HHSEARCH alignment of GI: 254780126 and SCOP domain: d1je5a_

Alignment
>d1je5a_ b.40.4.7 (A:) gp2.5 {Bacteriophage T7 [TaxId: 10760]}
Probab=100.00  E-value=1.7e-36  Score=241.78  Aligned_cols=163  Identities=12%  Similarity=0.188  Sum_probs=125.8

Q ss_pred             EEEEEEE-ECCCCCCCCCCCCCCC--CCCCEEEEEEEECCCCHHH---HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             6776899-8331278641123678--8662479999963787899---99999999999875420002210013444434
Q gi|254780126|r    4 LTVKGRL-SYPALDTKVRMKLPDG--SSVEHYGCDIVFPKADTKQ---INAVEACLKTAVTEIFPNVSPDAFLSAVRSKS   77 (216)
Q Consensus         4 vt~kgr~-sYp~L~~P~~~~~~~g--~~~~kYs~~llipK~d~~~---~~~i~~AI~~a~~~~~~~k~~~~~~~~~k~~~   77 (216)
                      .|+.|++ +||||++||+.|...+  .++.+|||+|+||++|+++   +.+|+++++++.+.......     .......
T Consensus         7 ttp~G~a~~Y~~L~kPDt~f~~~~~~~~~g~Ykv~L~v~k~d~~a~~~i~~i~~~~e~a~~~~~~~~~-----~~~~k~~   81 (197)
T d1je5a_           7 TSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYE-----ANPPAVA   81 (197)
T ss_dssp             ECCSEEECSSCEEEEEECCC---CCSCCSCEEEEEEEEETTSHHHHHHHHHHHHHHHHHHHHHHHHHH-----TSCC---
T ss_pred             CCCCCCEECCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHC-----CCCCCCC
T ss_conf             27983234154337898554333467889618999997264177999999999999999999998753-----4565443


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCC------------CCCCEEECCCCCCCCCCCCCCCCCCEEEEEE
Q ss_conf             4665210175455555454456542277389930377------------7788368578747347677401540799999
Q gi|254780126|r   78 ESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNK------------YVQPLLVDRQAQPVSDPREVFYPGCWVIAKL  145 (216)
Q Consensus        78 ~~k~plrDGD~~~~~~~~~~~~~e~~~g~~~i~a~~k------------~~kP~ivD~~~~~i~d~~~~iySGs~~kv~~  145 (216)
                      ..+.|+++++.+.+       +.+++.|.|++++++|            .++|.|||++++||++. ..|||||++||++
T Consensus        82 ~~K~~~~p~~~~~~-------~~~~~~G~~~fk~K~Ka~~~~~kt~~~~~~~P~i~Ds~~~~l~~~-~~i~~Gs~~~v~~  153 (197)
T d1je5a_          82 RGKKPLKPYEGDMP-------FFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDV-PIIGGGSKLKVKY  153 (197)
T ss_dssp             ----CCCCCBCCCS-------EEECSSSEEEEEEEEESEEECTTTCCEEECCCCEECTTSCBCSSC-CCCCTTCEEEEEE
T ss_pred             CCCCCCCCCCCCCC-------CCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCEEECCCCCCCCCC-CCCCCCCEEEEEE
T ss_conf             11135687644577-------753668858999998765024567875544873798989998887-6123686899999


Q ss_pred             EEEEEECCCCCCEEEEEEECEEEEEECCCCCCCC
Q ss_conf             9998640788531169997407997248755566
Q gi|254780126|r  146 NIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS  179 (216)
Q Consensus       146 ~~~pY~~~~~~gkGVs~~L~~VQ~i~dgE~~GG~  179 (216)
                      .++||.++++.|+||+|+|++||+|+++|++||.
T Consensus       154 ~~~py~~~~~~g~Gvsl~L~~VQvi~~~e~~gg~  187 (197)
T d1je5a_         154 SLVPYKWNTAVGASVKLQLESVMLVELATFGGGE  187 (197)
T ss_dssp             EEEEECCCSSCCBEEEEEEEEEEEEECCC-----
T ss_pred             EEEEEEECCCCCEEEEEEEEEEEEEEECCCCCCC
T ss_conf             9855450798863899984469998812677877


SCOP domain information

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Phage ssDNA-binding proteins
domain: gp2.5
species: Bacteriophage T7 [TaxId: 10760]