>gi|254780126|ref|YP_003064539.1| hypothetical protein CLIBASIA_00025 [Candidatus Liberibacter asiaticus str. psy62]
MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN