RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780124|ref|YP_003064537.1| hypothetical protein
CLIBASIA_00015 [Candidatus Liberibacter asiaticus str. psy62]
         (388 letters)



>gnl|CDD|151373 pfam10926, DUF2800, Protein of unknown function (DUF2800).  This is
           a family of uncharacterized proteins found in bacteria
           and viruses. Some members of this family are annotated
           as being Phi APSE P51-like proteins.
          Length = 363

 Score =  253 bits (648), Expect = 6e-68
 Identities = 132/378 (34%), Positives = 185/378 (48%), Gaps = 37/378 (9%)

Query: 4   HAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNLLAHCLEQGVDAETVSHQK 63
           HA LSASS+HRWL CP +  LE   P  +S  A+EGT AH L    L +G+DA T    K
Sbjct: 1   HALLSASSAHRWLNCPPSARLEEGFPDKSSPAAAEGTAAHELAELKLRKGLDAIT----K 56

Query: 64  LTF--ENDTRIVDTEMASSVSMVLAYVR----TFSGPFLS-ETEVPLEPFTTEPGATGTA 116
           L    E D   VD EMA  V   + +VR          L  E  V        P   GT 
Sbjct: 57  LGRNSEADGEYVDEEMAEYVQEYVDFVREQIELAKDGVLLIEQRVDFSQIV--PEGFGTG 114

Query: 117 DILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFGRPEALTLTIIQPR 176
           D++I       I+D KYG GV V AE N QLMLYA GAL ++  ++   + + +TI QPR
Sbjct: 115 DVVIIADGVLHIIDLKYGKGVLVSAEGNPQLMLYALGALDEFDVLYDF-DTVRMTIFQPR 173

Query: 177 VRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYGVNDDSCRFCRAKVR 236
           +     I+ W ISA++LLE A+E        +   ++ A + +      + CRFC+AK  
Sbjct: 174 L---DNISTWEISAEELLEWAEEV-------VKPAAELAYAGDGEFKPGEHCRFCKAKAT 223

Query: 237 CPALSRHVLLEATKD----PSTNTTVELSKAYSSISLIKSYVKACEDEMFKRLNAGDEIQ 292
           C A ++ VL  A  D        T  EL++      L++ + K  E         G E+ 
Sbjct: 224 CRARAQAVLNLAKYDFEDPTLDLTDEELAELLEKADLLEKWAKDVEAYALDEARNGKEVP 283

Query: 293 GYQLVEGRKGNRSFKDINRAQELLTSV-LGEEA-FKRILKTPKELEQLYKEQKVSDEFWE 350
           GY+LVEGR  NR + D       L +  L +E  +K+ L +P + E+L  ++K     ++
Sbjct: 284 GYKLVEGR-SNRKWTDEEAVAAALKAAGLKDEDIYKKKLISPTQAEKLLGKKK-----FK 337

Query: 351 EL-QELITRGDGKPVIAP 367
           EL   LI +  GKP + P
Sbjct: 338 ELLGALIVKPPGKPTLVP 355


>gnl|CDD|179834 PRK04346, PRK04346, tryptophan synthase subunit beta; Validated.
          Length = 397

 Score = 30.8 bits (71), Expect = 0.58
 Identities = 10/23 (43%), Positives = 14/23 (60%)

Query: 333 KELEQLYKEQKVSDEFWEELQEL 355
           +ELE+ Y++ K   EF  EL  L
Sbjct: 28  EELEEAYEKAKNDPEFQAELDYL 50


>gnl|CDD|181193 PRK08006, PRK08006, replicative DNA helicase; Provisional.
          Length = 471

 Score = 30.4 bits (68), Expect = 0.74
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 4/102 (3%)

Query: 160 DIFGRPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLA-LSLKSKRAVSL 218
           D + RP     T +     +GSPI+  +I+  + LE+  +    G  A L+  SK   S 
Sbjct: 59  DFYTRPHRHIFTEMARLQESGSPID--LITLAESLERQGQLDSVGGFAYLAELSKNTPSA 116

Query: 219 EHYGVNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTTVEL 260
            +     D  R  RA VR      + + +A  DP   T+ +L
Sbjct: 117 ANISAYADIVRE-RAVVREMISVANEIADAGYDPQGRTSEDL 157


>gnl|CDD|183851 PRK13028, PRK13028, tryptophan synthase subunit beta; Provisional.
          Length = 402

 Score = 29.8 bits (68), Expect = 1.3
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 333 KELEQLYKEQKVSDEFWEELQELITRGDGKP 363
            ELE  Y+E K   +F  EL+ L+    G+P
Sbjct: 32  DELEAAYEEIKKDPDFIAELRYLLKHYVGRP 62


>gnl|CDD|161793 TIGR00263, trpB, tryptophan synthase, beta subunit.  Tryptophan
           synthase catalyzes the last step in the biosynthesis of
           tryptophan. the beta chain contains the functional
           domain for or the synthesis of tryptophan from indole
           and serine. The enzyme requires pyridoxal-phosphate as a
           cofactor. The pyridoxal-P attachment site is contained
           within the conserved region
           [LIVM]-x-H-x-G-[STA]-H-K-x-N] [K is the pyridoxal-P
           attachment site] which is present between residues
           90-100 of the model.
          Length = 385

 Score = 28.9 bits (65), Expect = 2.1
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 334 ELEQLYKEQKVSDEFWEELQELITRGDGKP 363
           ELE  +++ K    FW EL EL+    G+P
Sbjct: 21  ELEAAFEDAKADPAFWAELNELLRNYAGRP 50


>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA.  LepA (GUF1 in
           Saccaromyces) is a GTP-binding membrane protein related
           to EF-G and EF-Tu. Two types of phylogenetic tree,
           rooted by other GTP-binding proteins, suggest that
           eukaryotic homologs (including GUF1 of yeast) originated
           within the bacterial LepA family. The function is
           unknown.
          Length = 595

 Score = 28.8 bits (65), Expect = 2.2
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 4/41 (9%)

Query: 33  SIYASEGTFAHNLLAHCLEQGVDAETVSHQKLTFENDTRIV 73
           S+ A EG     LL     QG++A+T+++  L  END  I+
Sbjct: 90  SLAACEGA----LLLVDAAQGIEAQTLANVYLALENDLEII 126


>gnl|CDD|163018 TIGR02784, addA_alphas, double-strand break repair helicase AddA,
            alphaproteobacterial type.  AddAB, also called RexAB,
            substitutes for RecBCD in several bacterial lineages.
            These DNA recombination proteins act before synapse and
            are particularly important for DNA repair of
            double-stranded breaks by homologous recombination. The
            term AddAB is used broadly, with AddA homologous between
            the alphaproteobacteria (as modeled here) and the
            Firmicutes, while the partner AddB proteins show no
            strong homology across the two groups of species.
          Length = 1141

 Score = 28.9 bits (65), Expect = 2.5
 Identities = 19/75 (25%), Positives = 29/75 (38%), Gaps = 9/75 (12%)

Query: 75   TEMASSVSMVLAYVRTFSGPFLSE---TEVPLEPFTTEPGAT----GTADILIFNSTQWI 127
             ++ ++V  VL   R    P  +E    EV +       G      G  D L  +  + +
Sbjct: 1028 EKLLAAVLAVLDDPRL--APVFAEGSRAEVAIMGTLKIGGQELAVSGQIDRLAVDDNRVL 1085

Query: 128  IVDFKYGAGVPVKAE 142
            IVD+K    VP   E
Sbjct: 1086 IVDYKTNRPVPATPE 1100


>gnl|CDD|128865 smart00602, VPS10, VPS10 domain. 
          Length = 612

 Score = 28.5 bits (64), Expect = 2.7
 Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 4/53 (7%)

Query: 96  LSETEVPLEPFTTEPGATGTADIL----IFNSTQWIIVDFKYGAGVPVKAENN 144
            + T V ++   TEPG +     L        + W +    +      + E +
Sbjct: 433 FTSTPVFVKGLLTEPGGSTLVFTLFGFTKERGSSWSLYTIDFKDIFERQCEED 485


>gnl|CDD|116614 pfam08004, DUF1699, Protein of unknown function (DUF1699).  This
           family contains many archaeal proteins which have very
           conserved sequences.
          Length = 131

 Score = 28.5 bits (64), Expect = 2.9
 Identities = 29/87 (33%), Positives = 40/87 (45%), Gaps = 13/87 (14%)

Query: 267 ISLIKSYVKACED--EMFKRLNAGDEIQGYQLVEGRK-GNRSFKDINRAQELLTSVLGEE 323
           I L KSY +      EMF       E+QG QL+EG   G+R  KDIN    +  SV+   
Sbjct: 46  IQLPKSYYRTVSKSIEMFL------EMQGIQLIEGDVWGHR--KDINEYYTVSQSVIERI 97

Query: 324 AFKRILKTPKE--LEQLYKEQKVSDEF 348
              +      E   E+L +E K+S + 
Sbjct: 98  RELKAEGISNEEIAEKLSRESKLSPDM 124


>gnl|CDD|181983 PRK09603, PRK09603, bifunctional DNA-directed RNA polymerase subunit
            beta/beta'; Reviewed.
          Length = 2890

 Score = 28.4 bits (63), Expect = 3.6
 Identities = 27/71 (38%), Positives = 35/71 (49%), Gaps = 12/71 (16%)

Query: 310  NRAQEL----LTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVI 365
            N A EL    L S L E  +   LK  K +     EQK S+E WE LQE+    +G PV+
Sbjct: 1760 NMALELFKPHLLSKLEERGYATTLKQAKRM----IEQK-SNEVWECLQEIT---EGYPVL 1811

Query: 366  APRDIPTNKQT 376
              R    +KQ+
Sbjct: 1812 LNRAPTLHKQS 1822


>gnl|CDD|182354 PRK10281, PRK10281, hypothetical protein; Provisional.
          Length = 299

 Score = 28.1 bits (63), Expect = 4.4
 Identities = 9/48 (18%), Positives = 17/48 (35%), Gaps = 9/48 (18%)

Query: 160 DIFGRPEALTLTIIQPRVRTGSPIN----EWVISA-----DDLLEKAK 198
           DI    +   +++ Q       P+       +I+A     DD+L    
Sbjct: 108 DIEKENDDYRISMTQGTPEFEPPLEGETRAAIINALGLTEDDILPGLP 155


>gnl|CDD|150466 pfam09802, Sec66, Preprotein translocase subunit Sec66.  Members of
           this family of proteins are a component of the
           heterotetrameric Sec62/63 complex composed of SEC62,
           SEC63, SEC66 and SEC72. The Sec62/63 complex associates
           with the Sec61 complex to form the Sec complex. Sec 66
           is involved in SRP-independent post-translational
           translocation across the endoplasmic reticulum and
           functions together with the Sec61 complex and KAR2 in a
           channel-forming translocon complex. Furthermore, Sec66
           is also required for growth at elevated temperatures.
          Length = 190

 Score = 27.7 bits (62), Expect = 5.0
 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 5/37 (13%)

Query: 321 GEEAFKRILKTPKELEQ----LYKEQKVSDEFWEELQ 353
             EA +R +K  KE +     LY+   V D+ W+  Q
Sbjct: 82  AAEAIRRSIKL-KENKPALNILYQNGSVGDDLWQRFQ 117


>gnl|CDD|184335 PRK13802, PRK13802, bifunctional indole-3-glycerol phosphate
           synthase/tryptophan synthase subunit beta; Provisional.
          Length = 695

 Score = 27.3 bits (60), Expect = 6.7
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 3/38 (7%)

Query: 334 ELEQLYKEQKVSDEFWEELQELITRGDGKP---VIAPR 368
           ELE++Y + K   EF +EL  L  R  G+P     APR
Sbjct: 297 ELERVYTQAKADPEFHKELATLNQRYVGRPSPLTEAPR 334


>gnl|CDD|117947 pfam09406, DUF2004, Protein of unknown function (DUF2004).  This is
           a family of proteins with unknown function. The
           structure of one of the proteins in this family has
           revealed a novel alpha-beta fold.
          Length = 123

 Score = 27.1 bits (60), Expect = 8.0
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 7/83 (8%)

Query: 282 FKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKE 341
           F+ LN  DE   + L      N   KD +    +    LG + F RIL + K+L  L+ E
Sbjct: 9   FQPLNGNDEKLVFALA-NITANDFLKDKSLKYLIFLVTLGGQKFFRILFSSKKLNDLHPE 67

Query: 342 --QKVSDEFWE----ELQELITR 358
             +K+ +EF +    E  EL+ +
Sbjct: 68  LRKKIREEFDDLSKLEYNELMNK 90


>gnl|CDD|181744 PRK09271, PRK09271, flavodoxin; Provisional.
          Length = 160

 Score = 27.1 bits (60), Expect = 8.5
 Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 3/42 (7%)

Query: 148 MLYACGALHQYGDIFGRPEALTLTIIQ-PR-VRTGSPINEWV 187
             Y CGA+H+    FG      L I Q P   R  + I+ W 
Sbjct: 100 EEYYCGAVHRMARFFGSSYP-RLKIEQMPHGERDAAAIDNWT 140


>gnl|CDD|185655 PTZ00477, PTZ00477, rhoptry-associated protein; Provisional.
          Length = 524

 Score = 27.1 bits (60), Expect = 9.4
 Identities = 17/84 (20%), Positives = 34/84 (40%), Gaps = 7/84 (8%)

Query: 279 DEMFKRLNAGDEIQGYQLVEGRKGNRSFKDI---NRAQELLTSVLGEEAFKRILKTPKEL 335
             +F++       Q  +++     NR+FK++    + QE+L   L + A     ++ K  
Sbjct: 380 KAVFRQKGRMGNEQFKRMLY----NRNFKNLTYKTKDQEVLERYLSKAAVYFKYRSRKTE 435

Query: 336 EQLYKEQKVSDEFWEELQELITRG 359
              +   KV       L+ L+  G
Sbjct: 436 LDKHTSTKVESFLMRTLRSLVGAG 459


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.316    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0707    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 6,116,066
Number of extensions: 387113
Number of successful extensions: 931
Number of sequences better than 10.0: 1
Number of HSP's gapped: 925
Number of HSP's successfully gapped: 28
Length of query: 388
Length of database: 5,994,473
Length adjustment: 95
Effective length of query: 293
Effective length of database: 3,941,713
Effective search space: 1154921909
Effective search space used: 1154921909
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 58 (26.2 bits)