RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] (262 letters) >d2tnfa_ b.22.1.1 (A:) Tumor necrosis factor (TNF) {Mouse (Mus musculus) [TaxId: 10090]} Length = 148 Score = 27.7 bits (61), Expect = 1.2 Identities = 10/30 (33%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Query: 228 DVPMQHVEG---STQQLKWNSNLLVSFLQN 254 D P+ HV +QL+W S + L N Sbjct: 2 DKPVAHVVANHQVEEQLEWLSQRANALLAN 31 >d1s21a_ d.166.1.4 (A:) AvrPphF ORF2, a type III effector {Pseudomonas syringae pv. phaseolicola [TaxId: 319]} Length = 176 Score = 27.2 bits (60), Expect = 1.3 Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 178 TITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKMCDVP 230 T+T I +L+ +R FL+ R ++ + YR T + R G P Sbjct: 9 TLTSI-HQLSSEERENFLDAHDPMRVYDLNSETSVYRTTQREYVRNGYATGNP 60 >d1tnra_ b.22.1.1 (A:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]} Length = 144 Score = 26.5 bits (58), Expect = 2.1 Identities = 9/30 (30%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Query: 230 PMQHVEG---STQQLKWNSNLLVSFLQNEL 256 P H+ G L W +N +FLQ+ Sbjct: 2 PAAHLIGDPSKQNSLLWRANTDRAFLQDGF 31 >d2dk8a1 a.4.5.85 (A:8-75) DNA-directed RNA polymerase III subunit RPC6, RPO3F {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Score = 26.3 bits (58), Expect = 2.6 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Query: 186 LNPPQRARFLNKLLLKRGLQVSKVSGG--YR 214 + QRA +N+LL L + + + G YR Sbjct: 35 IEAQQRAVAINRLLSMGQLDLLRSNTGLLYR 65 >d1y0ua_ a.4.5.5 (A:) Putative arsenical resistance operon repressor AF0168 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 89 Score = 25.0 bits (54), Expect = 7.6 Identities = 5/22 (22%), Positives = 11/22 (50%) Query: 199 LLKRGLQVSKVSGGYRPTPKGE 220 +L+ G + +V + T G+ Sbjct: 66 VLEAGFCIERVGERWVVTDAGK 87 >d1xm5a_ d.92.1.15 (A:) Hypothetical protein YbeY {Escherichia coli [TaxId: 562]} Length = 152 Score = 24.6 bits (53), Expect = 7.9 Identities = 6/27 (22%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Query: 83 LPSAQKFERWVFEEVLPTLRKTGSYSV 109 LP +F+ W+ V+P ++ ++ Sbjct: 18 LPEESQFQTWL-NAVIPQFQEESEVTI 43 >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Score = 24.8 bits (53), Expect = 8.5 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 5/51 (9%) Query: 90 ERWVFEEVLPTLRKTGSYSVEA-PKLRATSASTVLRVHKHLEELAKQAGLK 139 RW E L + K A R T+ R+ K L +L++Q G+K Sbjct: 256 NRWQSCEALRVMAKIMRECWYANGAARLTAL----RIKKTLSQLSQQEGIK 302 >d3bofa1 c.1.21.2 (A:301-560) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 260 Score = 24.6 bits (53), Expect = 9.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Query: 182 IGERLNPPQRARFLNKLL 199 IGER+NP R + ++ Sbjct: 18 IGERINPAGRKKLWAEMQ 35 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0539 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 920,302 Number of extensions: 41243 Number of successful extensions: 116 Number of sequences better than 10.0: 1 Number of HSP's gapped: 116 Number of HSP's successfully gapped: 12 Length of query: 262 Length of database: 2,407,596 Length adjustment: 84 Effective length of query: 178 Effective length of database: 1,254,276 Effective search space: 223261128 Effective search space used: 223261128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.2 bits)