BLAST/PSIBLAST alignment of GI: 254780126 and GI: 212499744 at iteration 1
>gi|212499744|ref|YP_002308552.1| hypothetical protein APSE240 [Bacteriophage APSE-2] Length = 184
>gi|238898735|ref|YP_002924417.1| APSE-2 prophage; hypothetical [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] Length = 184
>gi|75906033|gb|ABA29382.1| conserved hypothetical protein [Bacteriophage APSE-2] Length = 184
>gi|211731713|gb|ACJ10201.1| conserved hypothetical protein [Bacteriophage APSE-2] Length = 184
>gi|229466495|gb|ACQ68269.1| APSE-2 prophage; conserved hypothetical [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] Length = 184
 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 86/181 (47%), Gaps = 17/181 (9%)

Query: 9   RLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDA 68
           RL++P L    ++    G     Y  + + PK+ T  I  ++A +K  + E + N   + 
Sbjct: 9   RLAFPELFEPTQVS---GQGAFKYRANFLIPKSRTDLIEEIKAGIKHVIGEKWGNKDIEK 65

Query: 69  FLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPV 128
             +++   + +R  LRDGD+K             Y  ++Y+SA NK  +PL++DR   P+
Sbjct: 66  IYNSI-CNNPNRFCLRDGDSK---------EYDGYAGNLYLSASNK-SRPLVIDRNTSPL 114

Query: 129 SDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFK 188
           +      Y GC+V A +    Y+ +    KG S +L GVQFF+  + +     +   EF 
Sbjct: 115 TAQDGRPYSGCYVNATIEFYGYDNN---GKGVSASLRGVQFFRDGDAFTGGGVASVEEFD 171

Query: 189 D 189
           D
Sbjct: 172 D 172