTGIINSPAGALWDDEALFLQMAQV 879

Query: 154 -------------ALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKE- 199
                        A   +  +  +   + L      +           +  +L +K +E 
Sbjct: 880 RDARLPLEDRRRLAAVVFDQLAEKLRMIQLPAYLCMLHAAGFTELHDAALVELRDKGREY 939

Query: 200 --FKERGTLALSLKSKRAV------------SLEHYGVNDDSCRFCRAKVRCPA 239
             F  R  L    + ++                +  G   + CR+C  +  C A
Sbjct: 940 WLFGPRLDLDNDERIRQCFDVLSLLLWHMEHGPDFTGRPGEGCRWCDYQALCHA 993


>gi|289640616|ref|ZP_06472788.1| UvrD/REP helicase [Frankia symbiont of Datisca glomerata]
 gi|289509505|gb|EFD30432.1| UvrD/REP helicase [Frankia symbiont of Datisca glomerata]
          Length = 1162

 Score = 90.5 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 43/293 (14%), Positives = 65/293 (22%), Gaps = 56/293 (19%)

Query: 6    FLSASSSHRWLKCPIAPTLE-SKIPQTTSIY-ASEGTFAHNLLAHCL--EQGVDAETVSH 61
             LS SS    + CP    LE     Q TS      G   H L           D   +  
Sbjct: 864  RLSGSSLSGLVTCPTRWFLEHEAHAQGTSNAEMGFGKVVHALADEVATGRTPPDLGALDT 923

Query: 62   QKLTFEND---TRIVDTE-----MASSVSMVLAYVRTFSGPFLSETEVPLEPFTTE---- 109
            +               +E        +++  L +     G  L  +EVP           
Sbjct: 924  RLDRVWRHLGYEAQWRSEQQRAAARQALARFLVWHAAARGRRLVASEVPFSCDLAVGGRT 983

Query: 110  PGATGTADILIFNS-TQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQY-------- 158
                G  D +  +   +  +VDFK G   P       + QL +Y                
Sbjct: 984  VRLRGFVDRIELDDAGRVHVVDFKTGRTAPSGTDVARHPQLGIYQLAVRGGAVASAGPGS 1043

Query: 159  GDIFGRPEALTLTIIQPRVRT-----------------------------GSPINEWVIS 189
            G   G  E + L +                                        +     
Sbjct: 1044 GAEPGGAELVHLRLDAGPDPAPDDPPSDATGPDVTGPNATKAGAAGAGATDGRRSARAPK 1103

Query: 190  ADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSR 242
                     +        L    +   +          C  C  +  CPA   
Sbjct: 1104 VQRQPALPPDGPTWMDDLLVDAVELIAAERFPPRPGPDCSMCAFRRCCPAQDD 1156


>gi|111023339|ref|YP_706311.1| ATP-dependent DNA helicase [Rhodococcus jostii RHA1]
 gi|110822869|gb|ABG98153.1| probable ATP-dependent DNA helicase [Rhodococcus jostii RHA1]
          Length = 1115

 Score = 90.5 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/217 (17%), Positives = 60/217 (27%), Gaps = 17/217 (7%)

Query: 7    LSASSSHRWLKCP--IAPTLESKIPQTTSIYASEGTFAHNLLAHCL--EQGVDAETVSHQ 62
            LS S        P  +A  L   +P   +  A  GT  H  +       + +D + +   
Sbjct: 908  LSVSQLVELEADPDALAARLRRPLPFPPNPLARRGTAFHAWVERRFGATRLLDLDELPGA 967

Query: 63   KLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
              T        DT++A+     L        P  +E EVP E         G  D +  +
Sbjct: 968  ADTDAGP----DTDLATLQDAFLRSSWADRNP--TEVEVPFETSVAGTVLRGRIDAVFTD 1021

Query: 123  -STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRT 179
                W ++D+K GA      +     QL  Y             R               
Sbjct: 1022 PDGGWTVIDWKTGAEPSAANEKAVVMQLAAYRLAWAELMDVPIERVR----AAFHYVRTG 1077

Query: 180  GSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAV 216
             +   + +  AD L    +                A 
Sbjct: 1078 RTIAPDHLPDADALARLLRSAGSPDEEIRPDAEPSAT 1114


>gi|309810384|ref|ZP_07704218.1| UvrD/REP helicase [Dermacoccus sp. Ellin185]
 gi|308435624|gb|EFP59422.1| UvrD/REP helicase [Dermacoccus sp. Ellin185]
          Length = 1176

 Score = 90.5 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 53/175 (30%), Gaps = 9/175 (5%)

Query: 23   TLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVS 82
             L   +P   ++ A  GT  H  +            V   +L    D  +   EM   + 
Sbjct: 1003 RLRRPMPSEPAVAARRGTAFHAWVERHYGAAA---LVDLDELPGFGDEDVAADEMLPVLQ 1059

Query: 83   MVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI-FNSTQWIIVDFKYGAGV--PV 139
                    ++     + EV LE         G  D +   +   + +VD+K GA    P 
Sbjct: 1060 TNF-LASEWADRVPVDVEVALETVVAGYAVRGRIDAVFARDGGGFTVVDWKTGAKPAGPT 1118

Query: 140  KAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLL 194
                + QL  YA G     G      +A           T  P        ++LL
Sbjct: 1119 LRHRSLQLAAYALGYARLRGLDPEDVDA--AFFYAATGETYRPDVASQRDLEELL 1171


>gi|84494608|ref|ZP_00993727.1| putative DNA helicase [Janibacter sp. HTCC2649]
 gi|84384101|gb|EAP99981.1| putative DNA helicase [Janibacter sp. HTCC2649]
          Length = 1103

 Score = 90.5 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/194 (19%), Positives = 54/194 (27%), Gaps = 12/194 (6%)

Query: 7    LSASSSHRWLKCPIAPT--LESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
            LS SS   +   P      L   +P   +  A  GT  H  +     +    +       
Sbjct: 910  LSTSSLVAFATDPERFAAELRRPMPSAPAQAARRGTAFHAWIEEHYARAAIVDLFD--LP 967

Query: 65   TFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADIL--IFN 122
               ++  + D E+ +     L        P   E E  LE         G  D +     
Sbjct: 968  GSADEDPMGDAELPAMRERFLESPWAAREP--IEIETALETVVDGVAIRGRIDAVFADVE 1025

Query: 123  STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTG 180
             + W+IVD+K G      V      QL  Y        G    R              T 
Sbjct: 1026 GSDWVIVDWKTGRKPSGEVARMRALQLAAYRIAWARLRGVDPQRVSGG--FYYAGTGETV 1083

Query: 181  SPINEWVISADDLL 194
             P+        DLL
Sbjct: 1084 WPVLADEAEISDLL 1097


>gi|327493582|gb|AEA86441.1| putative RecB family exonuclease [Campylobacter phage NCTC12673]
          Length = 243

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 37/244 (15%), Positives = 69/244 (28%), Gaps = 29/244 (11%)

Query: 8   SASSSHRWLKCPIAPTLESKIP---QTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
           S S    + +C +                    +G++ H L+    ++     + S+   
Sbjct: 6   SYSRLECFRQCKLKFKYSYIDKISIPKDQTALIKGSYIHWLIEQSFKEEPIEVSKSYHNP 65

Query: 65  TFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTT---------EPGATGT 115
               D      E+           +          EV     +          +    GT
Sbjct: 66  LINADQYKEYNEIFEKFKE-TEKYKNIKDLPALGNEVNWALDSKLNPTNYYGNDYVIRGT 124

Query: 116 ADILIFNSTQWIIVDFKYGAGV-PVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQ 174
            D +   +   II+D+K G         +  QL LYA  A             +   I Q
Sbjct: 125 IDYIAIKNRCAIIIDWKTGKTKDKKYIPDANQLALYAIWAEKVLN--------VDKIICQ 176

Query: 175 PRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAK 234
                 +  + +  ++DDL+   K+F +      + K+               C +C  K
Sbjct: 177 FVYVETNDFHTYTYTSDDLVPLKKQFAQDIMSIENEKA-------FIANPGILCNWCEFK 229

Query: 235 VRCP 238
             C 
Sbjct: 230 SMCD 233


>gi|269838113|ref|YP_003320341.1| ATP-dependent nuclease subunit B-like protein [Sphaerobacter
            thermophilus DSM 20745]
 gi|269787376|gb|ACZ39519.1| ATP-dependent nuclease subunit B-like protein [Sphaerobacter
            thermophilus DSM 20745]
          Length = 1066

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 43/321 (13%), Positives = 78/321 (24%), Gaps = 70/321 (21%)

Query: 7    LSASSSHRWLKCPIAPTLE-----SKIPQTTS----IYASEGTFAHNLLAHCLEQGVDAE 57
            +S S    +  CP    L        + +            G   H++L   L +    +
Sbjct: 751  ISPSRLETYATCPFRFFLSYLLRLEPVEEPDLLERIESLERGALVHDVLQRFLTECGAND 810

Query: 58   TVSH-------QKLTFENDTRIVDTE---MASSVSMVLAYVRTFSGPFLSET-------- 99
              S         +L    +    D E   +     +     R      ++          
Sbjct: 811  PPSRVRREAHLARLRAIAEEECADREQRGLVGYPLLWQVDRRAILEDLITWYDREVAERD 870

Query: 100  -----------------------------EVPLEPFTTEPGATGTADILIFNSTQ--WII 128
                                          VPL+         G  D + ++  +  + +
Sbjct: 871  DALRPGAFELRFGPKWTHDREDSPLSTDDPVPLQADGLTLRFQGRIDRIDWSPDRSAFRV 930

Query: 129  VDFKYGAGVPVKAENNT------QLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSP 182
            VD+K G       ++        QL +Y   A H  G  + R E          V     
Sbjct: 931  VDYKTGKCPGHHKDDRLAGGRALQLPIYLLAASHVLGIPWERGE-----AEYFYVTRRGE 985

Query: 183  INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSR 242
                  S   L ++ +EF           +         G + + C +C     C     
Sbjct: 986  FKRVRFSGATLRDRWEEFTALVQGLAEGIAAGRFHPV-PGPSREHCTYCDYSTVCDIRIA 1044

Query: 243  HVLLEATKDPSTNTTVELSKA 263
             +      DP       L + 
Sbjct: 1045 RLAERKAADPRAADFARLGEV 1065


>gi|38233329|ref|NP_939096.1| putative helicase [Corynebacterium diphtheriae NCTC 13129]
 gi|38199589|emb|CAE49245.1| Putative helicase [Corynebacterium diphtheriae]
          Length = 1076

 Score = 90.1 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 54/176 (30%), Gaps = 14/176 (7%)

Query: 23   TLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVS 82
                 +P   + YA  GT  H  L +       AE +  +         + D+++     
Sbjct: 904  RRRRPVPFKPNSYAKRGTAFHEWLENRF----GAEALLDETELPGIGEELDDSDLDRLKE 959

Query: 83   MVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN-STQWIIVDFKYGAGVPVKA 141
              L        P     E P E         G  D +  N   +WI+VD+K G       
Sbjct: 960  AFLDSEWADRTPEHV--EHPFEVSIGRHIVRGRMDAVFKNSDGRWIVVDWKTGQPPTDNH 1017

Query: 142  ENN---TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLL 194
            E      QL +Y        G    R +A+         R  +   + +   ++L 
Sbjct: 1018 EKESVAMQLAVYRLAWARLQGIDVDRVDAV----FHYVGRNVTYRPQQLPDGEELA 1069


>gi|284794839|gb|ADB93765.1| gp72 [Mycobacterium phage RedRock]
          Length = 302

 Score = 90.1 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 69/301 (22%), Gaps = 83/301 (27%)

Query: 8   SASSSHRWLKCPIAPTLESKIPQTTSIYASE--GTFAHNLLAHCLEQGVDAETVSHQ--- 62
           S S  +++ +CP++  L           A    GT  H +     +   +   +S +   
Sbjct: 12  SVSQINQYTRCPMSYKLARIDKVWARPAAWLPQGTAFHTVAEVYEKALAEGREMSLERAQ 71

Query: 63  ---KLTFENDTRIVDTEMA-------------------------SSVSMVLAYVRT---- 90
              K  +  D   +  E                             V   +A+  T    
Sbjct: 72  EIFKEEYAKDINALAEETPNFDWWFHSGPYNGERDIARRFHIGLEQVEKFIAWRTTKGQQ 131

Query: 91  -----------------------------FSGPFLSETEVPLEPFTTEP----GATGTAD 117
                                           P     E+        P       G  D
Sbjct: 132 VWIAPAVVDPRCGADEAQSPLTDTHVKDCLCRPAEPAIELSFSIVLDTPLGPIRVRGYID 191

Query: 118 ILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRV 177
            ++  + +  + D+K G        ++ QL +YA     +YG                  
Sbjct: 192 AVVVVNGELRVRDYKTGNKPG----DDFQLGVYALAVAMKYGVKAPTTGD----YFMAGK 243

Query: 178 RTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRC 237
           +    +        +    A+   ER                      D C FC     C
Sbjct: 244 KGKKAVITAPYDLTEW--TAERIAERFHEVEVQIQAGEFPALPEP---DKCNFCDVSYSC 298

Query: 238 P 238
           P
Sbjct: 299 P 299


>gi|119475988|ref|ZP_01616340.1| hypothetical protein GP2143_05345 [marine gamma proteobacterium
           HTCC2143]
 gi|119450615|gb|EAW31849.1| hypothetical protein GP2143_05345 [marine gamma proteobacterium
           HTCC2143]
          Length = 934

 Score = 90.1 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/292 (13%), Positives = 66/292 (22%), Gaps = 61/292 (20%)

Query: 5   AFLSASSSHRWLKCPIAPTLESKIPQTTSI-------YASEGTFAHNLLAHCLEQGVDAE 57
           A L AS S     CP    L  ++              A  G+  H       +Q    +
Sbjct: 649 ATLFASQS----ACPFRAFLSHRLGVRGLPVAEIGLNAADRGSLLHRACELIWQQLKSQK 704

Query: 58  TV-------------------------SHQKLTFENDTRIVDTEMASSVSMVLAYVRTFS 92
           T+                                    R+    +   ++  L + R   
Sbjct: 705 TLLALNNSEQMSLCEETSQYAVRELDQRRSLHLGARYQRLECERLKLLLNTWLNFERERG 764

Query: 93  GPFLSETEVPLEPFTTEPGATGTADILI-FNSTQWIIVDFKYGAGVPVKAE----NNTQL 147
              + ETE                D +         ++D+K       +         QL
Sbjct: 765 DFIVKETEARKVFQHGHLKLETRIDRIDQLADGSLAVIDYKTSTTSIARWWGERPEEPQL 824

Query: 148 MLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGT-- 205
            LY        GD         L I    ++          S +  L    + K   +  
Sbjct: 825 PLYGMLV-ELAGDAVSGVGFAELRIEGCELKGIGD----EDSPEAALRWQDKVKNDASVL 879

Query: 206 -------------LALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCPALSRHV 244
                         AL+       +         +C++C     C    +  
Sbjct: 880 NWEQLKRHWEKVLTALANDFVAGKAAVDPRNAPQTCQYCDFSSACRVDHQQA 931


>gi|258652354|ref|YP_003201510.1| UvrD/REP helicase [Nakamurella multipartita DSM 44233]
 gi|258555579|gb|ACV78521.1| UvrD/REP helicase [Nakamurella multipartita DSM 44233]
          Length = 1099

 Score = 90.1 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 48/272 (17%), Positives = 82/272 (30%), Gaps = 37/272 (13%)

Query: 7    LSASSSHRWLKCPIAPTLESKIPQT-TSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
            LS S+     +CP+   LE +  ++ TS    EG   H L+         A+ V+  +  
Sbjct: 821  LSPSTVEALTRCPLRAVLERRGARSGTSQQQIEGIVMHALVDGLARGVPRADLVAEMERF 880

Query: 66   FEND---TRIVDTEMASSVSMVLAYVRTF-----SGPFLSETEVPLEPFTTE-------- 109
                      +      ++ ++L   +T+     +      TE  L  +  +        
Sbjct: 881  LAGRTNLPPWLIARTRRALELMLTAAQTWMAELPADRRPVATEAQLSTWLPQSDEAGRGR 940

Query: 110  -PGATGTADILIFN-STQWIIVDFKYGAGVPVKA--ENNTQLMLYACGALHQYGDIFGRP 165
                 G AD +        IIVDFK GA VP +A  E N QL +Y        G     P
Sbjct: 941  PVKVNGRADRIDQAPDGSMIIVDFKTGASVPSRAAVEQNAQLAVYQLALRLGAGADLATP 1000

Query: 166  EALTLTIIQPRVRTGSP----------------INEWVISADDLLEKAKEFKERGTLALS 209
            E                                +     +        ++  +     L 
Sbjct: 1001 EGAADRDAADSAAADDRNRAGRDSVAGGAELVYLRSGTPAVRQQPPLTEQDAQIWVHELR 1060

Query: 210  LKSKRAVSLEHYGVNDDSCRFCRAKVRCPALS 241
              ++   +     + + SC  C  +  CP   
Sbjct: 1061 QAAELLAAPTSVALENRSCERCPVRSSCPLQP 1092


>gi|330465621|ref|YP_004403364.1| hypothetical protein VAB18032_08230 [Verrucosispora maris
           AB-18-032]
 gi|328808592|gb|AEB42764.1| hypothetical protein VAB18032_08230 [Verrucosispora maris
           AB-18-032]
          Length = 315

 Score = 90.1 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 42/257 (16%), Positives = 71/257 (27%), Gaps = 32/257 (12%)

Query: 9   ASSSHRWLKCPIAPTL---ESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVS--- 60
            S    +  CP        +   P     +A  S G   H  L +      D        
Sbjct: 45  PSKLGAYADCPRRYRYTYVDRPAPPKGPPWAHNSLGASVHTALKNWYALPTDRRRPEVLP 104

Query: 61  -HQKLTFENDTRIVDTEMASSVSMVLAYVRTFSG-----PFLSETEVPLEPFTTEPGATG 114
              K T+  D    D +        L ++  +             E  +   T      G
Sbjct: 105 TLLKGTWVRDGYRDDEQEREVYRRALGWLEAYVDGLDPADEPVGVERVVAVKTGVLAFNG 164

Query: 115 TADILIFNST----QWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFGRPEAL 168
            AD +   +     + +IVD+K G        A  +  L LYA  A   +     R E  
Sbjct: 165 RADRIDGRAGSDGPELVIVDYKTGRTGLDSDDARGSQALALYAYAAERVFRRPCRRVELH 224

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE----HYGVN 224
            L            +     + + L  +    +E     ++ +   A   +         
Sbjct: 225 HL--------PSGTVAAHDHTVESLARQVSRAEETARDIMAAERTVADGGDPDEAFPTTP 276

Query: 225 DDSCRFCRAKVRCPALS 241
              C +C  +  CPA +
Sbjct: 277 GPRCAWCDYRRTCPAGA 293


>gi|265753492|ref|ZP_06088847.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|263235206|gb|EEZ20730.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 959

 Score = 90.1 bits (222), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 45/300 (15%), Positives = 79/300 (26%), Gaps = 69/300 (23%)

Query: 5   AFLSASSSHRWLKCPIAPTLES----KIPQTTS---IYASEGTFAH-------------- 43
           A  S S+ + +L CP+            P   S     A+ G+  H              
Sbjct: 662 AKFSPSALNYYLDCPLKFYYRYVAGLSAPDEVSAEIDSATFGSIFHYAAEHIYKDLTTHG 721

Query: 44  -----NLLAHCLEQGVDAETVSH-------------QKLTFENDTRIVDTEMASSVSMVL 85
                  L   L   V  +                 +K  +     I    +A  +  +L
Sbjct: 722 KVINKEALETLLRNEVKLQDYVDTAFKKLFFNVPQNEKPEYNGVQLINSAVIARYLKQLL 781

Query: 86  AYVRTFSGPFLSETEVPLEPFTT--------EPGATGTADILIFNSTQWIIVDFKYGAGV 137
                ++      +E+ ++            +    G  D +        IVD+K G   
Sbjct: 782 QNDLRYAPFTFIASEMEVDEPIDIQTPKGVIKSRIGGIIDRMDSKDGTLRIVDYKTGGDA 841

Query: 138 PVKAENN-------------TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPIN 184
                                Q  LYA     +   +  +     L I +    T SP+ 
Sbjct: 842 DTPPHVESLFIPDKKRSNYVFQTFLYAAIMCRKQPTM--KIAPALLYIHRAATETYSPVI 899

Query: 185 E------WVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
           +         + +D  +  KE++ER    L                 + C +C  K  C 
Sbjct: 900 QMGESRKPKEAVEDFSKYEKEYRERLQRLLEEIFN-PEKSFTQTEIIEKCTYCDFKALCK 958


>gi|220913224|ref|YP_002488533.1| UvrD/REP helicase [Arthrobacter chlorophenolicus A6]
 gi|219860102|gb|ACL40444.1| UvrD/REP helicase [Arthrobacter chlorophenolicus A6]
          Length = 1115

 Score = 89.7 bits (221), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 44/259 (16%), Positives = 73/259 (28%), Gaps = 29/259 (11%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYAS-EGTFAHNLLAH--------CLEQGVDA 56
            F+S S      K P+   +++   +  + +A   GT  H +            + +    
Sbjct: 850  FVSPSKVESVQKSPLDWFVQAAGGEAATDFARSLGTLVHAIAQDMPEASGQEYVAELARR 909

Query: 57   ETVSHQKLTFENDTR-IVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEP----- 110
                  K  +E          M   ++  +  +R  SG  L   E   +    E      
Sbjct: 910  WPQLGMKDNWEGRLDHQRAEAMVRKLAQYVLVMRG-SGRSLLGVEQDFDVALGEVLLDDA 968

Query: 111  -----GATGTADILIFN-STQWIIVDFKYGAGVP--VKAENNTQLMLYACGALHQY---G 159
                    G  D L  +   + +IVD K G   P   +  ++ QL  Y    L      G
Sbjct: 969  SPREAVLRGQVDRLEIDGEGRLVIVDLKTGKRQPGKTELASHPQLGAYQAAVLAGGFGDG 1028

Query: 160  DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
               G+       + Q      SP  +     D     A    +     +   +  A    
Sbjct: 1029 SDTGQTLPGGAVLAQLGTTAKSPAVQEQEPLDPQDNWALNMVKEAAAVMGGNAFEARHDP 1088

Query: 220  HYGVNDDSCRFCRAKVRCP 238
              G        CR    CP
Sbjct: 1089 GKGSFGGHG--CRLPEICP 1105


>gi|254881837|ref|ZP_05254547.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|319641142|ref|ZP_07995845.1| hypothetical protein HMPREF9011_01442 [Bacteroides sp. 3_1_40A]
 gi|254834630|gb|EET14939.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|317387273|gb|EFV68149.1| hypothetical protein HMPREF9011_01442 [Bacteroides sp. 3_1_40A]
          Length = 959

 Score = 89.3 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 45/300 (15%), Positives = 79/300 (26%), Gaps = 69/300 (23%)

Query: 5   AFLSASSSHRWLKCPIAPTLES----KIPQTTS---IYASEGTFAH-------------- 43
           A  S S+ + +L CP+            P   S     A+ G+  H              
Sbjct: 662 AKFSPSALNYYLDCPLKFYYRYVAGLSAPDEVSAEIDSATFGSIFHYAAEHIYKDLTTHG 721

Query: 44  -----NLLAHCLEQGVDAETVSH-------------QKLTFENDTRIVDTEMASSVSMVL 85
                  L   L   V  +                 +K  +     I    +A  +  +L
Sbjct: 722 KVINKEALETLLRNEVKLQDYVDTAFKKLFFNVPQNEKPEYNGIQLINSAVIARYLKQLL 781

Query: 86  AYVRTFSGPFLSETEVPLEPFTT--------EPGATGTADILIFNSTQWIIVDFKYGAGV 137
                ++      +E+ ++            +    G  D +        IVD+K G   
Sbjct: 782 QNDLRYAPFTFIASEMEVDEPIDIQTPKGVIKSRIGGIIDRMDSKDGTLRIVDYKTGGDA 841

Query: 138 PVKAENN-------------TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPIN 184
                                Q  LYA     +   +  +     L I +    T SP+ 
Sbjct: 842 DTPPHVESLFIPDKKRSNYVFQTFLYAAIMCRKQPTM--KIAPALLYIHRAATETYSPVI 899

Query: 185 E------WVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
           +         + +D  +  KE++ER    L                 + C +C  K  C 
Sbjct: 900 QMGEPRKPKEAVEDFSKYEKEYRERLQGLLEEIFN-PEKSFTQTEIIEKCTYCDFKALCK 958


>gi|330469984|ref|YP_004407727.1| UvrD/REP helicase [Verrucosispora maris AB-18-032]
 gi|328812955|gb|AEB47127.1| UvrD/REP helicase [Verrucosispora maris AB-18-032]
          Length = 1114

 Score = 89.3 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 43/146 (29%), Gaps = 7/146 (4%)

Query: 24   LESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVSM 83
            L   +P   + YA  GT  H  L      G D    + +     ++    D  +A     
Sbjct: 940  LRRPLPAEPNPYARRGTAFHAWLEQRF--GADRLLDTDELPGAADEDAAPDEALAELQRR 997

Query: 84   VLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNST-QWIIVDFKYGAGV--PVK 140
             LA           E EVP           G  D +      ++ +VD+K GA       
Sbjct: 998  FLASEWA--DRTPIEVEVPFATVIGGVVVRGRMDAVFRRPGDRFDVVDWKTGARPTGASA 1055

Query: 141  AENNTQLMLYACGALHQYGDIFGRPE 166
                 QL +Y        G    R  
Sbjct: 1056 EVAAVQLAVYRLAWAELAGVPVDRVG 1081


>gi|226365847|ref|YP_002783630.1| ATP-dependent DNA helicase [Rhodococcus opacus B4]
 gi|226244337|dbj|BAH54685.1| putative ATP-dependent DNA helicase [Rhodococcus opacus B4]
          Length = 1120

 Score = 89.3 bits (220), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 61/223 (27%), Gaps = 17/223 (7%)

Query: 7    LSASSSHRWLKCP--IAPTLESKIPQTTSIYASEGTFAHNLLAHCL--EQGVDAETVSHQ 62
            LS S        P  +A  L   +P   +  A  GT  H  +       + +D + +   
Sbjct: 908  LSVSQLVELEADPDALAARLRRPLPFPPNPLARRGTAFHAWVERRFGATRLLDLDELPGA 967

Query: 63   KLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
              T        D ++A+     L        P  +E EVP E         G  D +  +
Sbjct: 968  ADTGAGP----DADLATLQDAFLRSPWADRNP--TEVEVPFETSVAGTVLRGRIDAVFTD 1021

Query: 123  -STQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRT 179
                W ++D+K GA      +     QL  Y             R               
Sbjct: 1022 PDGGWTVIDWKTGAEPSAANEKAVVMQLAAYRLAWAELMDVPIERVR----AAFHYVRTG 1077

Query: 180  GSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG 222
             +   + +  AD L    +              +  +  +   
Sbjct: 1078 RTIAPDRLPGADALARLLRTAGAGEPDPAGGGPEDELRPDAEP 1120


>gi|237709836|ref|ZP_04540317.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|229455929|gb|EEO61650.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
          Length = 959

 Score = 89.3 bits (220), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/300 (15%), Positives = 79/300 (26%), Gaps = 69/300 (23%)

Query: 5   AFLSASSSHRWLKCPIAPTLES----KIPQTTS---IYASEGTFAH-------------- 43
           A  S S+ + +L CP+            P   S     A+ G+  H              
Sbjct: 662 AKFSPSALNYYLDCPLKFYYRYVAGLSAPDEVSAEIDSATFGSIFHYAAEHIYKDLTTHG 721

Query: 44  -----NLLAHCLEQGVDAETVSH-------------QKLTFENDTRIVDTEMASSVSMVL 85
                  L   L   V  +                 +K  +     I    +A  +  +L
Sbjct: 722 KVINKEALETLLRNEVKLQDYVDTAFKKLFFNVPQNEKPEYNGVQLINSAVIARYLKQLL 781

Query: 86  AYVRTFSGPFLSETEVPLEPFTT--------EPGATGTADILIFNSTQWIIVDFKYGAGV 137
                ++      +E+ ++            +    G  D +        IVD+K G   
Sbjct: 782 QNDLRYAPFTFIASEMEVDEPIDIQTPKGVIKSRIGGIIDRMDSKDGTLRIVDYKTGGDA 841

Query: 138 PVKAENN-------------TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPIN 184
                                Q  LYA     +   +  +     L I +    T SP+ 
Sbjct: 842 DTPPHVESLFIPDKKRSNYVFQTFLYAAIMCRKQPTM--KIAPALLYIHRAATETYSPVI 899

Query: 185 E------WVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
           +         + +D  +  KE++ER    L                 + C +C  K  C 
Sbjct: 900 QMGESRKPKEAVEDFSKYEKEYRERLQGLLEEIFN-PEKSFTQTEIIEKCTYCDFKALCK 958


>gi|212693030|ref|ZP_03301158.1| hypothetical protein BACDOR_02537 [Bacteroides dorei DSM 17855]
 gi|212664397|gb|EEB24969.1| hypothetical protein BACDOR_02537 [Bacteroides dorei DSM 17855]
          Length = 959

 Score = 89.3 bits (220), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/300 (15%), Positives = 79/300 (26%), Gaps = 69/300 (23%)

Query: 5   AFLSASSSHRWLKCPIAPTLES----KIPQTTS---IYASEGTFAH-------------- 43
           A  S S+ + +L CP+            P   S     A+ G+  H              
Sbjct: 662 AKFSPSALNYYLDCPLKFYYRYVAGLSAPDEVSAEIDSATFGSIFHYAAEHIYKDLTTHG 721

Query: 44  -----NLLAHCLEQGVDAETVSH-------------QKLTFENDTRIVDTEMASSVSMVL 85
                  L   L   V  +                 +K  +     I    +A  +  +L
Sbjct: 722 KVINKEALETLLRNEVKLQDYVDTAFKKLFFNVPQNEKPEYNGVQLINSAVIARYLKQLL 781

Query: 86  AYVRTFSGPFLSETEVPLEPFTT--------EPGATGTADILIFNSTQWIIVDFKYGAGV 137
                ++      +E+ ++            +    G  D +        IVD+K G   
Sbjct: 782 QNDLRYAPFTFIASEMEVDEPIDIQTPKGVIKSRIGGIIDRMDSKDGTLRIVDYKTGGDA 841

Query: 138 PVKAENN-------------TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPIN 184
                                Q  LYA     +   +  +     L I +    T SP+ 
Sbjct: 842 DTPPHVESLFIPDKKRSNYVFQTFLYAAIMCRKQPTM--KIAPALLYIHRAATETYSPVI 899

Query: 185 E------WVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
           +         + +D  +  KE++ER    L                 + C +C  K  C 
Sbjct: 900 QMGESRKPKEAVEDFSKYEKEYRERLQGLLEEIFN-PEKSFTQTEIIEKCTYCDFKALCK 958


>gi|145593295|ref|YP_001157592.1| hypothetical protein Strop_0737 [Salinispora tropica CNB-440]
 gi|145302632|gb|ABP53214.1| hypothetical protein Strop_0737 [Salinispora tropica CNB-440]
          Length = 302

 Score = 88.9 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/258 (17%), Positives = 72/258 (27%), Gaps = 32/258 (12%)

Query: 9   ASSSHRWLKCPIAPT---LESKIPQTTSIYA--SEGTFAHNLLAHCLEQGVDAETVSHQK 63
            S    +  CP       L+   P     +A  S G   H  L +     VD    +   
Sbjct: 36  PSKLGAYADCPRRYRYSYLDRPAPPKGPAWAHNSLGASVHTALKNWYALPVDRRRSAGLA 95

Query: 64  LTFE--------NDTRIVDTEMASSVSMVLAYVRTFSGPFL-SETEVPLEPFTTEPGATG 114
              +         D          ++  + AYV T          E  +   T      G
Sbjct: 96  TLLKGTWVRDGYRDHEQERVAFRHALGWLEAYVATLDPETEPLGVERVVAVKTGVLAFNG 155

Query: 115 TADILIFNST----QWIIVDFKYGAGVPV--KAENNTQLMLYACGALHQYGDIFGRPEAL 168
            AD +         +  IVD+K G        A  +  L LYA  A   +     R E  
Sbjct: 156 RADRIDSRVGPAGAELAIVDYKTGRAGLDTDDARGSQALALYAYAAERVFRKPCRRVELH 215

Query: 169 TLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE----HYGVN 224
            L            +     S + L  +    +E     ++ +   A   +         
Sbjct: 216 HL--------PSGTVAAHEHSPESLARQVTRAEETARDIIAGERSVAAGGDPDQAFPTAP 267

Query: 225 DDSCRFCRAKVRCPALSR 242
              C +C  +  CPA ++
Sbjct: 268 GPRCGWCDYRRHCPAGAQ 285


>gi|50954628|ref|YP_061916.1| ATP-dependent DNA helicase [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|50951110|gb|AAT88811.1| ATP-dependent DNA helicase [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 1043

 Score = 88.9 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 44/237 (18%), Positives = 74/237 (31%), Gaps = 20/237 (8%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLA----------HCLEQGVD 55
             LS S    + K P+A  +E      +S+ A  GT  H ++             L  G++
Sbjct: 792  RLSPSRLGTFEKSPLAWFVEEMAASPSSLTAGIGTVVHAVMEEASATGEFGVDALWAGIE 851

Query: 56   AE--TVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGAT 113
                 ++ +    E   R     +   VS  L      +G  L  +E   E         
Sbjct: 852  QRWAELAFESPWVEERERRRTRGLVGGVSDYLRD-FERAGGRLLGSEGEFELRLGRARIG 910

Query: 114  GTADILIFN-STQWIIVDFKYGAGVPVKAE--NNTQLMLYACG----ALHQYGDIFGRPE 166
            G  D +        ++VD K G  VP  AE  ++ QL  Y       A+ + G+      
Sbjct: 911  GKIDRVEATPDGTVVLVDLKTGRTVPSAAETASHAQLGAYQLALEHGAIEEAGERPPGGA 970

Query: 167  ALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGV 223
             L       R +    + +  + A+ L    +          +      V L     
Sbjct: 971  KLLFVAKGVRGKPYRELVQDRVDAEGLERLKQRVATAAEGMAAATFAAVVDLGDRDP 1027


>gi|237725570|ref|ZP_04556051.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|229436257|gb|EEO46334.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
          Length = 959

 Score = 88.9 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/300 (15%), Positives = 79/300 (26%), Gaps = 69/300 (23%)

Query: 5   AFLSASSSHRWLKCPIAPTLES----KIPQTTS---IYASEGTFAH-------------- 43
           A  S S+ + +L CP+            P   S     A+ G+  H              
Sbjct: 662 AKFSPSALNYYLDCPLKFYYRYVAGLSAPDEVSAEIDSATFGSIFHYAAEHIYKDLTTHG 721

Query: 44  -----NLLAHCLEQGVDAETVSH-------------QKLTFENDTRIVDTEMASSVSMVL 85
                  L   L   V  +                 +K  +     I    +A  +  +L
Sbjct: 722 KVINKEALETLLRNEVKLQDYVDTAFKKLFFNVPQNEKPEYNGVQLINSAVIARYLKQLL 781

Query: 86  AYVRTFSGPFLSETEVPLEPFTT--------EPGATGTADILIFNSTQWIIVDFKYGAGV 137
                ++      +E+ ++            +    G  D +        IVD+K G   
Sbjct: 782 QNDLRYAPFTFIASEMEVDEPIDIQTPKGVIKSRIGGIIDRMDSKDGTLRIVDYKTGGDA 841

Query: 138 PVKAENN-------------TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPIN 184
                                Q  LYA     +   +  +     L I +    T SP+ 
Sbjct: 842 DTPPHVESLFIPDKKRSNYVFQTFLYAAIMCRKQPTM--KIAPALLYIHRAATETYSPVI 899

Query: 185 E------WVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
           +         + +D  +  KE++ER    L                 + C +C  K  C 
Sbjct: 900 QMGEPRKPKEAVEDFSKYEKEYRERLQGLLEEIFN-PEKSFTQTEIIEKCTYCDFKALCK 958


>gi|294775535|ref|ZP_06741045.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
 gi|294450585|gb|EFG19075.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
          Length = 959

 Score = 88.9 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/300 (15%), Positives = 79/300 (26%), Gaps = 69/300 (23%)

Query: 5   AFLSASSSHRWLKCPIAPTLES----KIPQTTS---IYASEGTFAH-------------- 43
           A  S S+ + +L CP+            P   S     A+ G+  H              
Sbjct: 662 AKFSPSALNYYLDCPLKFYYRYVAGLSAPDEVSAEIDSATFGSIFHYAAEHIYKDLTTHG 721

Query: 44  -----NLLAHCLEQGVDAETVSH-------------QKLTFENDTRIVDTEMASSVSMVL 85
                  L   L   V  +                 +K  +     I    +A  +  +L
Sbjct: 722 KVINKEALETLLRNEVKLQDYVDTAFKKLFFNVPQNEKPEYNGVQLINSAVIARYLKQLL 781

Query: 86  AYVRTFSGPFLSETEVPLEPFTT--------EPGATGTADILIFNSTQWIIVDFKYGAGV 137
                ++      +E+ ++            +    G  D +        IVD+K G   
Sbjct: 782 QNDLRYAPFTFIASEMEVDEPIDIQTPKGVIKSRIGGIIDRMDSKDGTLRIVDYKTGGDA 841

Query: 138 PVKAENN-------------TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPIN 184
                                Q  LYA     +   +  +     L I +    T SP+ 
Sbjct: 842 DTPPHVESLFIPDKKRSNYVFQTFLYAAIMCRKQPTM--KIAPALLYIHRAATETYSPVI 899

Query: 185 E------WVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
           +         + +D  +  KE++ER    L                 + C +C  K  C 
Sbjct: 900 QMGEPRKPKEAVEDFSKYEKEYRERLQGLLEEIFN-PEKSFTQTEIIEKCTYCDFKALCK 958


>gi|54026511|ref|YP_120753.1| putative DNA helicase [Nocardia farcinica IFM 10152]
 gi|54018019|dbj|BAD59389.1| putative DNA helicase [Nocardia farcinica IFM 10152]
          Length = 1184

 Score = 88.9 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 50/187 (26%), Gaps = 10/187 (5%)

Query: 23   TLESKIPQTTSIYASEGTFAHNLLAHCL-EQGVDAETVSHQKLTFENDTRIVDTEMASSV 81
             L   +P   +  A  GT  H  +        +            +      D E+A   
Sbjct: 994  RLRRPLPYPPNPLARRGTAFHAWVQRWFSGTRLLGFDELPGAGEPDPGEAAADAELARMQ 1053

Query: 82   SMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN-STQWIIVDFKYGAGV--P 138
               L        P   + EVP E         G  D +      +W++VD+K GA     
Sbjct: 1054 DAFLNSAWAHRSP--IDVEVPFETSIAGTVIRGRMDAVFAEPDGRWVVVDWKTGAEPDPG 1111

Query: 139  VKAENNTQLMLYACGALHQYGDIFGRPEALTLT----IIQPRVRTGSPINEWVISADDLL 194
             +     QL +Y            G  E   L              +     +   D+L 
Sbjct: 1112 DEPAVAMQLAIYRLAWARLMAARTGGDEQAMLHRVDAAFHYVRSGRTIAPADLPGPDELA 1171

Query: 195  EKAKEFK 201
            E  +   
Sbjct: 1172 ELIRAAA 1178


>gi|256396908|ref|YP_003118472.1| UvrD/REP helicase [Catenulispora acidiphila DSM 44928]
 gi|256363134|gb|ACU76631.1| UvrD/REP helicase [Catenulispora acidiphila DSM 44928]
          Length = 1124

 Score = 88.9 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 49/190 (25%), Gaps = 13/190 (6%)

Query: 8    SASSSHRWLKCPIAPT--LESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKLT 65
            SAS   R+   P      L   +PQ     A  GT  H  +     Q    E        
Sbjct: 941  SASQLLRYRNDPSRFRRELARPMPQPPQPSARLGTKFHAWIESLFGQQALFE--YEDLPG 998

Query: 66   FENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFNSTQ 125
              ++    + ++       L      S P     E P +   +     G  D +      
Sbjct: 999  AADEEIADEVDLKELQDAFLRTPWADSVPAAV--EQPFQVVLSGRVVRGRIDAVYKTPDG 1056

Query: 126  WIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPINE 185
            W +VD+K             QL +Y        G                     +    
Sbjct: 1057 WEVVDWKTSRSQDADPV---QLAVYRLAWAEMRGVPLSAVS----AAFVYVRGGETVRPT 1109

Query: 186  WVISADDLLE 195
             +   ++L E
Sbjct: 1110 GLPDREELEE 1119


>gi|150005967|ref|YP_001300711.1| hypothetical protein BVU_3465 [Bacteroides vulgatus ATCC 8482]
 gi|149934391|gb|ABR41089.1| conserved hypothetical protein [Bacteroides vulgatus ATCC 8482]
          Length = 959

 Score = 88.9 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/300 (15%), Positives = 79/300 (26%), Gaps = 69/300 (23%)

Query: 5   AFLSASSSHRWLKCPIAPTLES----KIPQTTS---IYASEGTFAH-------------- 43
           A  S S+ + +L CP+            P   S     A+ G+  H              
Sbjct: 662 AKFSPSALNYYLDCPLKFYYRYVAGLSAPDEVSAEIDSATFGSIFHYAAEHIYKDLTTHG 721

Query: 44  -----NLLAHCLEQGVDAETVSH-------------QKLTFENDTRIVDTEMASSVSMVL 85
                  L   L   V  +                 +K  +     I    +A  +  +L
Sbjct: 722 KVINKEALETLLRNEVKLQDYVDTAFKKLFFNVPQNEKPEYNGVQLINSAVIARYLKQLL 781

Query: 86  AYVRTFSGPFLSETEVPLEPFTT--------EPGATGTADILIFNSTQWIIVDFKYGAGV 137
                ++      +E+ ++            +    G  D +        IVD+K G   
Sbjct: 782 QNDLRYAPFTFIASEMEVDEPIDIQTPKGVIKSRIGGIIDRMDSKDGTLRIVDYKTGGDA 841

Query: 138 PVKAENN-------------TQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGSPIN 184
                                Q  LYA     +   +  +     L I +    T SP+ 
Sbjct: 842 DTPPHVESLFIPDKKRSNYVFQTFLYAAIMCRKQPTM--KIAPALLYIHRAATETYSPVI 899

Query: 185 E------WVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
           +         + +D  +  KE++ER    L                 + C +C  K  C 
Sbjct: 900 QMGEPRKPKEAVEDFSKYEKEYRERLQGLLEEIFN-PEKSFTQTEIIEKCTYCDFKALCK 958


>gi|170782260|ref|YP_001710593.1| putative ATP-dependent DNA helicase [Clavibacter michiganensis subsp.
            sepedonicus]
 gi|169156829|emb|CAQ01996.1| putative ATP-dependent DNA helicase [Clavibacter michiganensis subsp.
            sepedonicus]
          Length = 1086

 Score = 88.6 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 67/222 (30%), Gaps = 21/222 (9%)

Query: 6    FLSASSSHRWLKCPI--APTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
             + AS    ++  P   A  L   +P+        GT  H  +         ++ +    
Sbjct: 875  RIPASRFKDFVSDPAGVAARLRRPMPERPYRQTRLGTLFHGWVEARYGPAGTSDVIDASG 934

Query: 64   LTFEN---DTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILI 120
            +  +    +  +   ++    ++  A       P   E E+ +E            D + 
Sbjct: 935  VELDADPTEPPVEQEDLDRLRAIFEASEWASRKPEEVEVEIHMELAGQVVIC--KIDAVF 992

Query: 121  FNSTQWIIVDFKYGAGVPVKAE---NNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRV 177
                ++ +VD+K G      A+      QL LY        G      +           
Sbjct: 993  LIDGRYRVVDWKTGRTPKDAADLELKQLQLALYRLAFAKWRGIDPDLID----AEFYFVA 1048

Query: 178  RTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
               S   E + S +DL+          + A +  + RA S E
Sbjct: 1049 DDRSLKPERLYSEEDLVA-------LWSGARTPDASRAPSGE 1083


>gi|158522931|ref|YP_001530801.1| hypothetical protein Dole_2921 [Desulfococcus oleovorans Hxd3]
 gi|158511757|gb|ABW68724.1| conserved hypothetical protein [Desulfococcus oleovorans Hxd3]
          Length = 274

 Score = 88.6 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 41/260 (15%), Positives = 78/260 (30%), Gaps = 36/260 (13%)

Query: 7   LSASSSHRWLKCPIAPTLESKI---PQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
           LSAS+   ++ C ++  L   I   P  T      G+  H +LA   +   + + +S + 
Sbjct: 12  LSASAISGYMDCGLSYYLGRIIGVSPDFTPAPLVFGSAVHAVLAEFYQALANGKRLSART 71

Query: 64  L--TFENDTRIVDTE---------------MASSVSMVLAYVRTFSGP--FLSETEVPLE 104
           L   FE+  + +  +               +     +V+ +          +   E P  
Sbjct: 72  LGALFEHYWQQMAEDRNDIQYKPGQDYASLLLEGKELVVTFCHQLPEDTGTIIGIEEPFA 131

Query: 105 PFTTEP--GATGTADILIFN-STQWIIVDFKYGAGVPVKA--ENNTQLMLYACGALHQYG 159
                      G  D+++ + +    IVD K  +     A  + N QL +Y   A     
Sbjct: 132 FELEGLPMPIIGAYDLVLEDAAGTITIVDHKTSSRAFSNADMDKNLQLTIYQMAARANG- 190

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLE 219
                   + L              ++     +  E   + + +        SK      
Sbjct: 191 ---FAGREILLRFDALIKTKIPKFEQYYTIRSEWDEL--KARRKILSVYEGISKGVFMPN 245

Query: 220 HYGVNDDSCRFCRAKVRCPA 239
                   C  C+ K  C A
Sbjct: 246 EE---SWKCAGCQYKTACKA 262


>gi|298387755|ref|ZP_06997306.1| conserved hypothetical protein [Bacteroides sp. 1_1_14]
 gi|298259611|gb|EFI02484.1| conserved hypothetical protein [Bacteroides sp. 1_1_14]
          Length = 954

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 46/296 (15%), Positives = 71/296 (23%), Gaps = 64/296 (21%)

Query: 6   FLSASSSHRWLKCPIAPTLES----KIPQTTS---IYASEGTFAH--------------- 43
            LS S+ + +L C +          K P   S     A  GT  H               
Sbjct: 659 ILSPSALNAYLDCRLKFYYRYVARLKAPDEVSAEIDSALFGTIFHLSAQLAYTDLTANRK 718

Query: 44  ----NLLAHCLEQGVDAETVSHQKLTFENDTRIVDTE-------------MASSVSMVLA 86
                 L   L   V  +         E      D +             + S +  +L 
Sbjct: 719 IIQKEDLERLLRNEVKLQNYVDLAFKQELFKVPADEKPEYNGVQLINSKVIVSYLKQLLR 778

Query: 87  YVRTFSGPFLSETEVPLEPFT--------TEPGATGTADILIFNSTQWIIVDFKYGAGVP 138
               ++   +   E P+                  GT D +    T   IVD+K G    
Sbjct: 779 NDLQYAPFEMVAMEKPVAEKITIQTGQGPITLRLGGTIDRMDAKDTTLRIVDYKTGGSPK 838

Query: 139 VKAENN-------------TQLMLY-ACGALHQYGDIFGRPEALTLTIIQPRVR--TGSP 182
             A                 Q  LY A  +  Q   +      +     +          
Sbjct: 839 TPANIEQLFTPSETRPNYIFQTFLYAAIMSRQQSLKVAPSLLYIHRAASESYSPVIEMGE 898

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
             +  I  ++      EF+ER    L               +   C +C  K  C 
Sbjct: 899 PRQPKIPVNNFAFFEDEFRERLQRLLKEIFDEN-EPFTQTEDTKKCAYCDFKAICK 953


>gi|29346467|ref|NP_809970.1| hypothetical protein BT_1057 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29338363|gb|AAO76164.1| putative exonuclease [Bacteroides thetaiotaomicron VPI-5482]
          Length = 954

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 46/296 (15%), Positives = 71/296 (23%), Gaps = 64/296 (21%)

Query: 6   FLSASSSHRWLKCPIAPTLES----KIPQTTS---IYASEGTFAH--------------- 43
            LS S+ + +L C +          K P   S     A  GT  H               
Sbjct: 659 ILSPSALNAYLDCRLKFYYRYVARLKAPDEVSAEIDSALFGTIFHLSAQLAYTDLTANRK 718

Query: 44  ----NLLAHCLEQGVDAETVSHQKLTFENDTRIVDTE-------------MASSVSMVLA 86
                 L   L   V  +         E      D +             + S +  +L 
Sbjct: 719 IIQKEDLERLLRNEVKLQNYVDLAFKQELFKVPADEKPEYNGVQLINSKVIVSYLKQLLR 778

Query: 87  YVRTFSGPFLSETEVPLEPFT--------TEPGATGTADILIFNSTQWIIVDFKYGAGVP 138
               ++   +   E P+                  GT D +    T   IVD+K G    
Sbjct: 779 NDLQYAPFEMVAMEKPVAEKITIQTGQGPITLRLGGTIDRMDAKDTTLRIVDYKTGGSPK 838

Query: 139 VKAENN-------------TQLMLY-ACGALHQYGDIFGRPEALTLTIIQPRVR--TGSP 182
             A                 Q  LY A  +  Q   +      +     +          
Sbjct: 839 TPANIEQLFTPSETRPNYIFQTFLYAAIMSRQQSLKVAPSLLYIHRAASESYSPVIEMGE 898

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
             +  I  ++      EF+ER    L               +   C +C  K  C 
Sbjct: 899 PRQPKIPVNNFAFFEDEFRERLQRLLKEIFDEN-EPFTQTEDTKKCAYCDFKAICK 953


>gi|297192221|ref|ZP_06909619.1| ATP-dependent DNA helicase [Streptomyces pristinaespiralis ATCC
            25486]
 gi|297151257|gb|EDY64039.2| ATP-dependent DNA helicase [Streptomyces pristinaespiralis ATCC
            25486]
          Length = 1190

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/164 (17%), Positives = 48/164 (29%), Gaps = 7/164 (4%)

Query: 5    AFLSASSSHRWLKCPIAPT--LESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQ 62
            A LSAS   R    P      L   +P+     A  GT  H  +    E+         +
Sbjct: 990  ASLSASQLLRLAADPDGFAQELARPMPRPPQPAARRGTRFHAWVESRFEEMPLPMLGPDE 1049

Query: 63   KLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN 122
                 ++  I D +  +++         ++       E P +         G  D +   
Sbjct: 1050 LPGGADEHDIADEQDLAALKDAFERTP-YARRTPYRDEAPFQFTLAGRVVRGRIDAVYRT 1108

Query: 123  -STQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRP 165
                + IVD+K             QL +Y      Q+G      
Sbjct: 1109 GEGTYEIVDWKTARNGVADP---LQLAVYRLAWAEQHGIPLDAV 1149


>gi|255009002|ref|ZP_05281128.1| hypothetical protein Bfra3_07667 [Bacteroides fragilis 3_1_12]
 gi|313146742|ref|ZP_07808935.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313135509|gb|EFR52869.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 957

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 47/295 (15%), Positives = 71/295 (24%), Gaps = 64/295 (21%)

Query: 7   LSASSSHRWLKCPIAPTLES----KIPQTTS---IYASEGTFAHNLL------------- 46
           LS S+ + +L C +          K P   S     A  GT  H                
Sbjct: 663 LSPSALNTYLDCRLKFYFRYVARLKAPDEVSAEIDSALFGTIFHRSAQLAYLDLTAHKQE 722

Query: 47  ------AHCLEQGVDAETVSHQKLTFENDTRIVDTE-------------MASSVSMVLAY 87
                    L   V  +         E     +D +             + S +  +L  
Sbjct: 723 IHKEDIERLLRDNVRLQNYVDTAFKEEFFHVPLDEKPEYNGVQLINSKVITSYLRQLLRN 782

Query: 88  VRTFSGPFLSETEVPLEPFTTE--------PGATGTADILIFNSTQWIIVDFKYGAGVPV 139
              ++   +   E  +                  GT D +        IVD+K G    V
Sbjct: 783 DLQYAPFRMIGMEQKVTEDIQIEGPKGMLSLKIGGTIDRMDSKEGTLRIVDYKTGGSPKV 842

Query: 140 KAENN-------------TQLMLY-ACGALHQYGDIFGRPEALTLTIIQPRVR--TGSPI 183
            A                 Q  LY A  A  Q   +      +     +           
Sbjct: 843 PANVEQLFTPAEGRPNYIFQTFLYAAIMARQQTLKVAPSLLYIHRAASESYSPVIEMGEA 902

Query: 184 NEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
            +  +  DD     KEF+ER    L               +   C +C  K  C 
Sbjct: 903 RKPKLPVDDFSVYEKEFRERLLALLEEI-YNDQEEFTQTEDLKKCEYCDFKAMCK 956


>gi|253568130|ref|ZP_04845541.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251842203|gb|EES70283.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 954

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 46/296 (15%), Positives = 71/296 (23%), Gaps = 64/296 (21%)

Query: 6   FLSASSSHRWLKCPIAPTLES----KIPQTTS---IYASEGTFAH--------------- 43
            LS S+ + +L C +          K P   S     A  GT  H               
Sbjct: 659 ILSPSALNAYLDCRLKFYYRYVARLKAPDEVSAEIDSALFGTIFHLSAQLAYTDLTANRK 718

Query: 44  ----NLLAHCLEQGVDAETVSHQKLTFENDTRIVDTE-------------MASSVSMVLA 86
                 L   L   V  +         E      D +             + S +  +L 
Sbjct: 719 IIQKEELERLLRNEVKLQNYVDLAFKQELFKVPADEKPEYNGVQLINSKVIVSYLKQLLR 778

Query: 87  YVRTFSGPFLSETEVPLEPFT--------TEPGATGTADILIFNSTQWIIVDFKYGAGVP 138
               ++   +   E P+                  GT D +    T   IVD+K G    
Sbjct: 779 NDLQYAPFEMVAMEKPVAEKITIQTGQGPITFRLGGTIDRMDAKDTTLRIVDYKTGGSPK 838

Query: 139 VKAENN-------------TQLMLY-ACGALHQYGDIFGRPEALTLTIIQPRVR--TGSP 182
             A                 Q  LY A  +  Q   +      +     +          
Sbjct: 839 TPANIEQLFTPSETRPNYIFQTFLYAAIMSRQQSLKVAPSLLYIHRAASESYSPVIEMGE 898

Query: 183 INEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVRCP 238
             +  I  ++      EF+ER    L               +   C +C  K  C 
Sbjct: 899 PRQPKIPVNNFAFFEDEFRERLQRLLKEIFDEN-EPFTQTEDTKKCAYCDFKAICK 953


>gi|159039659|ref|YP_001538912.1| UvrD/REP helicase [Salinispora arenicola CNS-205]
 gi|157918494|gb|ABV99921.1| UvrD/REP helicase [Salinispora arenicola CNS-205]
          Length = 1096

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/251 (16%), Positives = 68/251 (27%), Gaps = 26/251 (10%)

Query: 6    FLSASSSHRWLKCPIAPTLESKIPQTTSIYAS-EGTFAHN---LLA----------HCLE 51
             ++ S     L+C +   LE       +  A   G   H    L              + 
Sbjct: 834  RVTPSGMESALRCSLRWLLERHGGSAPAGAAQGVGNLVHAAAMLAESASSDRRALLDYVA 893

Query: 52   QGVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPG 111
               DA  ++ +        R     M   +   LA           E  V L        
Sbjct: 894  SRFDAIELAAR--WMVGPERARAEAMVDKLLRWLATNPRRLLAIEHEFAVRLNDPRHPVD 951

Query: 112  ATGTADILIFN-STQWIIVDFKYGAGVPVKAEN---NTQLMLYACGALHQYGDIFGRPEA 167
              G  D L  +   + ++VD K G    V A +   + QL  Y   A+          E+
Sbjct: 952  LVGRVDRLEVDADGRLVVVDLKTGKSTAVTAADLAEHPQLGAYQ-AAVEAGAFAEFGAES 1010

Query: 168  LTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDS 227
                ++Q          +    A +            T  +   +    +     V +  
Sbjct: 1011 GGAALVQLGTAAKDAREQSQPPAGEGPAAG-----WATALVRRTADTMAAATFAAVANSK 1065

Query: 228  CRFCRAKVRCP 238
            CR C  +  CP
Sbjct: 1066 CRVCPVRASCP 1076


>gi|220913223|ref|YP_002488532.1| UvrD/REP helicase [Arthrobacter chlorophenolicus A6]
 gi|219860101|gb|ACL40443.1| UvrD/REP helicase [Arthrobacter chlorophenolicus A6]
          Length = 1167

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/190 (15%), Positives = 55/190 (28%), Gaps = 13/190 (6%)

Query: 7    LSASSSHRWLKCPI--APTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQKL 64
            +SAS+     + P      L   +P+   + A +GT  H  +         A  +   + 
Sbjct: 974  ISASTLVDLEEDPAAVLARLRRPVPREPGMSARKGTAFHAWVEDYFG---SAGMLDLGED 1030

Query: 65   TFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFTTEPGATGTADILIFN-S 123
               +D      ++ + V    A       P   E  V  E    +    G  D +  +  
Sbjct: 1031 PGSDDHIDAAYDLDAMVETFRASEWAHRAPAYVEVPV--ETRVGDVVVRGRIDAVFRDAD 1088

Query: 124  TQWIIVDFKYGAGV--PVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPRVRTGS 181
             +W +VD+K G             QL  Y               E++             
Sbjct: 1089 GRWDLVDWKTGRRPSGARLKTRAVQLAAYRLAWARLKDVP---LESVRAAFFYVADNEVV 1145

Query: 182  PINEWVISAD 191
              ++   + +
Sbjct: 1146 RPHDLGTAVE 1155


>gi|158312779|ref|YP_001505287.1| UvrD/REP helicase [Frankia sp. EAN1pec]
 gi|158108184|gb|ABW10381.1| UvrD/REP helicase [Frankia sp. EAN1pec]
          Length = 1135

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/282 (12%), Positives = 64/282 (22%), Gaps = 60/282 (21%)

Query: 21   APTLE--SKIPQTTSIYASEGTFAHNLL--------AHCLEQGVDAETVSHQKLTFENDT 70
               LE  +   +  S     G   H L            LE       +  + L F++  
Sbjct: 848  RWFLEHEANAAEPASPAQGFGKVVHALADEVTTGRTEARLEALDARLDLVWRHLEFDSRW 907

Query: 71   --RIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLEPFT----TEPGATGTADILIFNS- 123
                       ++   L +     G  +  +EV                G  D +  +  
Sbjct: 908  RSEQERAAAREALGRFLEWHAAQRGREVVASEVRFSCDIEVAGRVVRLRGFIDRVELDDA 967

Query: 124  TQWIIVDFKYGAGVPVKAE--NNTQLMLYACGALHQY----------------------- 158
             +  +VDFK G   P + +   + QL