BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780126|ref|YP_003064539.1| hypothetical protein
CLIBASIA_00025 [Candidatus Liberibacter asiaticus str. psy62]
         (216 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|255957555|dbj|BAH96617.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957600|dbj|BAH96653.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957630|dbj|BAH96677.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957635|dbj|BAH96681.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957680|dbj|BAH96717.1| hypothetical protein [Candidatus Liberibacter asiaticus]
          Length = 216

 Score =  216 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 213/216 (98%), Positives = 214/216 (99%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
           MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPK DTKQINAVEACLKTAVTEI
Sbjct: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKTDTKQINAVEACLKTAVTEI 60

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL
Sbjct: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VDRQAQPVS+PREVFY GCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP
Sbjct: 121 VDRQAQPVSNPREVFYAGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180

Query: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216
           KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN
Sbjct: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216


>gi|255957640|dbj|BAH96685.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957645|dbj|BAH96689.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957685|dbj|BAH96721.1| hypothetical protein [Candidatus Liberibacter asiaticus]
          Length = 216

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 214/216 (99%), Positives = 215/216 (99%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
           MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPK DTKQINAVEACLKTAVTEI
Sbjct: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKTDTKQINAVEACLKTAVTEI 60

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL
Sbjct: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VDRQAQPVS+PREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP
Sbjct: 121 VDRQAQPVSNPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180

Query: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216
           KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN
Sbjct: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216


>gi|255957560|dbj|BAH96621.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957565|dbj|BAH96625.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957570|dbj|BAH96629.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957575|dbj|BAH96633.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957580|dbj|BAH96637.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957585|dbj|BAH96641.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957590|dbj|BAH96645.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957595|dbj|BAH96649.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957605|dbj|BAH96657.1| hypothetical protein [Candidatus Liberibacter asiaticus]
          Length = 216

 Score =  215 bits (546), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 212/216 (98%), Positives = 213/216 (98%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
           MQKLTVKGRLSYPALDTKV MKLPDGSSVEHYGCDIVFPK DTKQINAVEACLKTAVTEI
Sbjct: 1   MQKLTVKGRLSYPALDTKVSMKLPDGSSVEHYGCDIVFPKTDTKQINAVEACLKTAVTEI 60

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL
Sbjct: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VDRQAQPVS+PREVFY GCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP
Sbjct: 121 VDRQAQPVSNPREVFYAGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180

Query: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216
           KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN
Sbjct: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216


>gi|254780126|ref|YP_003064539.1| hypothetical protein CLIBASIA_00025 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039803|gb|ACT56599.1| hypothetical protein CLIBASIA_00025 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|317120697|gb|ADV02520.1| hypothetical protein SC1_gp205 [Liberibacter phage SC1]
 gi|317120740|gb|ADV02562.1| hypothetical protein SC2_gp205 [Liberibacter phage SC2]
 gi|317120801|gb|ADV02622.1| hypothetical protein SC2_gp205 [Liberibacter phage SC2]
 gi|317120841|gb|ADV02662.1| hypothetical protein SC1_gp205 [Liberibacter phage SC1]
          Length = 216

 Score =  215 bits (546), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 216/216 (100%), Positives = 216/216 (100%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
           MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI
Sbjct: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL
Sbjct: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP
Sbjct: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180

Query: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216
           KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN
Sbjct: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216


>gi|255957610|dbj|BAH96661.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957615|dbj|BAH96665.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957620|dbj|BAH96669.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957625|dbj|BAH96673.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957650|dbj|BAH96693.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957655|dbj|BAH96697.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957660|dbj|BAH96701.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957665|dbj|BAH96705.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957670|dbj|BAH96709.1| hypothetical protein [Candidatus Liberibacter asiaticus]
 gi|255957675|dbj|BAH96713.1| hypothetical protein [Candidatus Liberibacter asiaticus]
          Length = 216

 Score =  214 bits (545), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 213/216 (98%), Positives = 214/216 (99%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
           MQKLTVKGRLSYPALDTKV MKLPDGSSVEHYGCDIVFPK DTKQINAVEACLKTAVTEI
Sbjct: 1   MQKLTVKGRLSYPALDTKVSMKLPDGSSVEHYGCDIVFPKTDTKQINAVEACLKTAVTEI 60

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL
Sbjct: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VDRQAQPVS+PREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP
Sbjct: 121 VDRQAQPVSNPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180

Query: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216
           KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN
Sbjct: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216


>gi|254781192|ref|YP_003065605.1| hypothetical protein CLIBASIA_05495 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040869|gb|ACT57665.1| hypothetical protein CLIBASIA_05495 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|317120754|gb|ADV02575.1| hypothetical protein UF506_010 [Candidatus Liberibacter asiaticus]
          Length = 198

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 83/197 (42%), Positives = 111/197 (56%), Gaps = 9/197 (4%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
           M K+ +KGRLSYP L    R     G  V  Y  DI+F K D +Q + +E  ++ A  E 
Sbjct: 1   MAKVLIKGRLSYPQLHEP-RAYGDKGDEV--YSADILFSKTDNEQCDKLEQAIREAGEEK 57

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           F   +  A +   R K   R  L+DGD KI++S KPE   + Y    YI+ KNK V+P L
Sbjct: 58  FGGSNMSALIE--RMKRTGRYPLKDGDQKISTSLKPEA-YEVYAGQYYITPKNKKVRPRL 114

Query: 121 VDRQAQPVSDP-REVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           VDR  Q V++  +EVFY GC V A +++ AY      TKG + TLTGVQF K D RWG  
Sbjct: 115 VDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQG--TKGVTFTLTGVQFVKDDTRWGGQ 172

Query: 180 PKSDTSEFKDYGEEQDS 196
            ++ +S+F+ Y EE  S
Sbjct: 173 LRASSSDFESYEEETAS 189


>gi|315656937|ref|ZP_07909824.1| phage-associated protein [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
 gi|315492892|gb|EFU82496.1| phage-associated protein [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
          Length = 184

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 44/192 (22%), Positives = 76/192 (39%), Gaps = 21/192 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T + RLSY  +                Y   ++ PK+DT  I A+E  ++ A+      
Sbjct: 11  VTGEVRLSYAHIWEP----NSIQGGKPKYSVSLIIPKSDTATITAIEKAVEAAIEAGIG- 65

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                F     +K+  +  LRDGD +           + Y  + +++A N    P +VD 
Sbjct: 66  ----KFGGKRPNKAALKLPLRDGDIERDD--------EAYKGAYFLNA-NSLTAPQIVDM 112

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
              P+    EV Y GC+    L+   Y  +    +G +C L  +Q  +  E  G    S 
Sbjct: 113 NVAPILGRAEV-YSGCYARVSLSF--YAFNTNGNRGIACRLGNIQKTRDGETLGGGRVSA 169

Query: 184 TSEFKDYGEEQD 195
            ++F  +  + D
Sbjct: 170 ETDFGSFAADDD 181


>gi|304389854|ref|ZP_07371813.1| phage-associated protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|304327030|gb|EFL94269.1| phage-associated protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
          Length = 183

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 45/192 (23%), Positives = 76/192 (39%), Gaps = 21/192 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T + RLSY  +                Y   ++ PK DT  I A+E  +  A+      
Sbjct: 10  VTGEVRLSYAHVWEP----NSIQGGKPKYSVSLIIPKTDTATITAIEKAVDAAIEAGIG- 64

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                F     +K+  +  LRDGD +           + Y  + +++A N    P +VD+
Sbjct: 65  ----KFGGKRPNKAALKLPLRDGDIERDD--------EAYKGAYFLNA-NSLTAPQIVDQ 111

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
              P+ D  EV Y GC+    L+   Y  +    +G +C L  +Q  +  E  G    S 
Sbjct: 112 SVAPILDRAEV-YSGCYARVSLSF--YAFNTNGNRGIACGLGNIQKTRDGESLGGGRVSA 168

Query: 184 TSEFKDYGEEQD 195
            ++F  +  + D
Sbjct: 169 ETDFGSFAADDD 180


>gi|227875068|ref|ZP_03993213.1| phage-associated protein [Mobiluncus mulieris ATCC 35243]
 gi|304390311|ref|ZP_07372264.1| phage-associated protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|306817355|ref|ZP_07451100.1| phage-associated protein [Mobiluncus mulieris ATCC 35239]
 gi|227844346|gb|EEJ54510.1| phage-associated protein [Mobiluncus mulieris ATCC 35243]
 gi|304326067|gb|EFL93312.1| phage-associated protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|304649796|gb|EFM47076.1| phage-associated protein [Mobiluncus mulieris ATCC 35239]
          Length = 185

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 46/195 (23%), Positives = 78/195 (40%), Gaps = 27/195 (13%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---I 60
           +T + RLSY  +                Y   ++ PK+DT  I A+E  +  A+      
Sbjct: 12  VTGEVRLSYAHVWEP----NSIQGGKPKYSVSLIIPKSDTATIAAIEKAVDAAIDAGTAK 67

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           F    P+        K+  +  LRDGD +           + Y  + +++A N    P +
Sbjct: 68  FGGKRPN--------KAALKLPLRDGDIERDD--------EAYKGAYFLNA-NSLTAPQI 110

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VD+   P+ D  EV Y GC+    L+   Y  +    +G +C L  +Q  +  E  G   
Sbjct: 111 VDQSVAPILDRAEV-YSGCYARVSLSF--YAFNTNGNRGIACGLGNIQKTRDGETLGGGR 167

Query: 181 KSDTSEFKDYGEEQD 195
            S  ++F  +  + D
Sbjct: 168 VSAETDFGAFAADDD 182


>gi|300933486|ref|ZP_07148742.1| phage-associated protein [Corynebacterium resistens DSM 45100]
          Length = 184

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 42/193 (21%), Positives = 79/193 (40%), Gaps = 21/193 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T + RLSY  +     +          Y   ++ PK+DT+ +  +E  +  A+      
Sbjct: 10  VTGEVRLSYANIFEAKSI----QGGKPKYSVSLIIPKSDTETLAKIERAIDAAIDAGIG- 64

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                F     +K+  +  LRDGD +           + Y ++++++A N    P +V  
Sbjct: 65  ----KFGGKRPNKAALKLPLRDGDIERDD--------EAYANAMFVNA-NSTTPPQVVGT 111

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
             QP+ D  EV Y GC+    ++   Y  +    +G +C L  +Q  +  E  G +  S 
Sbjct: 112 DLQPILDANEV-YSGCYARVSISF--YAFNTNGNRGIACGLGNIQKLRDGEPLGGNRISA 168

Query: 184 TSEFKDYGEEQDS 196
            ++F  +    D 
Sbjct: 169 EADFGGFAAASDD 181


>gi|260579055|ref|ZP_05846954.1| conserved hypothetical protein [Corynebacterium jeikeium ATCC
           43734]
 gi|258602806|gb|EEW16084.1| conserved hypothetical protein [Corynebacterium jeikeium ATCC
           43734]
          Length = 176

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 42/193 (21%), Positives = 79/193 (40%), Gaps = 21/193 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T + RLSY  +     +          Y   ++ PK+DT+ +  +E  +  A+      
Sbjct: 2   VTGEVRLSYANIFEAKSI----QGGKPKYSVSLIIPKSDTETLAKIERAIDAAIDAGIG- 56

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                F     +K+  +  LRDGD +           + Y ++++++A N    P +V  
Sbjct: 57  ----KFGGKRPNKAALKLPLRDGDIERDD--------EAYANAMFVNA-NSTTPPQVVGT 103

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
             QP+ D  EV Y GC+    ++   Y  +    +G +C L  +Q  +  E  G +  S 
Sbjct: 104 DLQPILDANEV-YSGCYARVSISF--YAFNTNGNRGIACGLGNIQKLRDGEPLGGNRISA 160

Query: 184 TSEFKDYGEEQDS 196
            ++F  +    D 
Sbjct: 161 EADFGGFAAASDD 173


>gi|313813475|gb|EFS51189.1| conserved hypothetical protein [Propionibacterium acnes HL025PA1]
          Length = 181

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 50/193 (25%), Positives = 78/193 (40%), Gaps = 27/193 (13%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---I 60
           +T + RLSY  +                Y   ++ PKADT  I A+E  +  A+      
Sbjct: 10  VTGEVRLSYAHVWEP----NSIQGGKPKYSVSLIIPKADTTTITAIEKAIDAAIDAGTAK 65

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           F    P+        K+  +  LRDGD +           + Y +S +++A N    P +
Sbjct: 66  FGGKRPN--------KAALKLPLRDGDTERDD--------EAYANSFFVNA-NSLTPPQV 108

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VD    P+ D  EV Y GC+    L+   Y  +    KG +C L  +Q  +  E  GA  
Sbjct: 109 VDENVSPILDRSEV-YSGCYARVSLSF--YAFNTNGNKGVACGLGNIQKIRDGEPLGAGR 165

Query: 181 KSDTSEFKDYGEE 193
            S  S+F    ++
Sbjct: 166 VSAESDFGAPADD 178


>gi|116630095|ref|YP_815267.1| hypothetical protein LGAS_1472 [Lactobacillus gasseri ATCC 33323]
 gi|116095677|gb|ABJ60829.1| hypothetical protein LGAS_1472 [Lactobacillus gasseri ATCC 33323]
          Length = 198

 Score =  164 bits (415), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 79/192 (41%), Gaps = 22/192 (11%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           +  RLSY  +     +        E Y   ++ PK+D K I A+E  +  A+ E      
Sbjct: 26  INTRLSYANIWEPKSI----NGGKEKYSVSLIIPKSDQKTITAIEKAIDAAIQEGIG--- 78

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
              F     +K+  +  LRDGD +   +         Y DS +I+A N    P +VD+  
Sbjct: 79  --KFGGKKPNKATLKLPLRDGDVERDDA--------AYQDSYFINA-NSITAPQIVDKHV 127

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           QP+ D  EV Y GC+    +N   Y  +    +G +C L  +Q  +  E  G    +   
Sbjct: 128 QPILDRNEV-YSGCYARVSINF--YAFNTNGNRGIACGLGNIQKIRDGEPLGGHASASN- 183

Query: 186 EFKDYGEEQDSD 197
           +F    +  D D
Sbjct: 184 DFTAIDDSSDDD 195


>gi|227497453|ref|ZP_03927685.1| phage-associated protein [Actinomyces urogenitalis DSM 15434]
 gi|226833078|gb|EEH65461.1| phage-associated protein [Actinomyces urogenitalis DSM 15434]
          Length = 182

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 76/195 (38%), Gaps = 27/195 (13%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---I 60
           +T + RLSY  L            S   Y   ++ PK+D + I  +E  +  A+      
Sbjct: 9   VTGEVRLSYAHLFEP----QSIQRSKPKYSVSLIIPKSDRETIGKIERAIDAAIEAGTAK 64

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           F    P+        K+  +  LRDGD +           + Y    +++A N  + P +
Sbjct: 65  FGGKRPN--------KAALKLPLRDGDTERDD--------EAYAGCFFVNA-NSTLPPEV 107

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VD+   PV  P EV Y GC+    L+   Y  +    +G +C L  VQ  +  E  G   
Sbjct: 108 VDQDLNPVLSPAEV-YSGCYARVSLSF--YAFNTNGNRGIACGLGNVQKLRDGEPLGGGR 164

Query: 181 KSDTSEFKDYGEEQD 195
            S   +F  +    D
Sbjct: 165 TSAADDFAAFSAGDD 179


>gi|227544663|ref|ZP_03974712.1| phage-associated protein [Lactobacillus reuteri CF48-3A]
 gi|300909420|ref|ZP_07126881.1| conserved hypothetical protein [Lactobacillus reuteri SD2112]
 gi|227185388|gb|EEI65459.1| phage-associated protein [Lactobacillus reuteri CF48-3A]
 gi|300893285|gb|EFK86644.1| conserved hypothetical protein [Lactobacillus reuteri SD2112]
          Length = 191

 Score =  164 bits (414), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 79/192 (41%), Gaps = 22/192 (11%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           +  RLSY  +     +        E Y   ++ PK+D K I A+E  +  A+ E      
Sbjct: 19  INTRLSYANVWEPKSI----NGGKEKYSVSLIIPKSDKKTITAIEKAIDAAIQEGIG--- 71

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
              F     +K+  +  LRDGD +           + Y +S +I+A N    P +VD+  
Sbjct: 72  --KFGGKKPNKATLKLPLRDGDVERDD--------EAYQNSYFINA-NSITAPQIVDKHV 120

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           QP+ D  EV Y GC+    +N   Y  +    +G +C L  +Q  +  E  G    +   
Sbjct: 121 QPILDRTEV-YSGCYARVSINF--YAFNTNGNRGIACGLGNIQKIRDGEPLGGHASAS-D 176

Query: 186 EFKDYGEEQDSD 197
           +F    +  D D
Sbjct: 177 DFTAIDDNSDDD 188


>gi|50843071|ref|YP_056298.1| phage-associated protein [Propionibacterium acnes KPA171202]
 gi|50840673|gb|AAT83340.1| conserved phage-associated protein [Propionibacterium acnes
           KPA171202]
 gi|315106930|gb|EFT78906.1| conserved hypothetical protein [Propionibacterium acnes HL030PA1]
          Length = 181

 Score =  164 bits (414), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 49/190 (25%), Positives = 77/190 (40%), Gaps = 21/190 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T + RLSY  +                Y   ++ PKADT  I A+E  +  A+      
Sbjct: 10  VTGEVRLSYAHVWEP----NSIQGGKPKYSVSLIIPKADTTTITAIEKAIDAAIDAGTA- 64

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                F     +K+  +  LRDGD +           + Y +S +++A N    P +VD 
Sbjct: 65  ----KFGGKRSNKAALKLPLRDGDTERDD--------EAYANSFFVNA-NSLTPPQVVDE 111

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
              P+ D  EV Y GC+    L+   Y  +    KG +C L  +Q  +  E  GA   S 
Sbjct: 112 NVSPILDRSEV-YSGCYARVSLSF--YAFNTNGNKGVACGLGNIQKIRDGEPLGAGRVSA 168

Query: 184 TSEFKDYGEE 193
            S+F    ++
Sbjct: 169 ESDFGAPADD 178


>gi|300933388|ref|ZP_07148644.1| phage-associated protein [Corynebacterium resistens DSM 45100]
          Length = 185

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 78/196 (39%), Gaps = 27/196 (13%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---I 60
           +T + RLSY  +     +          Y   ++ PK+DT  +N +E  +  A+      
Sbjct: 11  VTGEVRLSYANIFEAKSI----QGGKPKYSVSLIIPKSDTDTLNRIERAIDAAIDAGTAK 66

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           F    P+            +  LRDGD +           + Y ++++++A N    P +
Sbjct: 67  FGGKRPNKV--------ALKLPLRDGDIERDD--------EAYANAMFVNA-NSTTPPQV 109

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           V    QP+ D  EV Y GC+    ++   Y  +    +G +C L  +Q  +  E  G + 
Sbjct: 110 VGTDLQPILDATEV-YSGCYARVSISF--YAFNTNGNRGIACGLGNIQKLREGEPLGGNR 166

Query: 181 KSDTSEFKDYGEEQDS 196
            S  ++F  +    D 
Sbjct: 167 ISAEADFGGFAAASDD 182


>gi|313895637|ref|ZP_07829193.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975763|gb|EFR41222.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 185

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 50/196 (25%), Positives = 84/196 (42%), Gaps = 21/196 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K RLSY  +   V +        E Y   ++ PK+DTK +  ++A +  A+      
Sbjct: 11  ITGKVRLSYAHVWEPVSI----NGGEEKYSVSLIIPKSDTKTVKDIQAAVDAAIEAGIG- 65

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                F     +K   +  LRDGD +  +        + Y D+ +I+A N    P +V+R
Sbjct: 66  ----KFGGKKPNKGAIKLPLRDGDVERPND-------ENYKDAYFINA-NARTAPQIVNR 113

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
           + QP+ D  EV Y GC+    + +  Y  +    KG +C L  +Q  +  E  G    + 
Sbjct: 114 KVQPILDRDEV-YSGCYARVSITL--YAFNSNGNKGIACGLGNIQKLEDGEPLGGRSSAA 170

Query: 184 TSEFKDYGEEQDSDTS 199
             +F+    E +   S
Sbjct: 171 -LDFESLDGEDEDFLS 185


>gi|218133414|ref|ZP_03462218.1| hypothetical protein BACPEC_01279 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990789|gb|EEC56795.1| hypothetical protein BACPEC_01279 [Bacteroides pectinophilus ATCC
           43243]
          Length = 180

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 51/198 (25%), Positives = 78/198 (39%), Gaps = 29/198 (14%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE- 59
           + K+ V  RLSY  L     +      S   Y    +  K D + I  ++  ++ A  E 
Sbjct: 6   LTKVIVPCRLSYAHLWEPDSI----NGSEPKYSVSCIIDKEDKETIAKIKKAIEIAKDEG 61

Query: 60  --IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ 117
              +    P          +  +  LRDGD             + Y DS++++A N    
Sbjct: 62  KGKWGGKIP----------ANLKTPLRDGDIDRPED-------EAYADSMFLNA-NSKQA 103

Query: 118 PLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWG 177
           P +VDRQ QP+ D  EV Y GC+    +   AY  +    KG +  L  VQ  +  E  G
Sbjct: 104 PQIVDRQVQPILDQSEV-YSGCYGRVSITFYAY--NSNGNKGIAAGLGNVQKLRDGEPLG 160

Query: 178 ASPKSDTSEFKDYGEEQD 195
           +   +   EF+    E D
Sbjct: 161 SRANAK-DEFEAVDAEDD 177


>gi|315654970|ref|ZP_07907875.1| phage-associated protein [Mobiluncus curtisii ATCC 51333]
 gi|315490931|gb|EFU80551.1| phage-associated protein [Mobiluncus curtisii ATCC 51333]
          Length = 190

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 43/192 (22%), Positives = 78/192 (40%), Gaps = 22/192 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T + RLSY  +     +          +   ++ PK D   I+A+   ++ A+ E    
Sbjct: 18  ITGEIRLSYANVWEAKSI----NGGKPKFSVSLLIPKDDAATIDAINTAIEAAIQEGIG- 72

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                F   +  ++  +  LRDGD +           + Y    +++A N    P +VD+
Sbjct: 73  ----KFGGKIPPRASLKLPLRDGDTERDD--------EAYAGHYFVNA-NSINAPQIVDQ 119

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
              P+ D  EV Y GC+    +N   Y  +    +G +C L  +Q  +  E  G    + 
Sbjct: 120 DVNPILDRSEV-YSGCYGRVSINF--YAFNTNGNRGVACGLGNIQKTRDGEPLGGHVSAA 176

Query: 184 TSEFKDYGEEQD 195
            SEF  +  ++D
Sbjct: 177 -SEFDTWDADED 187


>gi|227530262|ref|ZP_03960311.1| phage-associated protein [Lactobacillus vaginalis ATCC 49540]
 gi|227349816|gb|EEJ40107.1| phage-associated protein [Lactobacillus vaginalis ATCC 49540]
          Length = 191

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 80/192 (41%), Gaps = 22/192 (11%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           +  RLSY  +     +        E Y   ++ PK+D K ++A+E  +  A+ E      
Sbjct: 19  INTRLSYANIWEPKSI----NGGKEKYSVSLIIPKSDQKTVSAIEKAIDAAIQEGIG--- 71

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
              F     +K+  +  LRDGD +   +         Y DS +I+A N    P +VD+  
Sbjct: 72  --KFGGKKPNKATLKLPLRDGDVERDDA--------AYQDSYFINA-NSITAPQIVDKHV 120

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           QP+ D  EV Y GC+    +N   Y  +    +G +C L  +Q  +  E  G    +   
Sbjct: 121 QPILDRDEV-YSGCYARVSINF--YAFNTNGNRGIACGLGNIQKIRDGEPLGGHASAS-D 176

Query: 186 EFKDYGEEQDSD 197
           +F    +  D D
Sbjct: 177 DFTAIDDSNDDD 188


>gi|254975141|ref|ZP_05271613.1| hypothetical protein CdifQC_07495 [Clostridium difficile QCD-66c26]
 gi|255314268|ref|ZP_05355851.1| hypothetical protein CdifQCD-7_07955 [Clostridium difficile
           QCD-76w55]
 gi|255516948|ref|ZP_05384624.1| hypothetical protein CdifQCD-_07529 [Clostridium difficile
           QCD-97b34]
 gi|255650050|ref|ZP_05396952.1| hypothetical protein CdifQCD_07674 [Clostridium difficile
           QCD-37x79]
 gi|260686787|ref|YP_003217920.1| hypothetical protein CDR20291_1423 [Clostridium difficile R20291]
 gi|306519585|ref|ZP_07405932.1| hypothetical protein CdifQ_05402 [Clostridium difficile QCD-32g58]
 gi|260212803|emb|CBE03969.1| putative uncharacterized protein [Clostridium difficile R20291]
          Length = 190

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 72/184 (39%), Gaps = 19/184 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K RLSY  +    + +     +   Y   I+ PK+D   +  ++  +  A  +   +
Sbjct: 11  VTGKVRLSYCNI---FKSRAMVEGAEPKYSVCILIPKSDKVTLGRIKKAIDAAKEQGKTS 67

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +     +  LRDGDA+ A         + Y    +++A N   +P +VD+
Sbjct: 68  KWGG------KLPGNLKTPLRDGDAERADEA------EEYVGMYFLNA-NSTQKPGIVDK 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
               + D  EV Y GC+    +N   Y       KG  C L  VQ     E  G +  S 
Sbjct: 115 DLNEILDNTEV-YSGCYGRVSINFFPYNSAGN--KGIGCGLQNVQKLADGEVLGGARASA 171

Query: 184 TSEF 187
            ++F
Sbjct: 172 EADF 175


>gi|167757896|ref|ZP_02430023.1| hypothetical protein CLOSCI_00227 [Clostridium scindens ATCC 35704]
 gi|167664550|gb|EDS08680.1| hypothetical protein CLOSCI_00227 [Clostridium scindens ATCC 35704]
          Length = 197

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 44/182 (24%), Positives = 74/182 (40%), Gaps = 18/182 (9%)

Query: 1   MQKLT-VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M+ +T    R SY  +                Y   ++ PK+DT  IN ++A ++ A  E
Sbjct: 19  MKVITGPNTRWSYANVWEP----KAINGGTPKYSVSLIIPKSDTVTINKIKAAIEAAYKE 74

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                       +V + S  +  LRDGD +           + Y ++ +++A N    P 
Sbjct: 75  --GEAKLKGNGRSVPALSVLKTPLRDGDVERPDD-------EAYANAYFVNA-NSTTAPG 124

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +VD   QP+ +  EV Y G +  A +N   Y  +    KG +C L  +Q  +  E  G  
Sbjct: 125 IVDADRQPILERSEV-YSGVYGRASINF--YAFNSNGNKGIACGLNNLQKIRDGEPLGGK 181

Query: 180 PK 181
            +
Sbjct: 182 SR 183


>gi|225573257|ref|ZP_03782012.1| hypothetical protein RUMHYD_01448 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039389|gb|EEG49635.1| hypothetical protein RUMHYD_01448 [Blautia hydrogenotrophica DSM
           10507]
          Length = 197

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 44/182 (24%), Positives = 74/182 (40%), Gaps = 18/182 (9%)

Query: 1   MQKLT-VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M+ +T    R SY  +                Y   ++ PK+DT  IN ++A ++ A  E
Sbjct: 19  MKLITGPNTRWSYANVWEP----KAINGGTPKYSVSLIIPKSDTVTINRIKAAIEAAYKE 74

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                       +V + S  +  LRDGD +           + Y ++ +++A N    P 
Sbjct: 75  --GEAKLKGNGRSVPALSVLKTPLRDGDVERPDD-------EAYANAYFVNA-NSTTAPG 124

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +VD   QP+ +  EV Y G +  A +N   Y  +    KG +C L  +Q  +  E  G  
Sbjct: 125 IVDADRQPILERSEV-YSGVYGRASINF--YAFNSNGNKGIACGLNNLQKIRDGEPLGGK 181

Query: 180 PK 181
            +
Sbjct: 182 SR 183


>gi|255092531|ref|ZP_05322009.1| hypothetical protein CdifC_07702 [Clostridium difficile CIP 107932]
 gi|260683191|ref|YP_003214476.1| hypothetical protein CD196_1448 [Clostridium difficile CD196]
 gi|260209354|emb|CBA62782.1| putative uncharacterized protein [Clostridium difficile CD196]
          Length = 190

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 72/184 (39%), Gaps = 19/184 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K RLSY  +    + +     +   Y   I+ PK+D   +  ++  +  A  +   +
Sbjct: 11  VTGKVRLSYCNI---FKSRAMVEGAEPKYSVCILIPKSDKVTLGRIKKAIDAAKEQGKTS 67

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +     +  LRDGDA+ A         + Y    +++A N   +P +VD+
Sbjct: 68  KWGG------KLPGNLKTPLRDGDAERADEA------EEYVGMYFLNA-NSTQKPGIVDK 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
               + D  EV Y GC+    +N   Y       KG  C L  VQ     E  G +  S 
Sbjct: 115 DLNEILDNTEV-YSGCYGRVSINFFPYNSAGN--KGIGCGLQNVQKLVDGEVLGGARASA 171

Query: 184 TSEF 187
            ++F
Sbjct: 172 EADF 175


>gi|238854130|ref|ZP_04644477.1| conserved phage-associated protein [Lactobacillus gasseri 202-4]
 gi|238833206|gb|EEQ25496.1| conserved phage-associated protein [Lactobacillus gasseri 202-4]
          Length = 183

 Score =  161 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 79/192 (41%), Gaps = 22/192 (11%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           +  RLSY  +     +        E Y   ++ PK+D K I A+E  +  A+ E      
Sbjct: 11  INTRLSYANIWEPKSI----NGGKEKYSVSLIIPKSDQKTITAIEKAIDAAIQEGIG--- 63

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
              F     +K+  +  LRDGD +   +         Y DS +I+A N    P +VD+  
Sbjct: 64  --KFGGKKPNKATLKLPLRDGDVERDDA--------AYQDSYFINA-NSITAPQIVDKHV 112

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           QP+ D  EV Y GC+    +N   Y  +    +G +C L  +Q  +  E  G    +   
Sbjct: 113 QPILDRNEV-YSGCYARVSINF--YAFNTNGNRGIACGLGNIQKIRDGEPLGGHASASN- 168

Query: 186 EFKDYGEEQDSD 197
           +F    +  D D
Sbjct: 169 DFTAIDDSSDDD 180


>gi|154504841|ref|ZP_02041579.1| hypothetical protein RUMGNA_02351 [Ruminococcus gnavus ATCC 29149]
 gi|153794724|gb|EDN77144.1| hypothetical protein RUMGNA_02351 [Ruminococcus gnavus ATCC 29149]
          Length = 180

 Score =  161 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 51/198 (25%), Positives = 78/198 (39%), Gaps = 29/198 (14%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE- 59
           + K+ V  RLSY  L     +      S   Y    +  K D + I  ++  ++ A  E 
Sbjct: 6   LTKVIVPCRLSYAHLWEPDSI----NGSEPKYSVSCIIDKNDKETIAKIKKAIEVAKDEG 61

Query: 60  --IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ 117
              +    P          +  +  LRDGD             + Y DS++++A N    
Sbjct: 62  KGKWGGKIP----------ANLKTPLRDGDIDRPED-------EAYADSMFLNA-NSKQA 103

Query: 118 PLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWG 177
           P +VDRQ QP+ D  EV Y GC+    +   AY  +    KG +  L  VQ  +  E  G
Sbjct: 104 PQIVDRQVQPILDQSEV-YSGCYGRVSITFYAY--NSNGNKGIAAGLGNVQKLRDGEPLG 160

Query: 178 ASPKSDTSEFKDYGEEQD 195
           +   +   EF+    E D
Sbjct: 161 SRANAK-DEFEAVDAEDD 177


>gi|255306558|ref|ZP_05350729.1| hypothetical protein CdifA_08197 [Clostridium difficile ATCC 43255]
          Length = 190

 Score =  161 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 42/184 (22%), Positives = 72/184 (39%), Gaps = 19/184 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K RLSY  +    + +     +   Y   I+ PK+D   +  ++  +  A  +   +
Sbjct: 11  VTGKVRLSYCNI---FKSRAMVEGAEPKYSVCILIPKSDKVTLGRIKKAIDAAKEQGKTS 67

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +     +  +RDGDA+ A         + Y    +++A N   +P +VD+
Sbjct: 68  KWGG------KLPGNLKTPIRDGDAERADEA------EEYVGMYFLNA-NSTQKPGIVDK 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
               + D  EV Y GC+    +N   Y       KG  C L  VQ     E  G +  S 
Sbjct: 115 DLNEILDNTEV-YSGCYGRVSINFFPYNSAGN--KGIGCGLQNVQKLADGEVLGGARASA 171

Query: 184 TSEF 187
            ++F
Sbjct: 172 EADF 175


>gi|134299052|ref|YP_001112548.1| hypothetical protein Dred_1189 [Desulfotomaculum reducens MI-1]
 gi|134051752|gb|ABO49723.1| conserved hypothetical protein [Desulfotomaculum reducens MI-1]
          Length = 185

 Score =  160 bits (405), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 42/197 (21%), Positives = 69/197 (35%), Gaps = 28/197 (14%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI--- 60
           +T K RLSY  +      +  +      Y   I+ PK+DT  +  V+A +  A       
Sbjct: 10  VTGKVRLSYANVWEP---RAAEEGQDPKYSLCILIPKSDTATLRKVKAAIDAAKEAGKSL 66

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           +    P             +  LRDGD               Y    +++A N   +P +
Sbjct: 67  WGGKIP----------PNLKLPLRDGDIDRPDQ-------PEYAGHFFLNA-NSKQKPGI 108

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VD+   P+ D  EV Y GC+    +N   +       KG  C L  +Q     E      
Sbjct: 109 VDKNVNPILDQSEV-YSGCYGRVSVNFFPFNQKGN--KGVGCGLMNIQKVADGEPLSGRT 165

Query: 181 KSDTSEFKDYGEEQDSD 197
           +    +F+   +    +
Sbjct: 166 R-PEDDFEAIDDGDVEE 181


>gi|268610651|ref|ZP_06144378.1| hypothetical protein RflaF_14287 [Ruminococcus flavefaciens FD-1]
          Length = 188

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 43/181 (23%), Positives = 71/181 (39%), Gaps = 18/181 (9%)

Query: 4   LTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFP 62
           +T K  R SY  ++               Y   ++ PK DT  I  ++A ++ A  E   
Sbjct: 11  ITGKNTRFSYLVVNEP----KAINGGTPKYSVSLIIPKTDTVTIEKIKAAIQAAYEE--G 64

Query: 63  NVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVD 122
                    +V +    +  LRDGD +           + Y    +I+A N   +P +VD
Sbjct: 65  QSKLKGNGKSVPALKVLKTPLRDGDEERPDD-------EAYAGCYFINA-NSATKPGVVD 116

Query: 123 RQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
              QP+ D  E  Y G +  A +N   Y  +    KG +C L  +Q  +  E  G   ++
Sbjct: 117 ADCQPILDTSE-LYSGIYGRASINF--YAFNTNGNKGIACGLNNLQKIRDGEPLGGKSRA 173

Query: 183 D 183
           +
Sbjct: 174 E 174


>gi|256847833|ref|ZP_05553278.1| conserved hypothetical protein [Lactobacillus coleohominis
           101-4-CHN]
 gi|256715522|gb|EEU30498.1| conserved hypothetical protein [Lactobacillus coleohominis
           101-4-CHN]
          Length = 190

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/192 (26%), Positives = 80/192 (41%), Gaps = 23/192 (11%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           +  RLSY  +     +        E Y   ++ PK+D K +NA+E  + TA+ E      
Sbjct: 19  INTRLSYANIWEPKSI----NGGKEKYSVSLIIPKSDQKTVNAIEKAIDTAIQEGIG--- 71

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
              F     +K+  +  LRDGD +             Y DS +I+A N    P +VD+  
Sbjct: 72  --KFGGKKPNKATLKLPLRDGDVERD---------DAYQDSYFINA-NSITAPQIVDKHV 119

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           QP+ D  EV Y GC+    +N   Y  +    +G +C L  +Q  +  E  G    +   
Sbjct: 120 QPILDRDEV-YSGCYARVSINF--YAFNTNGNRGIACGLGNIQKIRDGEPLGGHASAS-D 175

Query: 186 EFKDYGEEQDSD 197
           +F    +  D D
Sbjct: 176 DFTAIDDNSDDD 187


>gi|167039878|ref|YP_001662863.1| hypothetical protein Teth514_1233 [Thermoanaerobacter sp. X514]
 gi|300915371|ref|ZP_07132685.1| conserved hypothetical protein [Thermoanaerobacter sp. X561]
 gi|307724798|ref|YP_003904549.1| hypothetical protein Thet_1676 [Thermoanaerobacter sp. X513]
 gi|166854118|gb|ABY92527.1| hypothetical protein Teth514_1233 [Thermoanaerobacter sp. X514]
 gi|300888647|gb|EFK83795.1| conserved hypothetical protein [Thermoanaerobacter sp. X561]
 gi|307581859|gb|ADN55258.1| hypothetical protein Thet_1676 [Thermoanaerobacter sp. X513]
          Length = 186

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 45/180 (25%), Positives = 73/180 (40%), Gaps = 20/180 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T   RLSY  +     +        E Y   ++  K+DTK ++A+   +  A+ E    
Sbjct: 14  VTGVVRLSYANVWEPKSI----NGGAEKYSVSLIIHKSDTKTLSAINEAVNAAIEEGKG- 68

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                F   + +K+  +  LRDGD             + Y +S +I+A N    P +VDR
Sbjct: 69  ----KFGGKIPNKAALKLPLRDGDIDRPDD-------EAYANSYFINA-NSNTPPQIVDR 116

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
              P+ D  EV Y G +    +N   Y  +    KG +C L  +Q  +  E  G    + 
Sbjct: 117 NVNPIIDRSEV-YSGVYARVSINF--YAFNSNGNKGIACGLGNIQKIRDGEPLGGRTNAA 173


>gi|227544276|ref|ZP_03974325.1| phage-associated protein [Lactobacillus reuteri CF48-3A]
 gi|300909465|ref|ZP_07126926.1| phage-associated protein [Lactobacillus reuteri SD2112]
 gi|227185736|gb|EEI65807.1| phage-associated protein [Lactobacillus reuteri CF48-3A]
 gi|300893330|gb|EFK86689.1| phage-associated protein [Lactobacillus reuteri SD2112]
          Length = 191

 Score =  160 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 79/192 (41%), Gaps = 22/192 (11%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           +  RLSY  +     +        E Y   ++ PK+D K + A+E  +  ++ E      
Sbjct: 19  INTRLSYANIWEPKSI----NGGKEKYSVSLIIPKSDQKTVTAIEKAIDASIQEGIG--- 71

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
              F     +K+  +  LRDGD +   +         Y DS +I+A N    P +VD+  
Sbjct: 72  --KFGGKKPNKATLKLPLRDGDVERDDA--------AYQDSYFINA-NSITAPQIVDKHV 120

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           QP+ D  EV Y GC+    +N   Y  +    +G +C L  +Q  +  E  G    +   
Sbjct: 121 QPILDRDEV-YSGCYARVSINF--YAFNTNGNRGIACGLGNIQKIRDGEPLGGHASA-ND 176

Query: 186 EFKDYGEEQDSD 197
           +F    +  D D
Sbjct: 177 DFTAIDDSNDDD 188


>gi|153814240|ref|ZP_01966908.1| hypothetical protein RUMTOR_00449 [Ruminococcus torques ATCC 27756]
 gi|145848636|gb|EDK25554.1| hypothetical protein RUMTOR_00449 [Ruminococcus torques ATCC 27756]
          Length = 180

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 51/198 (25%), Positives = 78/198 (39%), Gaps = 29/198 (14%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE- 59
           + K+ V  RLSY  L     +      S   Y    +  K D + I  ++  ++TA  E 
Sbjct: 6   LTKVIVPCRLSYAHLWEPDSI----NGSEPKYSVSCIIDKNDKETIAKIKKAIETAKDEG 61

Query: 60  --IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ 117
              +    P          +  +  LRDGD             + Y DS++++A N    
Sbjct: 62  KGKWGGKIP----------ANLKTPLRDGDIDRPED-------EAYADSMFLNA-NSKQA 103

Query: 118 PLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWG 177
           P +VDRQ QP+ D  EV Y GC+    +   AY  +    KG +  L  VQ  +     G
Sbjct: 104 PQIVDRQVQPILDQSEV-YSGCYGRVSITFYAY--NSNGNKGIAAGLGNVQKLRDGAPLG 160

Query: 178 ASPKSDTSEFKDYGEEQD 195
           +   +   EF+    E D
Sbjct: 161 SRANAK-DEFEAVDAEDD 177


>gi|315121966|ref|YP_004062455.1| hypothetical protein CKC_01080 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495368|gb|ADR51967.1| hypothetical protein CKC_01080 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 214

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 134/216 (62%), Positives = 166/216 (76%), Gaps = 2/216 (0%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
           MQ + +KGRLSYPALD   +M L D S +E++G DI+ PK + + I      L+ A  + 
Sbjct: 1   MQSIKIKGRLSYPALDKMTKMTLGDNSVMEYFGADIIIPKTNKETIARFTEVLRKAAKDS 60

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           +PN++PD F+   R     R +++DGD KIA++ KPE YT+ YT+S YISAKNK VQPLL
Sbjct: 61  YPNMNPDRFIEQARINK--RAIIKDGDEKIATATKPETYTKAYTNSWYISAKNKLVQPLL 118

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VDRQAQ VS+PR+VFY GCWVIAKLNI  YEL  +KTKGFSCTLTGVQFFK+DERWGASP
Sbjct: 119 VDRQAQIVSNPRDVFYAGCWVIAKLNISTYELGTFKTKGFSCTLTGVQFFKNDERWGASP 178

Query: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216
           K++ SEF DYGEE+DSD+SVS+FASAE + DALPWN
Sbjct: 179 KANASEFDDYGEEEDSDSSVSSFASAETEPDALPWN 214


>gi|291556515|emb|CBL33632.1| Protein of unknown function (DUF2815) [Eubacterium siraeum V10Sc8a]
          Length = 190

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 44/194 (22%), Positives = 74/194 (38%), Gaps = 18/194 (9%)

Query: 1   MQKLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M+ +T K  R SY  +      K  +G +   +   ++ PK DT  +  ++A ++ A  E
Sbjct: 11  MKVITGKDTRWSYANVWE---AKSINGGT-PKFSVSLIIPKTDTVTVQKIKAAIQAAYEE 66

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                        V   +  +  LRDGD +             Y    +++A N    P 
Sbjct: 67  --GQAKLKGNGRTVPPLTAIKTPLRDGDTERPDD-------PAYAGCYFVNA-NSATAPG 116

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +VD    P+    EV Y G +  A +N   Y  +    KG +C L  +Q  +  E  G  
Sbjct: 117 IVDADCNPILTRSEV-YSGVYGRASINF--YAFNSNGNKGIACGLNNLQKIRDGEPLGGK 173

Query: 180 PKSDTSEFKDYGEE 193
             + +    D  E+
Sbjct: 174 SSAASDFSTDDDED 187


>gi|226949734|ref|YP_002804825.1| conserved phage-associated protein [Clostridium botulinum A2 str.
           Kyoto]
 gi|226843803|gb|ACO86469.1| conserved phage-associated protein [Clostridium botulinum A2 str.
           Kyoto]
          Length = 206

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 49/195 (25%), Positives = 76/195 (38%), Gaps = 29/195 (14%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVT---EIF 61
           T K RLSY  L            +   Y   ++ PK DT+ + A++     A       +
Sbjct: 35  TGKVRLSYAHLFEP----HAIEGNEPKYSVSVIIPKTDTETLKAIKEATNEAKELGKSKW 90

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
               P          +  +  LRDGD +           + Y +  +++A N   +P +V
Sbjct: 91  NGKVP----------ATLKTPLRDGDTERPDD-------EAYANCYFLNA-NSKNKPGVV 132

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           D+  QPV D  EV Y GC+    LN  AY       KG +C L  VQ  +  E  G   +
Sbjct: 133 DKNVQPVLDATEV-YSGCYARLTLNFYAYSASGN--KGIACGLGNVQKLEDGEPLGGFTR 189

Query: 182 SDTSEFKDYGEEQDS 196
           ++  +F      +D 
Sbjct: 190 AE-DDFDSVETAEDD 203


>gi|237738627|ref|ZP_04569108.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
 gi|229424110|gb|EEO39157.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
          Length = 192

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 69/189 (36%), Gaps = 15/189 (7%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K RLSY  L         +    E Y C I+ PK D +    ++A +  A+ +   +
Sbjct: 8   MTGKVRLSYVHLFKP---YAAEKGQEEKYSCTILVPKTDVQTKMKLDAAINAAIEKGISS 64

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNK-YVQPLLVD 122
           V             +    + DGD    S  +   +          +A  K   QP +VD
Sbjct: 65  VWNGVK------PPKPTIPIYDGDGVRPSDGQ--EFGPECKGHWVFTASAKIDYQPGIVD 116

Query: 123 RQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
            +AQP+ +  E  Y G +    +N   Y +     KG  C L  VQ     E   A    
Sbjct: 117 VRAQPILNQSE-IYSGIYARVSVNFFPYAVSGK--KGIGCGLGNVQKLMDGEPLSAVGIK 173

Query: 183 DTSEFKDYG 191
             +EF +  
Sbjct: 174 AENEFDEVE 182


>gi|327461123|gb|EGF07456.1| hypothetical protein HMPREF9394_0989 [Streptococcus sanguinis
           SK1057]
          Length = 177

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 47/196 (23%), Positives = 77/196 (39%), Gaps = 29/196 (14%)

Query: 2   QKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE-- 59
            K+ V GRLSY  +            S   Y   ++ PK+D   I  ++  ++ A  E  
Sbjct: 5   TKVIVPGRLSYANVWEP----QSINGSEPKYSVSVIIPKSDKATIQKIQQAVEQAKQEAI 60

Query: 60  -IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP 118
             F    P          +  +  LRDGD             + Y +S +I+  N   +P
Sbjct: 61  SKFGGKIP----------ANLKLPLRDGDIDRPDD-------EAYANSYFINC-NSKQKP 102

Query: 119 LLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGA 178
            +VD+Q QP+ D  EV Y GC+    +    Y  +    +G +  L  +Q  K  E  G 
Sbjct: 103 QVVDQQVQPILDQTEV-YSGCYGRVSVTF--YGFNSNGNRGVAAGLGNIQKLKDGEPLGG 159

Query: 179 SPKSDTSEFKDYGEEQ 194
             +++  EF    ++ 
Sbjct: 160 RVRAE-DEFGTVDDDD 174


>gi|325687767|gb|EGD29788.1| conserved phage-associated protein [Streptococcus sanguinis SK72]
          Length = 177

 Score =  158 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 48/196 (24%), Positives = 77/196 (39%), Gaps = 29/196 (14%)

Query: 2   QKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE-- 59
            K+ V GRLSY  +            S   Y   ++ PK+D   I  ++  ++ A  E  
Sbjct: 5   TKVIVPGRLSYANVWEP----QSINGSEPKYSVSVIIPKSDKATIQKIQQAVEQAKQEAI 60

Query: 60  -IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP 118
             F    P          +  +  LRDGD             + Y +S +I+  N   +P
Sbjct: 61  SKFGGKIP----------ANLKLPLRDGDIDRPDD-------EAYANSYFINC-NSKQKP 102

Query: 119 LLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGA 178
            LVD+Q QP+ D  EV Y GC+    +    Y  +    +G +  L  +Q  K  E  G 
Sbjct: 103 QLVDQQVQPILDQTEV-YSGCYGRVSVTF--YGFNSNGNRGVAAGLGNIQKLKDGEPLGG 159

Query: 179 SPKSDTSEFKDYGEEQ 194
             +++  EF    ++ 
Sbjct: 160 RVRAE-DEFGTVDDDD 174


>gi|220930223|ref|YP_002507132.1| hypothetical protein Ccel_2858 [Clostridium cellulolyticum H10]
 gi|220000551|gb|ACL77152.1| conserved hypothetical protein [Clostridium cellulolyticum H10]
          Length = 182

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 49/193 (25%), Positives = 78/193 (40%), Gaps = 28/193 (14%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---IF 61
           +V  RLSY      V +        E Y   ++ PK D + INA+ A +  A+ E    F
Sbjct: 12  SVNTRLSYFHGWEPVSI----NGGAEKYSVSVLIPKTDKETINAINAAVDAAIEEGLAKF 67

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
               P+        K+  +  LRDGD +           + Y    +++A N    P +V
Sbjct: 68  GGKKPN--------KAAIKLPLRDGDVERDD--------EAYKGHYFVNA-NSTTPPQIV 110

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           D+  +P+ D  EV Y GC+    LN   Y  +    KG +C L  +Q  +  E  G    
Sbjct: 111 DKAVKPILDRNEV-YSGCYARVSLNF--YAFNSNGNKGVACGLGNIQKIRDGEPLGGRTN 167

Query: 182 SDTSEFKDYGEEQ 194
           +   +F    ++ 
Sbjct: 168 AA-DDFTTIEDDD 179


>gi|325690424|gb|EGD32427.1| conserved phage-associated protein [Streptococcus sanguinis SK115]
          Length = 177

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 47/196 (23%), Positives = 76/196 (38%), Gaps = 29/196 (14%)

Query: 2   QKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE-- 59
            K+ V GRLSY  +            S   Y   ++ PK D   I  ++  ++ A  E  
Sbjct: 5   TKVIVAGRLSYANVWEP----QSINGSEPKYSVSVIIPKTDQVTIQKIKQAVELAKQEAI 60

Query: 60  -IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP 118
             F    P          +  +  LRDGD             + Y +S +I+  N   +P
Sbjct: 61  SKFGGKIP----------ANLKLPLRDGDIDRPDD-------EAYANSYFINC-NSKQKP 102

Query: 119 LLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGA 178
            +VD+Q QP+ D  EV Y GC+    +    Y  +    +G +  L  +Q  K  E  G 
Sbjct: 103 QVVDQQVQPILDQAEV-YSGCYGRVSVTF--YGFNSNGNRGVAAGLGNIQKLKDGEPLGG 159

Query: 179 SPKSDTSEFKDYGEEQ 194
             +++  EF    ++ 
Sbjct: 160 RVRAE-DEFGTIEDDD 174


>gi|219855703|ref|YP_002472825.1| hypothetical protein CKR_2360 [Clostridium kluyveri NBRC 12016]
 gi|219569427|dbj|BAH07411.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 190

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 49/193 (25%), Positives = 80/193 (41%), Gaps = 28/193 (14%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---IF 61
           +V  RLSY      V +        E Y   ++ PK+D + INA+ A +  A+ E    F
Sbjct: 20  SVNTRLSYFHGWEPVSI----NGGAEKYSVSVLIPKSDKETINAINAAVDAAIEEGIAKF 75

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
               P+        K+  +  LRDGD +           + Y    +++A N    P +V
Sbjct: 76  GGKKPN--------KAAIKLPLRDGDVERDD--------EAYKGHYFVNA-NSTTPPQIV 118

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           D+  +P+ D  EV Y GC+    LN   Y  +    KG +C L  +Q  +  E  G+   
Sbjct: 119 DKAVKPILDRNEV-YSGCYARVSLNF--YAFNSNGNKGVACGLGNIQKIRDGEPLGSRTT 175

Query: 182 SDTSEFKDYGEEQ 194
           +   +F    ++ 
Sbjct: 176 AA-DDFTTIEDDD 187


>gi|227498333|ref|ZP_03928483.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226903795|gb|EEH89713.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 188

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 46/178 (25%), Positives = 72/178 (40%), Gaps = 17/178 (9%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           V  R SY  +     +          Y   ++ PK+DTK +  + A +K A  E      
Sbjct: 15  VNTRWSYANVWEPKSI----NGGTPKYSVSLIIPKSDTKTVEKIRAAIKAAYEE--GESK 68

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
                 AV +    +  LRDGD +             Y DS +I+A N   +P +VD   
Sbjct: 69  LKGNGRAVPALEAIKTPLRDGDLERPDD-------DAYKDSFFINA-NSATKPGIVDADC 120

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
           Q + +  EV Y G +  A +N   Y  +    KG +C L  +Q  +  E  G  P+++
Sbjct: 121 QHILERSEV-YSGVYGRASINF--YAFNSNGNKGIACGLNNLQKIRDGEPLGGKPRAE 175


>gi|259502605|ref|ZP_05745507.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
 gi|259169420|gb|EEW53915.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
          Length = 183

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 77/192 (40%), Gaps = 22/192 (11%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           +  RLSY  +     +        E Y   ++ PK+D K + A+E  +  A+        
Sbjct: 11  INTRLSYANIWEPKSI----NGGKEKYSVSLIIPKSDQKTVTAIEKAIDAAI-----QKG 61

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
              F     +K+  +  LRDGD +             Y DS +I+A N    P +VD+  
Sbjct: 62  IGKFGGKKPNKATLKLPLRDGDLERDDV--------AYQDSYFINA-NSITAPQIVDKHV 112

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           QP+ D  EV Y GC+    +N   Y  +    +G +C L  +Q  +  E  G    +   
Sbjct: 113 QPILDRDEV-YSGCYARVSINF--YAFNTNGNRGIACGLGNIQKIRDGEPLGGHASAS-D 168

Query: 186 EFKDYGEEQDSD 197
           +F    +  D D
Sbjct: 169 DFTAIDDSNDDD 180


>gi|42779457|ref|NP_976704.1| hypothetical protein BCE_0376 [Bacillus cereus ATCC 10987]
 gi|42735373|gb|AAS39312.1| phage-related protein [Bacillus cereus ATCC 10987]
          Length = 182

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 49/193 (25%), Positives = 78/193 (40%), Gaps = 28/193 (14%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---IF 61
           +V  RLSY      V +        E Y   ++ PK D + INA+ A +  A+ E    F
Sbjct: 12  SVNTRLSYFHGWEPVSI----NGGAEKYSVSVLIPKTDKETINAINAAVDAAIEEGIAKF 67

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
               P+        K+  +  LRDGD +           + Y    +++A N    P +V
Sbjct: 68  GGKKPN--------KAAIKLPLRDGDVERDD--------EAYKGHYFVNA-NSKTPPQIV 110

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           D+  +P+ D  EV Y GC+    LN   Y  +    KG +C L  +Q  +  E  G    
Sbjct: 111 DKAVRPILDRNEV-YSGCYARVSLNF--YAFNSNGNKGVACGLGNIQKIRDGEPLGGRTN 167

Query: 182 SDTSEFKDYGEEQ 194
           +   +F    ++ 
Sbjct: 168 AA-DDFTTIEDDD 179


>gi|167746063|ref|ZP_02418190.1| hypothetical protein ANACAC_00758 [Anaerostipes caccae DSM 14662]
 gi|167654578|gb|EDR98707.1| hypothetical protein ANACAC_00758 [Anaerostipes caccae DSM 14662]
          Length = 187

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 44/183 (24%), Positives = 73/183 (39%), Gaps = 18/183 (9%)

Query: 1   MQKLT-VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M+ +T    R SY  +     +      S   Y   ++ PK+D   +  ++  ++ A  E
Sbjct: 8   MKVITGPNTRWSYANVWEPKSI----NGSTPKYSVSLIIPKSDKVTVEKIKKAIQAAYEE 63

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                        V + S  +  LRDGD +           +TY +S +I+A N    P 
Sbjct: 64  --GQSKLKGNGKTVPALSVLKTPLRDGDLERPDD-------ETYANSYFINA-NSATAPG 113

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +VD     + D  EV Y G +  A +N+  Y  +    KG +C L  +Q  K  E  G  
Sbjct: 114 IVDADRNTIIDRSEV-YSGVYGRASINL--YAFNSNGNKGIACGLNNLQKIKDGEPLGGK 170

Query: 180 PKS 182
            ++
Sbjct: 171 SRA 173


>gi|167630956|ref|YP_001681455.1| hypothetical protein HM1_2935 [Heliobacterium modesticaldum Ice1]
 gi|167593696|gb|ABZ85444.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 192

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 49/198 (24%), Positives = 82/198 (41%), Gaps = 22/198 (11%)

Query: 1   MQKLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M+ +T    R SY  +      K  +G +   +   ++ PK+DT+ I  ++A ++ A  E
Sbjct: 13  MKVITGPDTRWSYANVWE---AKSINGGT-PKFSVSLIIPKSDTRTIAKLKAAIEAAYHE 68

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                        V   S  +  LRDGD +             Y ++ +I+A N    P 
Sbjct: 69  --GEAKLKGNGKTVPPLSAIKTPLRDGDTERPDD-------PAYANAYFINA-NSSTAPG 118

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +VD   QP+ D  EV Y G +  A +N   Y  +    +G +C L  +Q  +  E  G  
Sbjct: 119 IVDADRQPILDRSEV-YSGVYGRASINF--YAFNSNGNRGIACGLNNLQKIRDGEPLGGK 175

Query: 180 PKSDTSEFKDYGEEQDSD 197
            +++     D+  E D D
Sbjct: 176 SRAE----DDFATEIDED 189


>gi|168179452|ref|ZP_02614116.1| conserved phage-associated protein [Clostridium botulinum NCTC
           2916]
 gi|182669804|gb|EDT81780.1| conserved phage-associated protein [Clostridium botulinum NCTC
           2916]
          Length = 206

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 74/192 (38%), Gaps = 23/192 (11%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T K RLSY  L                Y   ++ PK DT+ + A++  +  A  +     
Sbjct: 35  TGKVRLSYANLFEP----RAMEGQEPKYSVSVIIPKTDTETLKAIKEAVAEAKEQGKGKF 90

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ 124
                    +  +  +  L DGD             + Y +  Y++A N   +P +VD+ 
Sbjct: 91  GG-------KVPANLKTPLHDGDIDRPDD-------EAYANCYYLNA-NSKNKPGIVDKN 135

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            QPV D  EV Y GC+    LN  AY       KG +C L  VQ  +  E  G   +++ 
Sbjct: 136 VQPVLDATEV-YSGCYARLTLNFYAYSASGN--KGIACGLGNVQKLEDGEPLGGFTRAE- 191

Query: 185 SEFKDYGEEQDS 196
            +F      +D 
Sbjct: 192 DDFDSVETAEDD 203


>gi|297242719|ref|ZP_06926657.1| hypothetical protein GVAMD_0731 [Gardnerella vaginalis AMD]
 gi|298253794|ref|ZP_06977383.1| hypothetical protein GV51_1082 [Gardnerella vaginalis 5-1]
 gi|296888930|gb|EFH27664.1| hypothetical protein GVAMD_0731 [Gardnerella vaginalis AMD]
 gi|297532130|gb|EFH71103.1| hypothetical protein GV51_1082 [Gardnerella vaginalis 5-1]
          Length = 182

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 80/192 (41%), Gaps = 23/192 (11%)

Query: 4   LTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFP 62
           +T K  RLSY        +        E Y   ++ PK+D + +NA+E  +  A+ E   
Sbjct: 10  ITGKNTRLSYFNGWEPKSI----NGGPEKYSVSLLIPKSDVETVNAIEKAIDAAIEEGVG 65

Query: 63  NVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVD 122
                 F     +K+  +  LRDGD +           + Y    +I+A N    P +VD
Sbjct: 66  -----KFGGKKPNKAALKTPLRDGDIERDD--------EAYKGHYFINA-NSTTAPQIVD 111

Query: 123 RQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
           +Q +P+ D  EV Y GC+    +N   Y  +    KG +C L  +Q  +  E  G    +
Sbjct: 112 KQVKPIMDRSEV-YSGCYARVSINF--YAFNSNGNKGVACGLGNIQKIRDGEPLGGRSLA 168

Query: 183 DTSEFKDYGEEQ 194
            T +F    ++ 
Sbjct: 169 -TDDFTTLEDDD 179


>gi|284048439|ref|YP_003398778.1| hypothetical protein Acfer_1094 [Acidaminococcus fermentans DSM
           20731]
 gi|283952660|gb|ADB47463.1| conserved hypothetical protein [Acidaminococcus fermentans DSM
           20731]
          Length = 188

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 48/189 (25%), Positives = 79/189 (41%), Gaps = 18/189 (9%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           V  R SY  +     +          Y   ++ PK+DTK +  V A +K A  E    + 
Sbjct: 15  VNTRWSYANVWEPKSI----NGGTPKYSVSLIIPKSDTKTVEKVRAAIKAAYQEGEGKLK 70

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
            ++    V +    +  LRDGD +             Y DS +I+A N   QP +VD   
Sbjct: 71  GNS--RVVPALEAIKTPLRDGDLER-------PGDDAYKDSFFINA-NSATQPGIVDANC 120

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           Q + +  EV Y G +  A ++   Y  +    KG +C+L  +Q  +  E  G  P+++  
Sbjct: 121 QHILERSEV-YSGVYGRASISF--YAFNSNGNKGIACSLNNLQKIRDGEPLGGKPRAE-D 176

Query: 186 EFKDYGEEQ 194
           +F    +E 
Sbjct: 177 DFATADDED 185


>gi|153955280|ref|YP_001396045.1| hypothetical protein CKL_2662 [Clostridium kluyveri DSM 555]
 gi|146348138|gb|EDK34674.1| Phage-related protein [Clostridium kluyveri DSM 555]
          Length = 182

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/193 (25%), Positives = 80/193 (41%), Gaps = 28/193 (14%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---IF 61
           +V  RLSY      V +        E Y   ++ PK+D + INA+ A +  A+ E    F
Sbjct: 12  SVNTRLSYFHGWEPVSI----NGGAEKYSVSVLIPKSDKETINAINAAVDAAIEEGIAKF 67

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
               P+        K+  +  LRDGD +           + Y    +++A N    P +V
Sbjct: 68  GGKKPN--------KAAIKLPLRDGDVERDD--------EAYKGHYFVNA-NSTTPPQIV 110

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           D+  +P+ D  EV Y GC+    LN   Y  +    KG +C L  +Q  +  E  G+   
Sbjct: 111 DKAVKPILDRNEV-YSGCYARVSLNF--YAFNSNGNKGVACGLGNIQKIRDGEPLGSRTT 167

Query: 182 SDTSEFKDYGEEQ 194
           +   +F    ++ 
Sbjct: 168 AA-DDFTTIEDDD 179


>gi|331090258|ref|ZP_08339145.1| hypothetical protein HMPREF1025_02728 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330401877|gb|EGG81452.1| hypothetical protein HMPREF1025_02728 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 180

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 71/196 (36%), Gaps = 29/196 (14%)

Query: 2   QKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE-- 59
            K+ V  R SY                   Y    + PK+D + I  ++A ++ A  E  
Sbjct: 8   TKVIVSCRFSYLHCWEP----EAINGGEPKYSVSAIIPKSDKETIKKIQAAVEAAKQESL 63

Query: 60  -IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP 118
             +    P             +  LRDGD             + Y    + +A N    P
Sbjct: 64  SKWGGKIP----------PNLKLPLRDGDIDRPED-------EAYKGCYFFNA-NSRQAP 105

Query: 119 LLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGA 178
            +VD+Q QP+ D  EV Y GC+    +N   Y  +    +G +  L  +Q  K  E   +
Sbjct: 106 QVVDKQVQPILDQTEV-YSGCYGRISVNFYGY--NSNGNRGVAAGLGNIQKLKDGEALSS 162

Query: 179 SPKSDTSEFKDYGEEQ 194
              ++  +F+   +E 
Sbjct: 163 RTNAE-DDFEAVEDED 177


>gi|302876794|ref|YP_003845427.1| hypothetical protein Clocel_4000 [Clostridium cellulovorans 743B]
 gi|307687476|ref|ZP_07629922.1| hypothetical protein Ccel74_04923 [Clostridium cellulovorans 743B]
 gi|302579651|gb|ADL53663.1| hypothetical protein Clocel_4000 [Clostridium cellulovorans 743B]
          Length = 187

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 43/189 (22%), Positives = 73/189 (38%), Gaps = 18/189 (9%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           V  R S+        +          Y   ++ PK D   IN ++A ++ A  E      
Sbjct: 14  VNTRWSFVNAWEPKSI----NGGAPKYSVSLIIPKDDIATINKIKAAIQAAYEE--GESK 67

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
                  V + S  +  LRDGD +             Y ++ +++A N    P +VD   
Sbjct: 68  LKGNGKTVPALSVLKTPLRDGDLERPDDA-------AYANAYFVNA-NSATAPGIVDADR 119

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           QP+ +  EV Y G +  A +N   Y  +    KG +C L  +Q  +  E  G   +++  
Sbjct: 120 QPIIERSEV-YSGVYGRASINF--YAFNSNGNKGIACGLNNLQKIRDGEPLGGKSRAE-D 175

Query: 186 EFKDYGEEQ 194
           +F    E+ 
Sbjct: 176 DFATSDEDD 184


>gi|325662092|ref|ZP_08150711.1| hypothetical protein HMPREF0490_01449 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471755|gb|EGC74974.1| hypothetical protein HMPREF0490_01449 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 187

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 46/192 (23%), Positives = 77/192 (40%), Gaps = 21/192 (10%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           V  R SY  +     +          Y   ++ PK+DT  +N ++A ++ A  E      
Sbjct: 14  VNTRWSYANVWDPKSI----NGGAPKYSVSLIIPKSDTVTVNKIKAAIQAAYEE--GESK 67

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
                    +    +  LRDGD +           + Y DS +I+A N    P +VD   
Sbjct: 68  LKGTAKVCPALDVIKTPLRDGDKER-------PGDEAYKDSYFINA-NSATAPGIVDADR 119

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           Q + D  EV Y G +  A +N+  Y  +    +G +C L  +Q  +  E  G   +++  
Sbjct: 120 QQIIDRSEV-YSGVYGRASINL--YAFNSNGNRGIACGLNNLQKIRDGEPLGGKSRAE-- 174

Query: 186 EFKDYGEEQDSD 197
              D+  E+D D
Sbjct: 175 --DDFATEEDDD 184


>gi|197303497|ref|ZP_03168536.1| hypothetical protein RUMLAC_02219 [Ruminococcus lactaris ATCC
           29176]
 gi|197297495|gb|EDY32056.1| hypothetical protein RUMLAC_02219 [Ruminococcus lactaris ATCC
           29176]
          Length = 187

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 46/177 (25%), Positives = 74/177 (41%), Gaps = 17/177 (9%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           V  R SY  +      K  +G +   Y   ++ PK+DT  +N ++A +  A  E      
Sbjct: 14  VNTRWSYANVWD---AKSINGGT-PKYSVSLIIPKSDTVTVNKIKAAITAAYEE--GQSK 67

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
                  V + S  +  LRDGD +             Y D+ +I+A N    P +VD   
Sbjct: 68  LKGNGKTVPALSVLKTPLRDGDLERPDD-------PAYADAYFINA-NSATAPGIVDADR 119

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
           QP+ +  EV Y G +  A +N+  Y  +    KG +C L  +Q  +  E  G   ++
Sbjct: 120 QPIFERSEV-YSGVYGRASINL--YAFNSNGNKGIACGLNNLQKIRDGEPLGGKSRA 173


>gi|225405824|ref|ZP_03761013.1| hypothetical protein CLOSTASPAR_05045 [Clostridium asparagiforme
           DSM 15981]
 gi|225042638|gb|EEG52884.1| hypothetical protein CLOSTASPAR_05045 [Clostridium asparagiforme
           DSM 15981]
          Length = 239

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 63/191 (32%), Gaps = 15/191 (7%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T K RLSY  L    +         E Y   ++ PK DT  +N + A ++ A      + 
Sbjct: 9   TGKVRLSYVHL---YKPYAAMPGQEEKYSVTVLVPKTDTDTMNRINAAVEAAKQRGITDK 65

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNK-YVQPLLVDR 123
                             + DGD    S   P  Y          +A  K    P +VD+
Sbjct: 66  WGGV------CPPMVPTPIYDGDGTRPSDGMP--YGPECKGHWVFTASAKADYPPEVVDK 117

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
              P+ +  EV Y G +    ++   Y       KG  C L  VQ  +  E   +S  + 
Sbjct: 118 MGNPIINQSEV-YSGIYGRVNVSFYPYAFGGK--KGIGCGLGPVQKLEDGEPLASSAPTA 174

Query: 184 TSEFKDYGEEQ 194
              F      Q
Sbjct: 175 AQAFGAPATPQ 185


>gi|266623808|ref|ZP_06116743.1| conserved hypothetical protein [Clostridium hathewayi DSM 13479]
 gi|288864380|gb|EFC96678.1| conserved hypothetical protein [Clostridium hathewayi DSM 13479]
          Length = 238

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 66/222 (29%), Gaps = 24/222 (10%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T + RLSY  L              E Y   ++ PK D   +  + A L  A  +     
Sbjct: 9   TGEVRLSYVHLFKP---YAAMTGQEEKYSVTVLVPKTDVDTMGRINAALDAAKQKGISEK 65

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNK-YVQPLLVDR 123
                    +        + DGD    S      +          +A  K   +P +VD+
Sbjct: 66  W------NGQCPPIVPVPVYDGDGVRPSDGM--AFGPECKGHWVFTASAKVDYRPEVVDK 117

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
              P+ +  EV Y G +    ++   Y       KG  C L  V   +  E  G S  S 
Sbjct: 118 MGNPIINQSEV-YSGMYGRVNVSFYPYSFGGK--KGIGCGLGPVMKTRDGESLGGSAPSA 174

Query: 184 TSEF---------KDYGEEQDSDTSVSNFASAEVDSDALPWN 216
              F              +  +    +  A+        PWN
Sbjct: 175 AQAFNVQQGQATAGYAAPQYGAAMPATPGAAGYAPQTTAPWN 216


>gi|220930428|ref|YP_002507337.1| hypothetical protein Ccel_3065 [Clostridium cellulolyticum H10]
 gi|220000756|gb|ACL77357.1| conserved hypothetical protein [Clostridium cellulolyticum H10]
          Length = 188

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 44/179 (24%), Positives = 76/179 (42%), Gaps = 17/179 (9%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K RLSY  L         D S    Y   ++ PK+D   +  ++A ++ A       
Sbjct: 11  ITGKVRLSYAHL---FTPASIDDSQDPKYSVCLLIPKSDKDTVKKIKAAIEAAKQAG--- 64

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
            +      A +  ++ +  LRDGD + A  +        Y    +I+A +K  +P ++DR
Sbjct: 65  -ADKIKNKAGKIPADLKIPLRDGDEERAEDN------PEYAGHYFINASSK-QKPGIIDR 116

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
               ++D  EV Y GC+  A +N   Y  +    KG +C L  +Q     +  G   ++
Sbjct: 117 YKNEITDSTEV-YSGCYARASVNF--YAFNTAGNKGIACGLNNIQKIADGDYLGGRSRA 172


>gi|317132757|ref|YP_004092071.1| hypothetical protein Ethha_1815 [Ethanoligenens harbinense YUAN-3]
 gi|315470736|gb|ADU27340.1| hypothetical protein Ethha_1815 [Ethanoligenens harbinense YUAN-3]
          Length = 192

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 74/186 (39%), Gaps = 18/186 (9%)

Query: 1   MQKLT-VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M+ +T    R SY  +     +          Y   ++ PK+DT  +  V+A ++ A  E
Sbjct: 10  MKVITGPNTRWSYANVWEPKSI----NGGTPKYSVSLIIPKSDTVTVAKVKAAIEAAYKE 65

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                       +V + S  +  LRDGDA+           + Y  S +++A N    P 
Sbjct: 66  --GEAKLKGNSKSVPALSVIKTPLRDGDAERPDD-------EAYRGSYFVNA-NATTAPG 115

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +VD    P+    EV Y G +  A +    Y  +    +G +C L  +Q  +  E  G+ 
Sbjct: 116 IVDADLNPILSRSEV-YSGVYGRASITF--YAFNSSGNRGIACGLNNLQKIRDGEPLGSK 172

Query: 180 PKSDTS 185
             +++ 
Sbjct: 173 ASAESD 178


>gi|308174988|ref|YP_003921693.1| hypothetical protein BAMF_3097 [Bacillus amyloliquefaciens DSM 7]
 gi|307607852|emb|CBI44223.1| conserved phage-associated protein [Bacillus amyloliquefaciens DSM
           7]
          Length = 189

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 74/196 (37%), Gaps = 28/196 (14%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTA---VTEI 60
           +T K R SY       +    +      Y   I+ PK D   +  ++A ++ A       
Sbjct: 13  VTGKVRFSYLH---AFQPHAIEEGQEPKYSTAILIPKTDKDTLRKIKAAVEAAKEAGKSK 69

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           +    P          +  +  LRDGD +           + Y    +++A +K  +P +
Sbjct: 70  WGGKIP----------ANLKTPLRDGDEERPDQ-------EEYAGCYFLNASSK-TKPGI 111

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VDR    + D  E  Y GC+    +N   Y  +    KG +C L  +Q  +  +  G   
Sbjct: 112 VDRNLNHIID-SEELYSGCYGRVSINF--YAFNTAGNKGIACGLNNIQKLEDGDYLGGRS 168

Query: 181 KSDTSEFKDYGEEQDS 196
           +++  +F    + ++ 
Sbjct: 169 RAE-DDFDALDDFEND 183


>gi|317501100|ref|ZP_07959306.1| phage protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|316897487|gb|EFV19552.1| phage protein [Lachnospiraceae bacterium 8_1_57FAA]
          Length = 190

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 46/195 (23%), Positives = 79/195 (40%), Gaps = 19/195 (9%)

Query: 1   MQKLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M+ +T    R SY  +     +          Y   ++ PK+DTK I  ++A ++ A  E
Sbjct: 11  MKVITGVDTRWSYANVWEPKSI----NGGTPKYSVSLIIPKSDTKTIAKIQAAIEAAYKE 66

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                       +V + S  +  LRDGDA+           + Y ++ +++A N    P 
Sbjct: 67  --GEAKLKGNGKSVPALSVLKTPLRDGDAERPDD-------EAYKNAYFVNA-NATSAPG 116

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +VD    P+    EV Y G +  A +    Y  +    KG +C L  +Q  +  E  G  
Sbjct: 117 IVDADLNPILTRSEV-YSGVYGRASITF--YAFNSSGNKGIACGLNNLQKIRDGEPLGGK 173

Query: 180 PKSDTSEFKDYGEEQ 194
             ++ S+F    +E 
Sbjct: 174 ASAE-SDFATEDDED 187


>gi|256617075|ref|ZP_05473921.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|257088362|ref|ZP_05582723.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|256596602|gb|EEU15778.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256996392|gb|EEU83694.1| conserved hypothetical protein [Enterococcus faecalis D6]
          Length = 182

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/189 (25%), Positives = 78/189 (41%), Gaps = 28/189 (14%)

Query: 9   RLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---IFPNVS 65
           RLSY      V +        E Y   ++ PK D K I+A+E  +  A+ E    F    
Sbjct: 16  RLSYFHGWEPVSI----NGGAEKYSTAVLIPKTDKKTIDAIEKAIDAAIEEGIAKFGGKK 71

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
           P+        K+  +  LRDGD +           + Y    +I+A N    P +VD++ 
Sbjct: 72  PN--------KAAIKLPLRDGDIERDD--------EAYKGHYFINA-NSTTPPQIVDQRV 114

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           QP+ +  +V Y GC+    +N   Y  +    KG +  L  +QF +  E  G    +   
Sbjct: 115 QPILERSQV-YSGCYARVSINF--YAFNSNGNKGVAAGLGNIQFVRDGEPLGGQTSAS-D 170

Query: 186 EFKDYGEEQ 194
           EF+   ++ 
Sbjct: 171 EFETLADDD 179


>gi|331085757|ref|ZP_08334840.1| hypothetical protein HMPREF0987_01143 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406680|gb|EGG86185.1| hypothetical protein HMPREF0987_01143 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 181

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 74/197 (37%), Gaps = 29/197 (14%)

Query: 2   QKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE-- 59
            K+ +  R SY        +      S   Y   ++  K DT  I  ++  ++ A  +  
Sbjct: 8   TKVIISARASYLHAFEPDSI----NGSDPKYSVSLIIDKKDTDLIAKIKKAVEQAKEDGK 63

Query: 60  -IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP 118
             +    P          +  +  LRDGD             + Y  + +I+A N    P
Sbjct: 64  SKWGGKIP----------ANLKLPLRDGDLDRPED-------EAYAGAYFINA-NSKQAP 105

Query: 119 LLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGA 178
            +VDR  QP+ D  E  Y GC++ A +   AY  +    KG +  L  +Q  +  E +G+
Sbjct: 106 QVVDRNVQPILDQSE-LYSGCYIRASVTFYAY--NSNGNKGIAAGLGNIQKVRDGEPFGS 162

Query: 179 SPKSDTSEFKDYGEEQD 195
              +   EF     E D
Sbjct: 163 RVNAK-DEFDAVDGEDD 178


>gi|313618508|gb|EFR90507.1| phage-associated protein [Listeria innocua FSL S4-378]
          Length = 183

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 76/192 (39%), Gaps = 28/192 (14%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---IFP 62
           V  R SY      V +        E Y   ++ PK D + INA+ A +  A+ E    F 
Sbjct: 14  VNSRFSYFHGWEPVSI----NGGAEKYSVSVLIPKDDKETINAIHAAVDAAIEEGIAKFG 69

Query: 63  NVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVD 122
              P+        K+  +  LRDGD +           + Y    +I+A N    P +VD
Sbjct: 70  GKKPN--------KAAIKLPLRDGDVERDD--------EAYKGHYFINA-NSKTAPQIVD 112

Query: 123 RQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
           +  +P+ D  EV Y GC+    LN   Y  +    KG +C L  +Q  +  E  G    +
Sbjct: 113 KSVKPILDRSEV-YSGCYGRVSLNF--YAFNSNGNKGVACGLGNIQKIRDGEPLGGKTSA 169

Query: 183 DTSEFKDYGEEQ 194
              +F    ++ 
Sbjct: 170 -VDDFTTLVDDD 180


>gi|300856815|ref|YP_003781799.1| phage-like protein [Clostridium ljungdahlii DSM 13528]
 gi|300436930|gb|ADK16697.1| phage-related protein [Clostridium ljungdahlii DSM 13528]
          Length = 186

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 76/192 (39%), Gaps = 23/192 (11%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T K RLSY  L            +   Y   ++ PK DT  + A++  +  A  +     
Sbjct: 15  TGKVRLSYAHLFEP----HAIEGNEPKYSVSVIIPKTDTDTLKAIKEAVAEAKEQG---- 66

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ 124
                    +  S  +  LRDGD++           + Y +S +++A N   +P +VD+ 
Sbjct: 67  ---KSKWNGKIPSNLKTPLRDGDSERPDD-------EAYENSYFLNA-NSKNKPGVVDQN 115

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            QPV D  EV Y GC+    LN   Y       KG +  L  VQ  +  E  G   ++  
Sbjct: 116 VQPVLDATEV-YSGCYARLTLNFFPYSASGN--KGVAAGLGNVQKLEDGEPLGGFTRAK- 171

Query: 185 SEFKDYGEEQDS 196
            +F+     +D 
Sbjct: 172 DDFEAVETAEDD 183


>gi|50914500|ref|YP_060472.1| unknown phage protein [Streptococcus pyogenes MGAS10394]
 gi|40218549|gb|AAR83203.1| hypothetical phage protein [Streptococcus pyogenes]
 gi|50261594|gb|AAT72362.1| unknown [Streptococcus pyogenes]
 gi|50903574|gb|AAT87289.1| unknown phage protein [Streptococcus pyogenes MGAS10394]
          Length = 190

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 41/177 (23%), Positives = 70/177 (39%), Gaps = 17/177 (9%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
              R SY   +    +      S   Y   ++ PK DT  IN ++A ++ A  E      
Sbjct: 17  PNTRFSYLNANEPKSI----NGSTPKYSASLIIPKEDTATINKIKAAIEQAYKE--GESK 70

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
                 +V + S  +  LRDGD +           + Y ++ +++A N   +P +VD   
Sbjct: 71  LKGNGKSVPALSTLKTPLRDGDLERPDD-------EAYKNAYFVNA-NSPHKPGVVDGNR 122

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
           Q + D  E  Y G +  A +    Y  +    KG +C L  +Q  +  E  G   ++
Sbjct: 123 QEIIDTSE-LYSGIYGRASITF--YAFNSNGNKGIACGLNNLQKLRDGEPLGGRTRA 176


>gi|227496456|ref|ZP_03926740.1| phage-associated protein [Actinomyces urogenitalis DSM 15434]
 gi|226834038|gb|EEH66421.1| phage-associated protein [Actinomyces urogenitalis DSM 15434]
          Length = 181

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/192 (23%), Positives = 73/192 (38%), Gaps = 20/192 (10%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RLSY  +     +          Y   ++ PKADT  I  VE  +   +        P 
Sbjct: 10  VRLSYAHVWEPKSV----NGGEPKYSASLIIPKADTTMIQMVEKAIDEVLKSE----GPG 61

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
            F   V  +   +  LRDGD     +   +         ++++A +K  +P +VD +  P
Sbjct: 62  KFGGKVPPRGSLKLPLRDGDTDRDDAAYADA--------MFLNASSK-TRPGIVDAEVHP 112

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           + D  EV Y GC+    + +  Y  +    +G +C L  +Q  +  ER G       SEF
Sbjct: 113 ILDREEV-YSGCYANVTVEL--YVFNVNGNRGVACGLGNIQKLRDGERLGGGGVKAESEF 169

Query: 188 KDYGEEQDSDTS 199
               +      S
Sbjct: 170 AVVDDGAADFLS 181


>gi|153939608|ref|YP_001391679.1| hypothetical protein CLI_2437 [Clostridium botulinum F str.
           Langeland]
 gi|152935504|gb|ABS41002.1| conserved hypothetical protein [Clostridium botulinum F str.
           Langeland]
          Length = 184

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 74/192 (38%), Gaps = 23/192 (11%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T K RLSY  L                YG  ++ PK D + + A++  +  A  +     
Sbjct: 13  TGKVRLSYANLFEP----RAMEGQEPKYGVSVIIPKTDIETLKAIKEAVAEAKEQGKGKF 68

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ 124
                    +  +  +  L DGD             + Y +  Y++A N   +P +VD+ 
Sbjct: 69  GG-------KVPANLKTPLHDGDIDRPDD-------EAYANCYYLNA-NSKNKPGIVDKN 113

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            QPV D  EV Y GC+    LN  AY       KG +C L  VQ  +  E  G   +++ 
Sbjct: 114 VQPVLDATEV-YSGCYARLTLNFYAYSASGN--KGIACGLGNVQKLEEGEPLGGFTRAE- 169

Query: 185 SEFKDYGEEQDS 196
            +F      +D 
Sbjct: 170 DDFDSVETAEDD 181


>gi|260161776|emb|CAZ39320.1| putative phage protein [Streptococcus suis]
 gi|313575358|emb|CBR26887.1| hypothetical protein [Streptococcus phage phi-SsUD.1]
          Length = 190

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 41/177 (23%), Positives = 70/177 (39%), Gaps = 17/177 (9%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
              R SY   +    +      S   Y   ++ PK DT  IN ++A ++ A  E      
Sbjct: 17  PNTRFSYLNANEPKSI----NGSTPKYSASLIIPKEDTATINKIKAAIEQAYKE--GESK 70

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
                 +V + S  +  LRDGD +           + Y ++ +++A N   +P +VD   
Sbjct: 71  LKGNGKSVPALSTLKTPLRDGDLERPDD-------EAYKNAYFVNA-NSPHKPGVVDGNR 122

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
           Q + D  E  Y G +  A +    Y  +    KG +C L  +Q  +  E  G   ++
Sbjct: 123 QEIIDTSE-LYSGIYGRASITF--YAFNSNGNKGIACGLNNLQKLRDGEPLGGRTRA 176


>gi|253581724|ref|ZP_04858948.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
 gi|251836073|gb|EES64610.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
          Length = 192

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 37/182 (20%), Positives = 61/182 (33%), Gaps = 13/182 (7%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K RLS+  +        P     E Y   ++ PK+DT     ++A ++ A  +   +
Sbjct: 9   VTGKVRLSFVHVFKP---YAPTPDQEEKYSVTVLVPKSDTVTKAKIDAAIQLATEQGVAS 65

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                         +    + DGD    S   P    +     V+ ++  K   P +VD 
Sbjct: 66  KWNGVK------PPKIAIPIYDGDGVKPSDGMP-FGDECKGHWVFTASAKKDYPPQVVDA 118

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
           Q   + +  EV Y G +    +N   Y       KG    L  VQ     E       + 
Sbjct: 119 QVNAILNQSEV-YSGIYGRVSVNFFPYAFAGK--KGIGVGLNNVQKLMDGEPLSGRANAA 175

Query: 184 TS 185
             
Sbjct: 176 ED 177


>gi|9633597|ref|NP_051011.1| hypothetical protein APSE-1_50 [Acyrthosiphon pisum bacteriophage
           APSE-1]
 gi|9910951|sp|Q9T1P8|VP50_BPAPS RecName: Full=Putative protein p50
 gi|6118045|gb|AAF03993.1|AF157835_50 P50 [Endosymbiont phage APSE-1]
          Length = 184

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 50/190 (26%), Positives = 84/190 (44%), Gaps = 17/190 (8%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++P L          G     Y  + + PK+ T  I  ++A +K  + E + N   +
Sbjct: 8   VRLAFPELFEP---TQVSGQGAFKYRANFLIPKSRTDLIEEIKAGIKHVIGEKWGNKDIE 64

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
              +++ +    R  LRDGD+K             Y  ++Y+SA NK  +PL++DR   P
Sbjct: 65  KIYNSICNNPN-RFCLRDGDSKE---------YDGYAGNLYLSASNK-SRPLVIDRNTSP 113

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           ++      Y GC+V A +    Y       KG S +L GVQFF+  + +     +   EF
Sbjct: 114 LTAQDGRPYSGCYVNATVEFYGY---DNNGKGVSASLRGVQFFRDGDAFTGGGVASVEEF 170

Query: 188 KDYGEEQDSD 197
            D    ++ +
Sbjct: 171 DDLSMAEEEE 180


>gi|262113719|emb|CAR95386.1| hypothetical protein [Streptococcus phage phi-m46.1]
          Length = 190

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 40/177 (22%), Positives = 69/177 (38%), Gaps = 17/177 (9%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
              R SY   +    +      S   Y   ++ PK DT  IN ++  ++ A  E      
Sbjct: 17  PNTRFSYLNANEPKSI----NGSTPKYSASLIIPKEDTATINKIKVAIEQAYKE--GESK 70

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
                 +V + S  +  LRDGD +           + Y ++ +++A N   +P +VD   
Sbjct: 71  LKGNGKSVPALSTLKTPLRDGDLERPDD-------EAYKNAYFVNA-NSPHKPGVVDGNR 122

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
           Q + D  E  Y G +  A +    Y  +    KG +C L  +Q  +  E  G   ++
Sbjct: 123 QEIIDTSE-LYSGIYGRASITF--YAFNSNGNKGIACGLNNLQKLRDGEPLGGRTRA 176


>gi|57234131|ref|YP_181816.1| hypothetical protein DET1101 [Dehalococcoides ethenogenes 195]
 gi|57224579|gb|AAW39636.1| conserved hypothetical protein [Dehalococcoides ethenogenes 195]
          Length = 190

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 45/194 (23%), Positives = 77/194 (39%), Gaps = 18/194 (9%)

Query: 1   MQKLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M+ +T    R SY  +     +          Y   ++ PK+DTK I  ++  ++ A  E
Sbjct: 11  MKVITGVDTRWSYANVWEPKSV----NGGTPKYSVSLIIPKSDTKTIAKIKDAIEAAYKE 66

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                       +V + S  +  LRDGDA+           + Y +S +++A N    P 
Sbjct: 67  --GEAKLKGNGKSVPALSVLKTPLRDGDAERPDD-------EAYKNSYFVNA-NATSAPG 116

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +VD    P+    EV Y G +  A +    Y  +    KG +C L  +Q  +  E  G  
Sbjct: 117 IVDADLNPILTRSEV-YSGVYGRASITF--YAFNSSGNKGIACGLNNLQKIRDGEPLGGK 173

Query: 180 PKSDTSEFKDYGEE 193
             +++    D  E+
Sbjct: 174 ASAESDFATDDDED 187


>gi|76787707|ref|YP_329355.1| hypothetical protein SAK_0727 [Streptococcus agalactiae A909]
 gi|77412061|ref|ZP_00788387.1| phage protein [Streptococcus agalactiae CJB111]
 gi|76562764|gb|ABA45348.1| conserved hypothetical protein [Streptococcus agalactiae A909]
 gi|77161866|gb|EAO72851.1| phage protein [Streptococcus agalactiae CJB111]
          Length = 187

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 40/181 (22%), Positives = 75/181 (41%), Gaps = 18/181 (9%)

Query: 4   LTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFP 62
           +T K  R SY   +    +      S   Y   ++ PK D + ++ ++A ++ A  E   
Sbjct: 11  ITGKNTRFSYLNANEPKSI----NGSTPKYSVSLIIPKDDIETVDKIKAAIELAYKE--G 64

Query: 63  NVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVD 122
                    +V + S  +  LRDGD +           + Y ++ +++A N   +P +VD
Sbjct: 65  ESKLKGNGKSVPALSILKTPLRDGDLERPDD-------EAYRNAYFVNA-NSPHKPGVVD 116

Query: 123 RQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
              Q + D  E  Y G +  A ++   Y  +    KG +C L  +Q  +  E  G   ++
Sbjct: 117 ANRQEIIDTSE-LYSGIYGRASISF--YAFNSNGNKGIACGLNNLQKLRDGEPLGGRTRA 173

Query: 183 D 183
           +
Sbjct: 174 E 174


>gi|212499744|ref|YP_002308552.1| hypothetical protein APSE240 [Bacteriophage APSE-2]
 gi|238898735|ref|YP_002924417.1| APSE-2 prophage; hypothetical [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|75906033|gb|ABA29382.1| conserved hypothetical protein [Bacteriophage APSE-2]
 gi|211731713|gb|ACJ10201.1| conserved hypothetical protein [Bacteriophage APSE-2]
 gi|229466495|gb|ACQ68269.1| APSE-2 prophage; conserved hypothetical [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 184

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 50/190 (26%), Positives = 84/190 (44%), Gaps = 17/190 (8%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++P L          G     Y  + + PK+ T  I  ++A +K  + E + N   +
Sbjct: 8   VRLAFPELFEP---TQVSGQGAFKYRANFLIPKSRTDLIEEIKAGIKHVIGEKWGNKDIE 64

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
              +++ +    R  LRDGD+K             Y  ++Y+SA NK  +PL++DR   P
Sbjct: 65  KIYNSICNNPN-RFCLRDGDSKE---------YDGYAGNLYLSASNK-SRPLVIDRNTSP 113

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           ++      Y GC+V A +    Y       KG S +L GVQFF+  + +     +   EF
Sbjct: 114 LTAQDGRPYSGCYVNATIEFYGY---DNNGKGVSASLRGVQFFRDGDAFTGGGVASVEEF 170

Query: 188 KDYGEEQDSD 197
            D    ++ +
Sbjct: 171 DDLSMAEEEE 180


>gi|255994007|ref|ZP_05427142.1| conserved hypothetical protein [Eubacterium saphenum ATCC 49989]
 gi|255993675|gb|EEU03764.1| conserved hypothetical protein [Eubacterium saphenum ATCC 49989]
          Length = 191

 Score =  150 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 63/181 (34%), Gaps = 15/181 (8%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T + R S+  +   +     +      Y   ++ PK DT+   A++A ++ A      + 
Sbjct: 8   TGRVRFSFVHV---LEAYAREQGQDPKYSLTVLVPKTDTETKKAIDAAIEAATVLGTSSK 64

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNK-YVQPLLVDR 123
                    +   +    + DGD    S   P  +          +A ++    P +VD 
Sbjct: 65  W------QGKRPQKVNIPIHDGDGVKPSDGMP--FGDECKGHWVFTASSRIDYPPEVVDA 116

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
             Q +  P EV Y GC+    +N   Y       KG  C L  VQ  +  E      K+ 
Sbjct: 117 NLQAIISPAEV-YSGCYGRVHINFFPYAYGGK--KGIGCALNAVQKLEDGEPLAGRAKAS 173

Query: 184 T 184
            
Sbjct: 174 E 174


>gi|212712319|ref|ZP_03320447.1| hypothetical protein PROVALCAL_03407 [Providencia alcalifaciens DSM
           30120]
 gi|212685065|gb|EEB44593.1| hypothetical protein PROVALCAL_03407 [Providencia alcalifaciens DSM
           30120]
          Length = 183

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 52/193 (26%), Positives = 83/193 (43%), Gaps = 17/193 (8%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++P L         +G     +    + PK  T  I A+E+ +K   T  +   +  
Sbjct: 8   VRLAFPDL---FEATQVNGQGDYKFRATFLIPKNRTDLIEAIESAIKQVATAKWGAKADA 64

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
              S     +  R   RDGD KI            Y D +YI A NK  +PL++DR   P
Sbjct: 65  VLKSI--RGNSMRFNFRDGDEKIE--------YDGYADHMYIGASNK-ARPLVIDRDRTP 113

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           ++      Y GC+V A + I AY     + KG S +L GVQFF+  + +     +   +F
Sbjct: 114 LTAQDGRPYSGCYVNATITIFAY---DNQGKGISASLGGVQFFRDGDAFAGGGVASEDDF 170

Query: 188 KDYGEEQDSDTSV 200
            D    ++ ++ +
Sbjct: 171 DDLSVAEEEESLI 183


>gi|226323295|ref|ZP_03798813.1| hypothetical protein COPCOM_01067 [Coprococcus comes ATCC 27758]
 gi|225208485|gb|EEG90839.1| hypothetical protein COPCOM_01067 [Coprococcus comes ATCC 27758]
          Length = 187

 Score =  150 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 46/192 (23%), Positives = 77/192 (40%), Gaps = 21/192 (10%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           V  R SY  +     +      +   Y   ++ PK+DT  +N ++A ++ A  E      
Sbjct: 14  VNTRRSYANVWDPKSI----NGAAPKYSVSLIIPKSDTVTVNKIKAAIQAAYEE--GESK 67

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
                    +    +  LRDGD +           + Y DS +I+A N    P +VD   
Sbjct: 68  LKGTAKVCPALDVIKTPLRDGDKER-------PGDEAYKDSYFINA-NSATAPGIVDADR 119

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           Q + D  EV Y G +  A +N+  Y       +G +C L  +Q  +  E  G   +++  
Sbjct: 120 QQIIDRSEV-YSGVYGRASINL--YAFTSNGNRGIACGLNNLQKIRDGEPLGGKSRTE-- 174

Query: 186 EFKDYGEEQDSD 197
              D+  E+D D
Sbjct: 175 --DDFATEEDDD 184


>gi|295114047|emb|CBL32684.1| Protein of unknown function (DUF2815). [Enterococcus sp. 7L76]
          Length = 180

 Score =  150 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 46/189 (24%), Positives = 77/189 (40%), Gaps = 28/189 (14%)

Query: 9   RLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---IFPNVS 65
           RLSY                 E Y   ++ PK+D + I+ +E  +  A+ E    F    
Sbjct: 14  RLSYFHGWEP----ASINGGAEKYSTAVLIPKSDKRTIDTIEKAIDAAIEEGLAKFGGKK 69

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
           P+        K+E +  LRDGD +           + Y    +I+A N    P +VD+  
Sbjct: 70  PN--------KAEIKLPLRDGDIERDD--------EAYQGHYFINA-NSTTAPQIVDQHV 112

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           QP+ D  +V Y GC+    +N   Y  +    +G +  L  +QF +  E  G+   +   
Sbjct: 113 QPILDRSQV-YSGCYARVSINF--YAFNANGNRGVAAGLGNIQFVRDGEPLGSQVSAS-D 168

Query: 186 EFKDYGEEQ 194
           EF+   ++ 
Sbjct: 169 EFETLADDD 177


>gi|304436358|ref|ZP_07396334.1| hypothetical phage protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304370627|gb|EFM24276.1| hypothetical phage protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 186

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 73/176 (41%), Gaps = 17/176 (9%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           VK R SY  +     +      S   Y   ++ PK+DTK + AV+  ++ A  E      
Sbjct: 14  VKTRWSYANVWQAKSI----NGSAPKYSVSLIIPKSDTKTVTAVKNAIQAAYEE--GQSK 67

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
                 +V + +  +  LRDGDA+           + Y DS +I+A N    P +VD   
Sbjct: 68  LKGNSKSVPALTAIKTPLRDGDAERPDD-------EAYKDSYFINA-NSATAPGIVDTAR 119

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
            P+ +  EV Y G +  A +N   Y  +    KG +C L  +Q     E  G   +
Sbjct: 120 NPIIEHSEV-YSGVYGRASINF--YAFNSNGNKGIACGLNNLQKVSDGEPLGGKTR 172


>gi|150391703|ref|YP_001321752.1| hypothetical protein Amet_4011 [Alkaliphilus metalliredigens QYMF]
 gi|149951565|gb|ABR50093.1| conserved hypothetical protein [Alkaliphilus metalliredigens QYMF]
          Length = 183

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 53/192 (27%), Positives = 78/192 (40%), Gaps = 28/192 (14%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---IFP 62
           V  RLSY      V +        E Y   ++ PK DT+ INAV A +  A+ E    F 
Sbjct: 14  VNTRLSYFHGWEPVSV----NGGAEKYSVSVLIPKDDTETINAVNAAIDAAIEEGIAKFG 69

Query: 63  NVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVD 122
              P+        K+  +  LRDGD +           + Y    +I+A N    P +VD
Sbjct: 70  GKKPN--------KAAIKIPLRDGDVERDD--------EAYKGHYFINA-NSKTPPQIVD 112

Query: 123 RQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
           +  +P+ D  EV Y GC+    L+  A   +    KG +C L  +Q  K  E  G    +
Sbjct: 113 KSVKPIMDRGEV-YSGCYARVSLSFFA--FNSNGNKGVACGLGNIQKIKDGEPLGGKSSA 169

Query: 183 DTSEFKDYGEEQ 194
              +F    E+ 
Sbjct: 170 A-DDFTTLAEDD 180


>gi|300764693|ref|ZP_07074684.1| hypothetical protein LMHG_11075 [Listeria monocytogenes FSL N1-017]
 gi|300514579|gb|EFK41635.1| hypothetical protein LMHG_11075 [Listeria monocytogenes FSL N1-017]
          Length = 180

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 76/189 (40%), Gaps = 28/189 (14%)

Query: 9   RLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVT---EIFPNVS 65
           RLSY                 E Y   ++ PK+D + I+ +E  +  A+      F    
Sbjct: 14  RLSYFHGWEP----ASINGGAEKYSTAVLIPKSDKRTIDTIEKAIDAAIEVGLAKFGGKK 69

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
           P+        K+E +  LRDGD +           + Y    +I+A N    P +VD+  
Sbjct: 70  PN--------KAEIKLPLRDGDIERDD--------EAYQGHYFINA-NSTTAPQIVDQHV 112

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTS 185
           QP+ D  +V Y GC+    +N   Y  +    +G +  L  +QF +  E  G+   +   
Sbjct: 113 QPILDRSQV-YSGCYARVSINF--YAFNANGNRGVAAGLGNIQFVRDGEPLGSQVSAS-D 168

Query: 186 EFKDYGEEQ 194
           EF+   ++ 
Sbjct: 169 EFETLADDD 177


>gi|302873661|ref|YP_003842294.1| hypothetical protein Clocel_0760 [Clostridium cellulovorans 743B]
 gi|307686615|ref|ZP_07629061.1| hypothetical protein Ccel74_00586 [Clostridium cellulovorans 743B]
 gi|302576518|gb|ADL50530.1| hypothetical protein Clocel_0760 [Clostridium cellulovorans 743B]
          Length = 179

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 45/190 (23%), Positives = 78/190 (41%), Gaps = 22/190 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K R SY  +     +        E Y   ++ PK+DTK +N ++A ++ A  E    
Sbjct: 9   ITGKVRFSYANIWEAKSI----NGGDEKYSVSLIIPKSDTKTVNEIKAAIEAAKQEGKAK 64

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +  +  +  LRDGD             + Y +S +I+A N   +P +VD+
Sbjct: 65  FGG-------KIPANLKLPLRDGDIDRPDD-------EAYKNSYFINA-NSKDKPQVVDK 109

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
             +P+ D  EV Y GC+  A +N   Y  +    KG +C L  +Q     E      +++
Sbjct: 110 NVKPILDQEEV-YSGCYGRASINF--YTFNQNGNKGIACGLGNLQKLSDGEPLSGRSRAE 166

Query: 184 TSEFKDYGEE 193
                   ++
Sbjct: 167 DDFTSAEDDD 176


>gi|295428042|ref|ZP_06820674.1| hypothetical protein SIAG_00570 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|295128400|gb|EFG58034.1| hypothetical protein SIAG_00570 [Staphylococcus aureus subsp.
           aureus EMRSA16]
          Length = 203

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 71/179 (39%), Gaps = 20/179 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K R SY  +                Y   ++ PK+DT  I A+E  ++ A  E   +
Sbjct: 30  ITGKVRASYAHIFEP---HSMQEGQESKYSISLIIPKSDTSTIKAIEQAIEAAKEEGKVS 86

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +  +  +  LRDGD +             Y D+ +I+A +K   P ++D+
Sbjct: 87  KFGG------KVPANLKLPLRDGDTEREDDVN-------YQDAYFINASSK-QAPGIIDQ 132

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
               ++D   V   G ++ A +N+  +  +    KG +  L  +Q  +  E  G +  +
Sbjct: 133 NKIRLTDSGTVV-SGDYIRASINLFPFNTNGN--KGIAVGLNNIQLVEKGEPLGGASAA 188


>gi|328913310|gb|AEB64906.1| phage-associated protein [Bacillus amyloliquefaciens LL3]
          Length = 191

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 38/188 (20%), Positives = 69/188 (36%), Gaps = 28/188 (14%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTA---VTEIFP 62
            K R SY       +    +      Y   I+ PK D   +  ++A ++ A       + 
Sbjct: 17  GKVRFSYLH---AFQPHAIEEGQEPKYSTAILIPKTDKDTLRKIKAAVEAAKEAGKSKWG 73

Query: 63  NVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVD 122
              P          +  +  LRDGD +           + Y    +++A +K  +P +VD
Sbjct: 74  GKIP----------TNLKTPLRDGDEERPDQ-------EEYAGCYFLNASSK-TKPGIVD 115

Query: 123 RQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
           R    + D  E  Y GC+    +N   Y  +    KG +C L  +Q  +  +  G   ++
Sbjct: 116 RNLNHIID-SEELYSGCYGRVSINF--YAFNTAGNKGIACGLNNIQKLEDGDYLGGRSRA 172

Query: 183 DTSEFKDY 190
           +  +F   
Sbjct: 173 E-DDFDAL 179


>gi|319757794|gb|ADV69736.1| hypothetical phage protein [Streptococcus suis JS14]
          Length = 182

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 39/177 (22%), Positives = 70/177 (39%), Gaps = 17/177 (9%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
              R SY   +    +      S   Y   ++ PK DT  +N ++A ++ A  E      
Sbjct: 9   PNTRFSYLNANEPKSI----NGSTPKYSASLIIPKDDTVTVNKIKAAIEQAYKE--GESK 62

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
                 +V + S  +  LRDGD +           + Y ++ +++A N   +P +VD   
Sbjct: 63  LKGNGKSVPALSTLKTPLRDGDLERPDD-------EAYKNAYFVNA-NSPHKPGVVDGNR 114

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
           Q + D  E  Y G +  A +    Y  +    KG +C L  +Q  +  +  G   ++
Sbjct: 115 QEIIDTSE-LYSGIYGRASITF--YAFNSNGNKGIACGLNNLQKLRDGDPLGGRTRA 168


>gi|300911889|ref|ZP_07129332.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|300886135|gb|EFK81337.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|320140647|gb|EFW32501.1| hypothetical protein HMPREF9528_01271 [Staphylococcus aureus subsp.
           aureus MRSA131]
 gi|320142781|gb|EFW34584.1| hypothetical protein HMPREF9529_01881 [Staphylococcus aureus subsp.
           aureus MRSA177]
          Length = 200

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 71/179 (39%), Gaps = 20/179 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K R SY  +                Y   ++ PK+DT  I A+E  ++ A  E   +
Sbjct: 27  ITGKVRASYAHIFEP---HSMQEGQESKYSISLIIPKSDTSTIKAIEQAIEAAKEEGKVS 83

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +  +  +  LRDGD +             Y D+ +I+A +K   P ++D+
Sbjct: 84  KFGG------KVPANLKLPLRDGDTEREDDVN-------YQDAYFINASSK-QAPGIIDQ 129

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
               ++D   V   G ++ A +N+  +  +    KG +  L  +Q  +  E  G +  +
Sbjct: 130 NKIRLTDSGTVV-SGDYIRASINLFPFNTNGN--KGIAVGLNNIQLVEKGEPLGGASAA 185


>gi|307244261|ref|ZP_07526376.1| conserved hypothetical protein [Peptostreptococcus stomatis DSM
           17678]
 gi|306492411|gb|EFM64449.1| conserved hypothetical protein [Peptostreptococcus stomatis DSM
           17678]
          Length = 181

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 76/192 (39%), Gaps = 23/192 (11%)

Query: 4   LTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFP 62
           +T K  RLSY        +        E Y   ++ PK D K I A+E  +  A+ E   
Sbjct: 9   ITGKDTRLSYFNGWEPKSI----NRGPEKYSVSVLIPKDDIKTIKAIEEAIDVAIEEGIG 64

Query: 63  NVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVD 122
                 F     +K+  +  LRDGD +           + Y    +I+A N    P +VD
Sbjct: 65  -----KFGGKKPNKAAIKLPLRDGDIERDD--------EAYKGHYFINA-NSTSAPQIVD 110

Query: 123 RQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
           ++  P+ D  EV Y GC+    LN   Y  +    KG +C L  +Q  +  E  G    +
Sbjct: 111 KKVVPILDRSEV-YSGCYARVSLNF--YAFNSNGNKGVACGLGNIQKIRDGEPLGGKVNA 167

Query: 183 DTSEFKDYGEEQ 194
              EF    ++ 
Sbjct: 168 A-DEFTSLEDDD 178


>gi|297583085|ref|YP_003698865.1| hypothetical protein Bsel_0770 [Bacillus selenitireducens MLS10]
 gi|297141542|gb|ADH98299.1| hypothetical protein Bsel_0770 [Bacillus selenitireducens MLS10]
          Length = 182

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 46/191 (24%), Positives = 75/191 (39%), Gaps = 22/191 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T   RLSY  +     +        E Y   ++ PK+DTK I A+E  +  A+ E    
Sbjct: 11  ITDIVRLSYANVWEPKSI----NGGAEKYSVSLIIPKSDTKTIEAIERAVDAAIEEGK-- 64

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                   +  +K   +  LRDGD               Y DS +++A N    P +VD+
Sbjct: 65  ---KKHGRSFPNKQALKLPLRDGDIDR-------PGDDAYADSYFVNA-NSVSPPQIVDQ 113

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
              P+ +  +V Y G +    +N   +     + KG +C L  +Q  K  E  G    + 
Sbjct: 114 SVAPILNRSDV-YSGVYARVSVNFYPFA---SQNKGIACGLGNIQKIKDGEPLGGKASAA 169

Query: 184 TSEFKDYGEEQ 194
            S+F     + 
Sbjct: 170 -SDFSSVPTDD 179


>gi|304439197|ref|ZP_07399115.1| phage-associated protein [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372329|gb|EFM25917.1| phage-associated protein [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 193

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 46/193 (23%), Positives = 80/193 (41%), Gaps = 22/193 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T + RLSY  +     +        E Y   ++ PK+D K I  +E  +  A+ E    
Sbjct: 20  ITGEVRLSYANVWEPKSI----NGGKERYSVSVIIPKSDQKTIEKIEKAVDAAIDEGLSK 75

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
            +         +K   +  LRDGD +           + Y D+ +++A N    P +VDR
Sbjct: 76  FNGKK-----PNKKAIKLPLRDGDTEKDD--------EAYADAYFLNA-NSMTAPQIVDR 121

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
             +P+ D  EV Y G +    LN  AY ++    KG +  L  +Q  +  +  G    + 
Sbjct: 122 NVEPILDRSEV-YSGVYARVSLNFYAYNVNGN--KGVAVGLGNIQKLRDGQPLGNRSNAS 178

Query: 184 TSEFKDYGEEQDS 196
             +F    E+++ 
Sbjct: 179 -DDFDAMDEDEED 190


>gi|323484115|ref|ZP_08089485.1| hypothetical protein HMPREF9474_01236 [Clostridium symbiosum
           WAL-14163]
 gi|323402557|gb|EGA94885.1| hypothetical protein HMPREF9474_01236 [Clostridium symbiosum
           WAL-14163]
          Length = 182

 Score =  147 bits (371), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 72/198 (36%), Gaps = 29/198 (14%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE- 59
           + K+ V  R SY                   Y    + PK+D + +  ++  ++ A  + 
Sbjct: 8   LTKVIVPCRFSYLHCWEP----NAVNGGDPKYSVSAIIPKSDAETVEKIKRAIEQAKKDS 63

Query: 60  --IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ 117
              +    P          +  +  LRDGD             + Y DS + +A N    
Sbjct: 64  VSKWGGKIP----------ANLKLPLRDGDIDRPED-------EAYADSYFFNA-NSRQA 105

Query: 118 PLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWG 177
           P +V +  QP+ D  EV Y GC+    +N      +    +G +  L  +Q  +  E  G
Sbjct: 106 PQVVGKNVQPIFDQSEV-YSGCYGRISVNFY--GFNNNGNRGIAAGLGNIQKLRDGESLG 162

Query: 178 ASPKSDTSEFKDYGEEQD 195
               ++  +F    +++D
Sbjct: 163 GRSNAEE-DFDAVEDQED 179


>gi|298346387|ref|YP_003719074.1| phage-associated protein [Mobiluncus curtisii ATCC 43063]
 gi|298236448|gb|ADI67580.1| phage-associated protein [Mobiluncus curtisii ATCC 43063]
          Length = 187

 Score =  147 bits (371), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 47/192 (24%), Positives = 80/192 (41%), Gaps = 22/192 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T + RLSY  +     +        E Y   ++ PK D + ++A+EA +  A+ E    
Sbjct: 15  ITGEVRLSYATVWEPKSI----NGGKEKYSASLLIPKDDKETLDAIEAAIDAAIKEGIG- 69

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                F   +  +   +  LRDGD +           + Y    +++A N   QP +VD 
Sbjct: 70  ----KFGGKIPPRGSLKLPLRDGDTERDD--------EAYAGHYFVNA-NSINQPQIVDG 116

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
              P+ D  EV Y GC+    +N   Y  +    +G +C L  +Q  +  E  G    + 
Sbjct: 117 NVAPILDRSEV-YSGCYARVSINF--YAFNTNGNRGIACGLGNIQKTRDGEPLGGHVSAA 173

Query: 184 TSEFKDYGEEQD 195
            SEF  +  ++D
Sbjct: 174 -SEFDAWNADED 184


>gi|255525750|ref|ZP_05392681.1| conserved hypothetical protein [Clostridium carboxidivorans P7]
 gi|296188035|ref|ZP_06856427.1| hypothetical protein CLCAR_3550 [Clostridium carboxidivorans P7]
 gi|255510573|gb|EET86882.1| conserved hypothetical protein [Clostridium carboxidivorans P7]
 gi|296047161|gb|EFG86603.1| hypothetical protein CLCAR_3550 [Clostridium carboxidivorans P7]
          Length = 173

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/181 (26%), Positives = 74/181 (40%), Gaps = 22/181 (12%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
           M+ +T K R SY  +     +          Y   ++ PKAD   IN V+  +++A    
Sbjct: 1   MKVITGKVRFSYANVWEPKSI----NGGDPKYSVSLIIPKADKVTINKVKEAIESA---- 52

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
                              +  LRDGD   A         + Y DS +I+A N   +P +
Sbjct: 53  ---KKEGISKLGGSIPDNLKMPLRDGDVDRAEE-------EAYKDSYFINA-NSSTKPGI 101

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VD+  Q ++D  E FY GC+  A +   AY +D    KG +C L  +Q  +  E  G   
Sbjct: 102 VDKNVQTITDKSE-FYSGCYGRASITFYAYNVDGN--KGIACGLENLQKLEDGEALGGHS 158

Query: 181 K 181
           +
Sbjct: 159 R 159


>gi|313896436|ref|ZP_07829987.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312974860|gb|EFR40324.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 186

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 46/177 (25%), Positives = 76/177 (42%), Gaps = 17/177 (9%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVS 65
           VK R SY  +      K  +G +   +   ++ PK+DTK + AV+  ++ A  E      
Sbjct: 14  VKTRWSYANVWQ---AKSINGGA-LKFSVSLIIPKSDTKTVTAVKNAIQAAYDE--GQSK 67

Query: 66  PDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQA 125
                 +V + +  +  LRDGDA+           + Y DS +I+A N    P +VD   
Sbjct: 68  LKGNSKSVPALTAIKTPLRDGDAERPDD-------EAYKDSYFINA-NSATAPGIVDAAR 119

Query: 126 QPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
            P+ +  EV Y G +  A +N   Y  +    +G +C L  +Q     E  G   ++
Sbjct: 120 NPIIEHSEV-YSGVYGRASINF--YAFNSNGNRGIACGLNNLQKISDGEHLGGKTRA 173


>gi|29028628|ref|NP_803317.1| hypothetical protein phi12p11 [Staphylococcus phage phi 12]
 gi|66395607|ref|YP_239980.1| ORF019 [Staphylococcus phage 3A]
 gi|66395678|ref|YP_240049.1| ORF022 [Staphylococcus phage 47]
 gi|88195277|ref|YP_500080.1| hypothetical protein SAOUHSC_01565 [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148267472|ref|YP_001246415.1| hypothetical protein SaurJH9_1038 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150393525|ref|YP_001316200.1| hypothetical protein SaurJH1_1057 [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156603969|ref|YP_001429915.1| hypothetical protein SPTP3102_gp20 [Staphylococcus phage tp310-2]
 gi|253317127|ref|ZP_04840340.1| hypothetical protein SauraC_13549 [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|258428684|ref|ZP_05688218.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|258455586|ref|ZP_05703543.1| phage protein [Staphylococcus aureus A5937]
 gi|262049891|ref|ZP_06022753.1| hypothetical protein SAD30_0347 [Staphylococcus aureus D30]
 gi|282911108|ref|ZP_06318910.1| phage protein [Staphylococcus aureus subsp. aureus WBG10049]
 gi|296277207|ref|ZP_06859714.1| hypothetical protein SauraMR_12703 [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297207804|ref|ZP_06924238.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|18920552|gb|AAL82292.1| phage protein [Staphylococcus phage phi 12]
 gi|62635953|gb|AAX91064.1| ORF019 [Staphylococcus phage 3A]
 gi|62636102|gb|AAX91213.1| ORF022 [Staphylococcus phage 47]
 gi|87202835|gb|ABD30645.1| phage-related protein [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|147740541|gb|ABQ48839.1| hypothetical protein SaurJH9_1038 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149945977|gb|ABR51913.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           JH1]
 gi|154818055|gb|ABS87482.1| hypothetical protein [Staphylococcus phage tp310-2]
 gi|257849739|gb|EEV73703.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|257862274|gb|EEV85045.1| phage protein [Staphylococcus aureus A5937]
 gi|259162040|gb|EEW46620.1| hypothetical protein SAD30_0347 [Staphylococcus aureus D30]
 gi|282324803|gb|EFB55113.1| phage protein [Staphylococcus aureus subsp. aureus WBG10049]
 gi|283469577|emb|CAQ48788.1| conserved phage-associated protein [Staphylococcus aureus subsp.
           aureus ST398]
 gi|283470754|emb|CAQ49965.1| conserved phage-associated protein [Staphylococcus aureus subsp.
           aureus ST398]
 gi|296887520|gb|EFH26419.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|312438062|gb|ADQ77133.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|329724427|gb|EGG60937.1| hypothetical protein SA21189_1601 [Staphylococcus aureus subsp.
           aureus 21189]
          Length = 185

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 70/179 (39%), Gaps = 20/179 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K R SY  +                Y   ++ PK+DT  I A+E  ++ A  E   +
Sbjct: 12  ITGKVRASYAHIFEP---HSMQEGQEAKYSISLIIPKSDTSTIKAIEQAIEAAKEEGKVS 68

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +  +  +  LRDGD +             Y D+ +I+A +K   P ++D+
Sbjct: 69  KFGG------KVPANLKLPLRDGDTEREDDVN-------YQDAYFINASSK-QAPGIIDQ 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
               ++D       G ++ A +N+  +  +    KG +  L  +Q  +  E  G +  +
Sbjct: 115 NKIRLTD-SGTIVSGDYIRASINLFPFNTNGN--KGIAVGLNNIQLVEKGEPLGGASAA 170


>gi|282919246|ref|ZP_06326981.1| hypothetical protein SASG_00552 [Staphylococcus aureus subsp.
           aureus C427]
 gi|282317056|gb|EFB47430.1| hypothetical protein SASG_00552 [Staphylococcus aureus subsp.
           aureus C427]
          Length = 185

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 70/179 (39%), Gaps = 20/179 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K R SY  +                Y   ++ PK+DT  I A+E  ++ A  E   +
Sbjct: 12  ITGKVRASYAHIFEP---HSMQEGQESKYSISLIIPKSDTSTIKAIEQAIEAAKEEGKVS 68

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +  +  +  LRDGD +             Y D+ +I+A +K   P ++D+
Sbjct: 69  KFGG------KVPANLKLPLRDGDTEREDDVN-------YQDAYFINASSK-QAPGIIDQ 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
               ++D       G ++ A +N+  +  +    KG +  L  +Q  +  E  G +  +
Sbjct: 115 NKIRLTD-SGTIVSGDYIRASINLFPFNTNGN--KGIAVGLNNIQLVEKGEPLGGASAA 170


>gi|227872577|ref|ZP_03990913.1| phage-associated protein [Oribacterium sinus F0268]
 gi|227841578|gb|EEJ51872.1| phage-associated protein [Oribacterium sinus F0268]
          Length = 190

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/195 (26%), Positives = 77/195 (39%), Gaps = 17/195 (8%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T + RLSY  +         D S    Y   ++ PK+DTK I                 V
Sbjct: 7   TGEVRLSYVNVFEP----SADPSGNLKYSAMLLIPKSDTKTIA------AIEAAIKEATV 56

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAK-NKYVQPLLVDR 123
                    +  ++    L+DGD    +  +P  Y +       I+AK N    P +VDR
Sbjct: 57  LGKDKKFQGKIPAKLTSPLQDGDGVRPTDGEP--YGEECHGHYLINAKANPSYPPKVVDR 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
             Q + D  EV Y GC+  A ++  AY  +    KG +C L  +Q  +  E  G +  S 
Sbjct: 115 HRQEILDQSEV-YSGCYARANISFYAYNTNGN--KGIACGLNAIQKIRDGEPLGGTRVSV 171

Query: 184 TSEF-KDYGEEQDSD 197
              F  D+ E+ + D
Sbjct: 172 EDAFGDDFVEDDNLD 186


>gi|323443493|gb|EGB01109.1| hypothetical protein SAO46_0718 [Staphylococcus aureus O46]
          Length = 185

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 39/179 (21%), Positives = 72/179 (40%), Gaps = 20/179 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K R SY  +                Y   ++ PK+DT  I A+E  ++ A  E   +
Sbjct: 12  ITGKVRASYAHIFEP---HSMQEGQEAKYSISLIIPKSDTSTIKAIEQAIEAAKEEGKVS 68

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +  +  +  LRDGD +             Y D+ +I+A +K   P ++D+
Sbjct: 69  KFGG------KVPANLKLPLRDGDTEREDDVN-------YQDAYFINASSK-QAPGIIDQ 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
               ++D   V   G ++ A +N+  +  +    KG +  L  +Q  +  ER G +  +
Sbjct: 115 NKIRLTDSGTVV-SGDYIRASINLFPFNTNGN--KGIAVGLNNIQLVEKGERLGGASAA 170


>gi|323440322|gb|EGA98036.1| hypothetical protein SAO11_1059 [Staphylococcus aureus O11]
          Length = 185

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 71/179 (39%), Gaps = 20/179 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K R SY  +                Y   ++ PK+DT  I A+E  ++ A  E   +
Sbjct: 12  ITGKVRASYAHIFEP---HSMQEGQEAKYSISLIIPKSDTSTIKAIEQAIEAAKEEGKVS 68

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +  +  +  LRDGD +             Y D+ +I+A +K   P ++D+
Sbjct: 69  KFGG------KVPANLKLPLRDGDTEREDDVN-------YQDAYFINASSK-QAPGIIDQ 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
               ++D   V   G ++ A +N+  +  +    KG +  L  +Q  +  E  G +  +
Sbjct: 115 NKIRLTDSGTVV-SGDYIRASINLFPFNTNGN--KGIAVGLNNIQLVEKGEPLGGASAA 170


>gi|209363570|ref|YP_002267988.1| hypothetical protein phi2958PVL_gp18 [Staphylococcus phage
           phi2958PVL]
 gi|215401124|ref|YP_002332379.1| hypothetical protein SauSIPLA35_gp16 [Staphylococcus phage
           phiSauS-IPLA35]
 gi|257428254|ref|ZP_05604652.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257432436|ref|ZP_05608799.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|258445212|ref|ZP_05693407.1| gp16 [Staphylococcus aureus A6300]
 gi|282905879|ref|ZP_06313734.1| gp16 [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282926446|ref|ZP_06334078.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|208973071|dbj|BAG74387.1| hypothetical protein [Staphylococcus phage phi2958PVL]
 gi|215260475|gb|ACJ64605.1| gp16 [Staphylococcus phage phiSauS-IPLA35]
 gi|257275095|gb|EEV06582.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257283315|gb|EEV13447.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257855973|gb|EEV78893.1| gp16 [Staphylococcus aureus A6300]
 gi|282331171|gb|EFB60685.1| gp16 [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282591775|gb|EFB96846.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|315128371|gb|EFT84382.1| hypothetical protein CGSSa03_07336 [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329730620|gb|EGG67005.1| hypothetical protein SA21193_1534 [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 185

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 71/179 (39%), Gaps = 20/179 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K R SY  +                Y   ++ PK+DT  I A+E  ++ A  E   +
Sbjct: 12  ITGKVRASYAHIFEP---HSMQEGQEAKYSISLIIPKSDTSTIKAIEQAIEAAKEEGKVS 68

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +  +  +  LRDGD +             Y D+ +I+A +K   P ++D+
Sbjct: 69  KFGG------KVPANLKLPLRDGDTEREDDVN-------YQDAYFINASSK-QAPGIIDQ 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
               ++D   V   G ++ A +N+  +  +    KG +  L  +Q  +  E  G +  +
Sbjct: 115 NKIRLTDSGTVV-SGDYIRASINLFPFNTNGN--KGIAVGLNNIQLVEKGEPLGGASAA 170


>gi|21283155|ref|NP_646243.1| hypothetical protein MW1426 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49483720|ref|YP_040944.1| hypothetical protein SAR1542 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|87162369|ref|YP_494121.1| hypothetical protein SAUSA300_1424 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|161509703|ref|YP_001575362.1| hypothetical protein USA300HOU_1474 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|258419943|ref|ZP_05682902.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|258448862|ref|ZP_05696972.1| conserved hypothetical protein [Staphylococcus aureus A6224]
 gi|262053229|ref|ZP_06025381.1| hypothetical protein SA930_1971 [Staphylococcus aureus 930918-3]
 gi|282928294|ref|ZP_06335898.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|284024531|ref|ZP_06378929.1| hypothetical protein Saura13_08070 [Staphylococcus aureus subsp.
           aureus 132]
 gi|294848502|ref|ZP_06789248.1| hypothetical protein SKAG_00566 [Staphylococcus aureus A9754]
 gi|295407652|ref|ZP_06817441.1| hypothetical protein SMAG_02822 [Staphylococcus aureus A8819]
 gi|297246753|ref|ZP_06930568.1| hypothetical protein SLAG_02804 [Staphylococcus aureus A8796]
 gi|21204595|dbj|BAB95291.1| hypothetical protein [Staphylococcus aureus subsp. aureus MW2]
 gi|49241849|emb|CAG40541.1| hypothetical phage protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|87128343|gb|ABD22857.1| conserved hypothetical phage protein [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|160368512|gb|ABX29483.1| hypothetical bacteriophage protein [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|257844068|gb|EEV68458.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|257857899|gb|EEV80790.1| conserved hypothetical protein [Staphylococcus aureus A6224]
 gi|259158879|gb|EEW43971.1| hypothetical protein SA930_1971 [Staphylococcus aureus 930918-3]
 gi|282591965|gb|EFB96998.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|294824528|gb|EFG40951.1| hypothetical protein SKAG_00566 [Staphylococcus aureus A9754]
 gi|294967466|gb|EFG43506.1| hypothetical protein SMAG_02822 [Staphylococcus aureus A8819]
 gi|297176379|gb|EFH35652.1| hypothetical protein SLAG_02804 [Staphylococcus aureus A8796]
 gi|302333142|gb|ADL23335.1| conserved hypothetical phage protein [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|315197711|gb|EFU28045.1| hypothetical bacteriophage protein [Staphylococcus aureus subsp.
           aureus CGS01]
          Length = 185

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 71/179 (39%), Gaps = 20/179 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K R SY  +                Y   ++ PK+DT  I A+E  ++ A  E   +
Sbjct: 12  ITGKVRASYAHIFEP---HSMQEGQESKYSISLIIPKSDTSTIKAIEQAIEAAKEEGKVS 68

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +  +  +  LRDGD +             Y D+ +I+A +K   P ++D+
Sbjct: 69  KFGG------KVPANLKLPLRDGDTEREDDVN-------YQDAYFINASSK-QAPGIIDQ 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
               ++D   V   G ++ A +N+  +  +    KG +  L  +Q  +  E  G +  +
Sbjct: 115 NKIRLTDSGTVV-SGDYIRASINLFPFNTNGN--KGIAVGLNNIQLVEKGEPLGGASAA 170


>gi|303239093|ref|ZP_07325623.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
 gi|302593431|gb|EFL63149.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
          Length = 182

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 67/179 (37%), Gaps = 21/179 (11%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T K R SY  +     +        E Y   ++ PK+D   I  +   ++ A        
Sbjct: 9   TGKVRFSYANVWKPKSI----NGGEEKYSVSLIIPKSDKDTIRKINEAVEEA------KK 58

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ 124
           +              +  LRDGD   A         + Y ++ +I+A N    P +++RQ
Sbjct: 59  AGAEKFGQKFLSGNLKLPLRDGDTDRADD-------ENYENAYFINA-NSTTAPGIINRQ 110

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
            + + D  EV Y GC+  A +    +  +    KG +C L  +Q     E      +++
Sbjct: 111 KEEILDQTEV-YSGCYGRASVTFYPFNTNGN--KGIACGLNHLQKLADGEPLSGRGRAE 166


>gi|325478781|gb|EGC81892.1| hypothetical protein HMPREF9290_0161 [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 182

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 45/178 (25%), Positives = 73/178 (41%), Gaps = 21/178 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T + RLSY  +     +        E Y   I+ PK+D K I  +E  +  A+ E    
Sbjct: 10  ITGEVRLSYANVWEPKSI----NGGKERYSVSIIIPKSDQKTIEKIEKAVDAAIDEGLSK 65

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
            +         +K   +  LRDGD +           + Y D+ +++A N    P +VDR
Sbjct: 66  FNGKK-----PNKKSIKLPLRDGDTEKDD--------EAYADAYFLNA-NSMTAPQIVDR 111

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
             +P+ D  EV Y G +    LN  AY ++    KG +  L  +Q  +  +  G    
Sbjct: 112 NVEPILDRSEV-YSGVYARVSLNFYAYNVNGN--KGVAVGLGNIQKLRDGQPLGNRSN 166


>gi|309702938|emb|CBJ02269.1| putative phage protein [Escherichia coli ETEC H10407]
          Length = 182

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 76/193 (39%), Gaps = 18/193 (9%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++P+L      K  +G     +    +       Q+  +   +K    E +      
Sbjct: 8   VRLAFPSL---FEAKTVNGEGDPRFSAVFLMSPKHP-QLEEIRKAMKQVAKEKWGEKWEP 63

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
            +    +   + +  L DGD K           + +  + +++A NK  +P ++DR   P
Sbjct: 64  IYNQLEK---KLKLCLHDGDEKAE--------YEGFPGNFFLNAANK-ARPAVLDRDRSP 111

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           +       Y GC+V A ++I  +  D    K  + +L GVQF +  + +     +   +F
Sbjct: 112 LIQADGRPYAGCYVNAVIDI--WAQDNNFGKRINASLGGVQFLRDGDAFAGGGVASADDF 169

Query: 188 KDYGEEQDSDTSV 200
            D  E  D++  +
Sbjct: 170 DDISEGADAEALI 182


>gi|49485813|ref|YP_043034.1| hypothetical protein SAS0908 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|49244256|emb|CAG42683.1| hypothetical phage protein [Staphylococcus aureus subsp. aureus
           MSSA476]
          Length = 185

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/179 (21%), Positives = 71/179 (39%), Gaps = 20/179 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K R SY  +     M          Y   ++ PK+DT  I A+E  ++ A  E   +
Sbjct: 12  ITGKVRASYANIFKPRSM---QEGQEAKYSISLIIPKSDTSTIKAIEQAIEAAKEEGKVS 68

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +  +  +  LRDGD +             Y D+ +I+A +K   P +VD+
Sbjct: 69  KFGG------KVPANLKLPLRDGDTEREDDVN-------YQDAYFINASSK-QAPGIVDQ 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
               ++D       G ++ A +N+  +  +    KG +  L  +Q  +  E  G +  +
Sbjct: 115 DRNRLTD-SGAVVSGDYIRASINLFPFNTNGN--KGIAVGLNNIQLVEKGEPLGGASAA 170


>gi|293400007|ref|ZP_06644153.1| conserved hypothetical protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291306407|gb|EFE47650.1| conserved hypothetical protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 212

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 42/211 (19%), Positives = 70/211 (33%), Gaps = 20/211 (9%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---IF 61
           T + RLSY  L         D      Y   I+F K D +   A+    K A       F
Sbjct: 13  TGEVRLSYCHLFEP---HAFDEGQDAKYSVQIIFDKNDNETAAAISQAYKNAKQNGINKF 69

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
                      +    +  G++R+GD     +  P    +TY     ++ K     P + 
Sbjct: 70  GQKFGQITNDLMCKPGDKTGLVRNGDTDPRYTDDP----ETYAGKYIMNCKCS-TAPGVY 124

Query: 122 DRQ---AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGA 178
            ++    +   D +E+ Y GC+     N+  Y        G    L  V   +  +  G 
Sbjct: 125 SKETGTRKLTMDDQEIVYSGCYGKVTFNLYPYSKAGNT--GIGVGLNNVLKTRDGDNLGG 182

Query: 179 SPKSDTSEFKDYGEEQDSDTSVSNFASAEVD 209
               +     D+ +E   ++S   F   E D
Sbjct: 183 RVSGEV----DFADEFKDESSFPGFNDTEDD 209


>gi|194429250|ref|ZP_03061777.1| Bbp40 [Escherichia coli B171]
 gi|260845237|ref|YP_003223015.1| hypothetical protein ECO103_3130 [Escherichia coli O103:H2 str.
           12009]
 gi|291283827|ref|YP_003500645.1| hypothetical protein G2583_3133 [Escherichia coli O55:H7 str.
           CB9615]
 gi|331648297|ref|ZP_08349386.1| putative protein p50 [Escherichia coli M605]
 gi|331654012|ref|ZP_08355013.1| putative protein p50 [Escherichia coli M718]
 gi|194412658|gb|EDX28953.1| Bbp40 [Escherichia coli B171]
 gi|257760384|dbj|BAI31881.1| hypothetical protein ECO103_3130 [Escherichia coli O103:H2 str.
           12009]
 gi|290763700|gb|ADD57661.1| hypothetical protein G2583_3133 [Escherichia coli O55:H7 str.
           CB9615]
 gi|331042846|gb|EGI14987.1| putative protein p50 [Escherichia coli M605]
 gi|331048861|gb|EGI20937.1| putative protein p50 [Escherichia coli M718]
          Length = 182

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 75/193 (38%), Gaps = 18/193 (9%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++P+L      K  +G     +    +       Q+  +   +K    E +      
Sbjct: 8   VRLAFPSL---FEAKTVNGEGDPRFSAVFLMSPKHP-QLEEIRKAMKQVAKEKWGEKWEP 63

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
            +    +   +    L DGD K           + +  + +++A NK  +P ++DR   P
Sbjct: 64  IYNQLEK---KLNLCLHDGDEKAE--------YEGFPGNFFLNAANK-ARPAVLDRDRSP 111

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           +       Y GC+V A ++I  +  D    K  + +L GVQF +  + +     +   +F
Sbjct: 112 LIQADGRPYAGCYVNAVIDI--WAQDNNFGKRINASLGGVQFLRDGDAFAGGGVASADDF 169

Query: 188 KDYGEEQDSDTSV 200
            D  E  D++  +
Sbjct: 170 DDISEGADAEALI 182


>gi|71899882|ref|ZP_00682030.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71901328|ref|ZP_00683424.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71728912|gb|EAO31047.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71730322|gb|EAO32405.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 188

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/214 (26%), Positives = 92/214 (42%), Gaps = 29/214 (13%)

Query: 3   KLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIF 61
           KLT+K  RL++P L      K  +G     +    +   AD  Q+ A+   +     + +
Sbjct: 2   KLTLKNVRLAFPVLFEP---KKVNGEGEAAFSACFLIDPADP-QVKALNQAIDKMANDKW 57

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
             V   A L  +R     R  L DGD K +           +   +Y+SA+NK  +PL+V
Sbjct: 58  G-VKAAAQLKQMRMGD--RVALHDGDLKAS--------YDGFAGHLYVSARNK-SRPLVV 105

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           DR   P++      Y GC+V A + +  +  D    K  + +L GVQF +  E +     
Sbjct: 106 DRDRTPLTAQDGRPYAGCYVNANIEL--WAQDNNYGKRINASLGGVQFLRDGEAFAGGGV 163

Query: 182 SDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPW 215
           +   +F+D        ++V+  A  E    A+PW
Sbjct: 164 ASVEDFEDL-------SNVAELADVE---GAMPW 187


>gi|191174030|ref|ZP_03035547.1| Bbp40 [Escherichia coli F11]
 gi|190905721|gb|EDV65343.1| Bbp40 [Escherichia coli F11]
 gi|324014353|gb|EGB83572.1| hypothetical protein HMPREF9533_01585 [Escherichia coli MS 60-1]
          Length = 182

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 75/193 (38%), Gaps = 18/193 (9%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++P+L      K  +G     +    +       Q+  +   +K    E +      
Sbjct: 8   VRLAFPSL---FEAKTVNGEGDPRFSAVFLMSPKHP-QLEEIRKAMKQVAKEKWGEKWES 63

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
            +    +   +    L DGD K           + +  + +++A NK  +P ++DR   P
Sbjct: 64  IYNQLEK---KLNLCLHDGDEKAE--------YEGFPGNFFLNAANK-ARPAVLDRDRSP 111

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           +       Y GC+V A ++I  +  D    K  + +L GVQF +  + +     +   +F
Sbjct: 112 LIQADGRPYAGCYVNAVIDI--WAQDNNFGKRINASLGGVQFLRDGDAFAGGGVASADDF 169

Query: 188 KDYGEEQDSDTSV 200
            D  E  D++  +
Sbjct: 170 DDISEGADAEALI 182


>gi|320530601|ref|ZP_08031653.1| hypothetical protein HMPREF9555_01758 [Selenomonas artemidis F0399]
 gi|320137128|gb|EFW29058.1| hypothetical protein HMPREF9555_01758 [Selenomonas artemidis F0399]
          Length = 182

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 69/184 (37%), Gaps = 19/184 (10%)

Query: 1   MQKLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M +L +K  RLSY  +      K P     + Y   ++  K DTK +N ++  +  A  E
Sbjct: 1   MSRLVLKNVRLSYANIWEP---KEPADGGDKKYSASLIIRKTDTKTLNGIKKAIAEAKEE 57

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISA-KNKYVQP 118
                            S  +  LRDGD               Y   ++I+A       P
Sbjct: 58  G----KTKLANKKGVIPSNIKLPLRDGDEDRPDD-------PAYEGCMFINANATVNYPP 106

Query: 119 LLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGA 178
            +VDR  QP+ D  EV Y GC+    ++  A+  +     G  C L  +Q     +   +
Sbjct: 107 KIVDRHVQPIMDRSEV-YSGCYANVSVSFYAFNQNGNI--GIGCGLGNIQKIGDGDPLSS 163

Query: 179 SPKS 182
           +  +
Sbjct: 164 ARSA 167


>gi|218555132|ref|YP_002388045.1| hypothetical protein ECIAI1_2662 [Escherichia coli IAI1]
 gi|218361900|emb|CAQ99500.1| conserved hypothetical protein from bacteriophage origin
           [Escherichia coli IAI1]
          Length = 182

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 76/193 (39%), Gaps = 18/193 (9%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++P+L      K  +G     +    +       Q+  +   +K    E +      
Sbjct: 8   VRLAFPSL---FEAKTVNGEGDPRFSAVFLMSPKHP-QLEEIRKAMKQVAKEKWGEKWEP 63

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
            +    +   +    L DGD K           + +  + +++A NK  +P ++DR   P
Sbjct: 64  IYNQLEK---KLNLCLHDGDEKAE--------YEGFPGNFFLNAANK-ARPAVLDRDRSP 111

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           +       Y GC+V A ++I  +  D    K  + +L+GVQF +  + +     +   +F
Sbjct: 112 LIQADGRPYAGCYVNAVIDI--WAQDNNFGKRINASLSGVQFLRDGDAFAGGGVASADDF 169

Query: 188 KDYGEEQDSDTSV 200
            D  E  D++  +
Sbjct: 170 DDISEGADAEALI 182


>gi|71901489|ref|ZP_00683576.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71728745|gb|EAO30889.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 188

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/214 (26%), Positives = 90/214 (42%), Gaps = 29/214 (13%)

Query: 3   KLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIF 61
           KLT+K  RL++P L      K  +G     +    +   AD  Q+ A+   +     + +
Sbjct: 2   KLTLKNVRLAFPVLFEP---KKVNGEGEAAFSACFLIDPADP-QVKALNQAIDKMANDKW 57

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
             V   A L  +R     R  L DGD K +           +   +Y+SA+NK  +PL++
Sbjct: 58  G-VKAAAQLKQMRMGD--RVALHDGDLKAS--------YDGFAGHLYVSARNK-ARPLVI 105

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           DR   P++      Y GC+V A + +  +  D    K  + +L GVQF +  E +     
Sbjct: 106 DRDRTPLTAQDGRPYAGCYVNANIEL--WAQDNNYGKRINASLGGVQFLRDGEAFAGGGV 163

Query: 182 SDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPW 215
           +   +F+D           SN A  E    A+PW
Sbjct: 164 ASVEDFEDL----------SNVAELEDVEGAMPW 187


>gi|315122934|ref|YP_004063423.1| hypothetical protein CKC_05950 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496336|gb|ADR52935.1| hypothetical protein CKC_05950 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 183

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 110/183 (60%), Positives = 137/183 (74%), Gaps = 2/183 (1%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
           MQ + +KGRLSYPALD   +M L D S +E++G DI+ PK + + I      L+ A  + 
Sbjct: 1   MQSIKIKGRLSYPALDKMTKMTLGDNSVMEYFGADIIIPKTNKETIARFTEVLRKAAKDS 60

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           +PN++PD F+   R     R +++DGD KIA++ KPE YT+ YT+S YISAKNK VQPLL
Sbjct: 61  YPNMNPDRFIEQARINK--RAIIKDGDEKIATATKPETYTKAYTNSWYISAKNKLVQPLL 118

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VDRQAQ VS+PR+VFY GCWVIAKLNI  YEL  +KTKGFSCTLTGVQFFK+DERWGASP
Sbjct: 119 VDRQAQIVSNPRDVFYAGCWVIAKLNISTYELGTFKTKGFSCTLTGVQFFKNDERWGASP 178

Query: 181 KSD 183
           KS+
Sbjct: 179 KSE 181


>gi|332088059|gb|EGI93184.1| bbp40 [Shigella boydii 5216-82]
          Length = 182

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 39/193 (20%), Positives = 75/193 (38%), Gaps = 18/193 (9%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++PAL      K  +G     +    +       Q+  +   +K    E +      
Sbjct: 8   VRLAFPAL---FEAKTVNGEGDPRFSAVFLMSPKHP-QLEEIRKAMKQVAKEKWGEKWES 63

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
            +    +   +    L DGD K           + +  + +++A NK  +P ++DR   P
Sbjct: 64  IYNQLEK---KLNLCLHDGDEKAE--------YEGFPGNFFLNAANK-ARPAVLDRDRSP 111

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           +       Y GC+V A ++I  +  D    K  + +L GVQF +  + +     +   +F
Sbjct: 112 LIQADGRPYAGCYVNAVIDI--WAQDNNFGKRINASLGGVQFLRDGDAFAGGGVASADDF 169

Query: 188 KDYGEEQDSDTSV 200
            D  E  D++  +
Sbjct: 170 DDISEGADAEALI 182


>gi|71276265|ref|ZP_00652543.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71900320|ref|ZP_00682455.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71162873|gb|EAO12597.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71729895|gb|EAO31991.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 188

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 55/214 (25%), Positives = 92/214 (42%), Gaps = 29/214 (13%)

Query: 3   KLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIF 61
           KLT+K  RL++P L      K  +G     +    +   AD  Q+ A+   +     + +
Sbjct: 2   KLTLKNVRLAFPVLFEP---KKVNGEGEAAFSACFLIDPADP-QVKALNQAIDKMANDKW 57

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
             V   A L  +R     R  L DGD K +           +   +Y+SA+NK  +PL+V
Sbjct: 58  G-VKAAAQLKQMRMGD--RVALHDGDLKAS--------YDGFAGHLYVSARNK-SRPLVV 105

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           DR   P++      Y GC+V A + +  +  D    K  + +L GVQF +  E +     
Sbjct: 106 DRDRTPLTAQDGRPYAGCYVNANIEL--WAQDNNYGKRINASLGGVQFLRDGEAFAGGGV 163

Query: 182 SDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPW 215
           +   +F+D        ++V+     E   +A+PW
Sbjct: 164 ASVEDFEDL-------SNVAELVDVE---EAMPW 187


>gi|28199024|ref|NP_779338.1| hypothetical protein PD1132 [Xylella fastidiosa Temecula1]
 gi|28199600|ref|NP_779914.1| hypothetical protein PD1725 [Xylella fastidiosa Temecula1]
 gi|182681746|ref|YP_001829906.1| hypothetical protein XfasM23_1204 [Xylella fastidiosa M23]
 gi|182682341|ref|YP_001830501.1| hypothetical protein XfasM23_1824 [Xylella fastidiosa M23]
 gi|28057122|gb|AAO28987.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|28057715|gb|AAO29563.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|182631856|gb|ACB92632.1| conserved hypothetical protein [Xylella fastidiosa M23]
 gi|182632451|gb|ACB93227.1| conserved hypothetical protein [Xylella fastidiosa M23]
 gi|307578622|gb|ADN62591.1| hypothetical protein XFLM_02960 [Xylella fastidiosa subsp.
           fastidiosa GB514]
 gi|307580175|gb|ADN64144.1| hypothetical protein XFLM_11445 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 188

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 49/214 (22%), Positives = 84/214 (39%), Gaps = 29/214 (13%)

Query: 3   KLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIF 61
           KLT+K  RL++P L      K  +G     +    +   AD  Q+ A+   +     + +
Sbjct: 2   KLTLKNVRLAFPVLFEP---KKVNGEGEAAFSACFLIDPADP-QVKALNQAIDKMANDKW 57

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
              +                 +R GD         +     +   +Y+SA+NK  +PL++
Sbjct: 58  GAKAAAQLKQ-----------MRMGDRVALHDGDLKASYDGFAGHLYVSARNK-ARPLVI 105

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           DR   P++      Y GC+V A + +  +  D    K  + +L GVQF +  E +     
Sbjct: 106 DRDRTPLAAQDGRPYAGCYVNANIEL--WAQDNNYGKRINASLGGVQFLRDGEAFAGGGV 163

Query: 182 SDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPW 215
           +   +F+D           SN A  E    A+PW
Sbjct: 164 ASVEDFEDL----------SNVAELEDVEGAMPW 187


>gi|273810428|ref|YP_003344899.1| gp09 [Xylella phage Xfas53]
 gi|257097803|gb|ACV41109.1| gp09 [Xylella phage Xfas53]
          Length = 188

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 49/214 (22%), Positives = 86/214 (40%), Gaps = 29/214 (13%)

Query: 3   KLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIF 61
           KLT+K  RL++P L      K  +G     +    +   AD  Q+ A+   +     + +
Sbjct: 2   KLTLKNVRLAFPVLFEP---KKVNGEGEAAFSACFLIDPADP-QVKALNQAIDKMANDKW 57

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
              +                 +R GD         +     +   +Y+SA+NK  +PL+V
Sbjct: 58  GVKAAAQLKQ-----------MRMGDKVALHDGDLKASYDGFAGHLYVSARNK-ARPLVV 105

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           DR   P++      Y GC+V A + +  +  D    K  + +L GVQF +  E +     
Sbjct: 106 DRDRTPLTAQDGRPYAGCYVNANIEL--WAQDNNYGKRINASLGGVQFLRDGEAFAGGGV 163

Query: 182 SDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPW 215
           +   +F+D        ++V+  A  E    A+PW
Sbjct: 164 ASVEDFEDL-------SNVAELADVE---GAMPW 187


>gi|297585292|ref|YP_003701072.1| APSE-2 prophage; hypothetical [Bacillus selenitireducens MLS10]
 gi|297143749|gb|ADI00507.1| APSE-2 prophage; hypothetical [Bacillus selenitireducens MLS10]
          Length = 182

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 49/202 (24%), Positives = 80/202 (39%), Gaps = 28/202 (13%)

Query: 1   MQKLTV-----KGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKT 55
           M K+ +       R SY  +   V +K         Y   I+ PK+ T  I  ++A +K 
Sbjct: 1   MTKIKIGTTQQPVRFSYANVHEPVSVK----GGEPKYSVSIIIPKSHTATIQKIQAAIKE 56

Query: 56  AVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKY 115
            + E              +  S  +  LRDGD               Y +S +I+A +K 
Sbjct: 57  TIEEQKDRFGG-------KVPSNVKSPLRDGDTDRPDD-------PAYENSYFINASDK- 101

Query: 116 VQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDER 175
           ++P +V    + + +P E FY GC+  A LN   Y ++    KG S  L  +   +  E 
Sbjct: 102 MKPGIVGPDREDLMNPSE-FYSGCYGRASLNFYVYNVNGN--KGVSAGLQNLMKTEDGEP 158

Query: 176 WGASPKSDTSEFKDYGEEQDSD 197
            G    ++  +F D  +E   D
Sbjct: 159 LGGRVSAEK-DFADDEDESIHD 179


>gi|71898929|ref|ZP_00681096.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71731341|gb|EAO33405.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 188

 Score =  141 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 55/214 (25%), Positives = 92/214 (42%), Gaps = 29/214 (13%)

Query: 3   KLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIF 61
           KLT+K  RL++P L      K  +G     +    +   AD  Q+ A+   +     + +
Sbjct: 2   KLTLKNVRLAFPVLFEP---KKVNGEGEAAFSACFLIDPADP-QVKALNQAIDKMANDKW 57

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
             V   A L  +R     R  L DGD K +           +   +Y+SA+NK  +PL++
Sbjct: 58  G-VKAAAQLKQMRMGD--RVALHDGDLKAS--------YDGFAGHLYVSARNK-ARPLVI 105

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           DR   P++      Y GC+V A + +  +  D    K  + +L GVQF +  E +     
Sbjct: 106 DRDRTPLAAQDGRPYAGCYVNANIEL--WAQDNNYGKRINASLGGVQFLRDGEAFAGGGV 163

Query: 182 SDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPW 215
           +   +F+D        ++V+  A  E    A+PW
Sbjct: 164 ASVEDFEDL-------SNVAELADVE---GAMPW 187


>gi|295096877|emb|CBK85967.1| Protein of unknown function (DUF2815) [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 182

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/193 (21%), Positives = 75/193 (38%), Gaps = 18/193 (9%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++PAL      K  +G     +    +       Q+  V   LK    E +      
Sbjct: 8   VRLAFPAL---FEAKTVNGEGDPRFSAVFLMDPKHP-QLEEVRKALKQVAKEKWGEKWET 63

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
            +    +   +    L DGD K           + +  + +++A NK  +P ++DR   P
Sbjct: 64  IYGQLEK---KLNLCLHDGDEKAE--------YEGFPGNFFLNAANK-ARPAVIDRDRTP 111

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           +       Y GC+V A ++I  +  D    K  + +L GVQF +  + +     +   +F
Sbjct: 112 LIQADGRPYAGCYVNAVIDI--WAQDNNFGKRVNASLGGVQFLRDGDAFAGGGVAAPDDF 169

Query: 188 KDYGEEQDSDTSV 200
            D  E  D+D  +
Sbjct: 170 DDISEGADADALI 182


>gi|160937656|ref|ZP_02085016.1| hypothetical protein CLOBOL_02546 [Clostridium bolteae ATCC
           BAA-613]
 gi|158439301|gb|EDP17053.1| hypothetical protein CLOBOL_02546 [Clostridium bolteae ATCC
           BAA-613]
          Length = 189

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/181 (22%), Positives = 71/181 (39%), Gaps = 20/181 (11%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T   R SY  +              + Y   ++ PK+D K ++ ++  ++ A  E   N 
Sbjct: 12  TGTVRFSYLHVFEPW---AAQEGQEKRYSVCLLIPKSDKKTLSKIKEAIEAAKKEGAANK 68

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ 124
                       +  +  LRDGD + A           YT   +++A N   +P+L+D+ 
Sbjct: 69  FKGKT-------AGLKLPLRDGDEERADD------YPEYTGMYFMNA-NSNRKPILLDQD 114

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
              + D  E  Y GCW  A +N      +    KG +  L  ++  + DE  G +   D+
Sbjct: 115 NNEILDQTE-MYSGCWGQASINFFP--FNSNGNKGIAVGLNALKKKRDDEPLGGTITVDS 171

Query: 185 S 185
           +
Sbjct: 172 A 172


>gi|291545368|emb|CBL18476.1| Protein of unknown function (DUF2815) [Ruminococcus sp. SR1/5]
          Length = 179

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 44/193 (22%), Positives = 74/193 (38%), Gaps = 17/193 (8%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
           M+    K R SY  +     +          Y   ++ PK+DTK +  +EA ++ A  E 
Sbjct: 1   MKPCLGKWRWSYANVWEPKSI----NGGTPKYSVSLIIPKSDTKTVAKIEAAIEAAYRE- 55

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
                      +V + S  +  LRDGD +             Y  S +++A N    P +
Sbjct: 56  -GEAKLKGNGKSVPALSVLKTPLRDGDLERPDD-------PAYAGSFFVNA-NATSAPGI 106

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VD    P+    EV Y G +  A ++   Y  +    KG +C L  +Q     E  G   
Sbjct: 107 VDADRNPILTRSEV-YSGIYGRASISF--YAFNSSGNKGIACGLNNLQKIHDGEPLGGKA 163

Query: 181 KSDTSEFKDYGEE 193
            +++    D  ++
Sbjct: 164 SAESDFATDNDDD 176


>gi|323693314|ref|ZP_08107532.1| phage protein [Clostridium symbiosum WAL-14673]
 gi|323502797|gb|EGB18641.1| phage protein [Clostridium symbiosum WAL-14673]
          Length = 190

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 47/198 (23%), Positives = 77/198 (38%), Gaps = 19/198 (9%)

Query: 1   MQKLT-VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M+ +T    R SY  +     +          Y   ++ PK+DTK I  ++A ++ A  E
Sbjct: 11  MKVITGPNTRWSYANVWEPKSI----NGGTPKYSVSLIIPKSDTKTIAKIKAAIEAAYKE 66

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                       +V + S  +  LRDGD +             Y  S +++A N    P 
Sbjct: 67  --GEAKLKGNGKSVPALSVLKTPLRDGDLERPDD-------PAYAGSYFVNA-NASSAPG 116

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +VD    P+    EV Y G +  A ++   Y  +    KG +C L  +Q  +  E  G  
Sbjct: 117 IVDADRNPILTRSEV-YSGVYGRASISF--YAFNSSGNKGIACGLNNLQKIRDGEPLGGK 173

Query: 180 PKSDTSEFKDYGEEQDSD 197
             ++ S+F     E   D
Sbjct: 174 ASAE-SDFATDDAEDFLD 190


>gi|167761126|ref|ZP_02433253.1| hypothetical protein CLOSCI_03524 [Clostridium scindens ATCC 35704]
 gi|167661245|gb|EDS05375.1| hypothetical protein CLOSCI_03524 [Clostridium scindens ATCC 35704]
          Length = 198

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 45/194 (23%), Positives = 78/194 (40%), Gaps = 18/194 (9%)

Query: 1   MQKLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M+ +T    R SY  +     +          Y   ++ PK+DTK I  ++A ++ A  E
Sbjct: 19  MKVITGVDTRWSYANVWEPKSI----NGGTPKYSVSLIIPKSDTKTIAKIKAAIEAAYKE 74

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                       +V + S  +  LRDGDA+           + Y ++ +++A N    P 
Sbjct: 75  --GEAKLKGNGKSVPALSVLKTPLRDGDAERPDD-------EAYKNAYFVNA-NATSAPG 124

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +VD    P+    EV Y G +  A +    Y  +    KG +C L  +Q  +  E  G  
Sbjct: 125 IVDADLNPILTRSEV-YSGVYGRASITF--YAFNSSGNKGIACGLNNLQKIRDGEPLGGK 181

Query: 180 PKSDTSEFKDYGEE 193
             +++    D  E+
Sbjct: 182 ASAESDFATDDDED 195


>gi|15837287|ref|NP_297975.1| hypothetical protein XF0685 [Xylella fastidiosa 9a5c]
 gi|9105567|gb|AAF83495.1|AE003912_7 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 188

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/214 (21%), Positives = 86/214 (40%), Gaps = 29/214 (13%)

Query: 3   KLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIF 61
           KLT+K  RL++P L      K  +G     +    +   AD  Q+ A+   +     + +
Sbjct: 2   KLTLKNVRLAFPVLFEP---KKVNGEGEAAFSACFLIDPADP-QVKALNQAIDKMANDKW 57

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
              +                 +R GD         +     +   +Y+SA+NK  +PL++
Sbjct: 58  GVKAAAQLKQ-----------MRMGDRVALHDGDLKASYDGFAGHLYVSARNK-ARPLVI 105

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           DR   P++      Y GC+V A + +  +  D    K  + +L GVQF +  E +     
Sbjct: 106 DRDRTPLAAQDGRPYAGCYVNANIEL--WAQDNNYGKRINASLGGVQFLRDGEAFAGGGV 163

Query: 182 SDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPW 215
           +   +F+D        ++++  A  E D   +PW
Sbjct: 164 ASVEDFEDL-------SAIAELADVEGD---MPW 187


>gi|258646420|ref|ZP_05733889.1| conserved hypothetical protein [Dialister invisus DSM 15470]
 gi|260403823|gb|EEW97370.1| conserved hypothetical protein [Dialister invisus DSM 15470]
          Length = 194

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 57/196 (29%), Gaps = 16/196 (8%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RLSY  +   ++       +   Y   I+ PK D      ++  ++ A           
Sbjct: 11  VRLSYVHI---LKAYARIPGAEAKYQTTILVPKTDIAAKAEIDRAIEAAKANGITGKWNG 67

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP-LLVDRQAQ 126
                  + +     + DGD     +     Y          +A +   +P  +VD    
Sbjct: 68  V------APAIVATPVHDGDGL---TQNGAEYGPECKGHWVFTASSAADKPVEVVDANLN 118

Query: 127 PVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSE 186
           P+  P    Y G +    +N   Y       KG  C L  VQ     E  G    S  S 
Sbjct: 119 PIISPI-QIYSGIYANISVNFFPYNFQGK--KGIGCGLGPVQKVADGEPLGGQAPSAKSV 175

Query: 187 FKDYGEEQDSDTSVSN 202
           F            ++ 
Sbjct: 176 FAAQPAAVQKVNPLTG 191


>gi|15839113|ref|NP_299801.1| hypothetical protein XF2523 [Xylella fastidiosa 9a5c]
 gi|9107729|gb|AAF85321.1|AE004059_11 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 188

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 47/214 (21%), Positives = 85/214 (39%), Gaps = 29/214 (13%)

Query: 3   KLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIF 61
           KLT+K  RL++P L      K  +G     +    +   AD  Q+ A+   +     + +
Sbjct: 2   KLTLKNVRLAFPVLFEP---KKVNGEGEAAFSACFLIDPADP-QVKALNQAIDKMANDKW 57

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
              +                 +R GD         +     +   +Y+SA+NK  +PL++
Sbjct: 58  GVKAAAQLKQ-----------MRMGDRVALHDGDLKASYDGFAGHLYVSARNK-ARPLVI 105

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           DR   P++      Y GC+V A + +  +  D    K  + +L GVQF    E +     
Sbjct: 106 DRDRTPLAAQDGRPYAGCYVNANIEL--WAQDNNYGKRINASLGGVQFVGDGEAFAGGGV 163

Query: 182 SDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPW 215
           +   +F+D        ++++  A  E    A+PW
Sbjct: 164 ASVEDFEDL-------SAIAELADVE---GAMPW 187


>gi|297587102|ref|ZP_06945747.1| phage-associated protein [Finegoldia magna ATCC 53516]
 gi|297575083|gb|EFH93802.1| phage-associated protein [Finegoldia magna ATCC 53516]
          Length = 180

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 44/178 (24%), Positives = 72/178 (40%), Gaps = 21/178 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T + RLSY        +        E Y   ++ PK+D K I  +E  +  A+ E    
Sbjct: 8   ITGEVRLSYFNGWEPKSI----NGGKERYSVSVIIPKSDQKTIEKIEKAVDAAIDEGLSK 63

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
            +         +K   +  LRDGD +           + Y D+ +++A N    P +VDR
Sbjct: 64  FNGKK-----PNKKAIKLPLRDGDTEKDD--------EAYADAYFLNA-NSMTAPQIVDR 109

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
             +P+ D  EV Y G +    LN  AY ++    KG +  L  +Q  +  +  G    
Sbjct: 110 NVEPILDRSEV-YSGVYARVSLNFYAYNVNGN--KGVAVGLGNIQKLRDGQPLGNRSN 164


>gi|71911264|ref|YP_282814.1| phage protein [Streptococcus pyogenes MGAS5005]
 gi|94989083|ref|YP_597184.1| phage protein [Streptococcus pyogenes MGAS9429]
 gi|94992974|ref|YP_601073.1| phage protein [Streptococcus pyogenes MGAS2096]
 gi|71854046|gb|AAZ52069.1| phage protein [Streptococcus pyogenes MGAS5005]
 gi|94542591|gb|ABF32640.1| phage protein [Streptococcus pyogenes MGAS9429]
 gi|94546482|gb|ABF36529.1| phage protein [Streptococcus pyogenes MGAS2096]
          Length = 185

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 50/181 (27%), Positives = 69/181 (38%), Gaps = 19/181 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K RLSY AL      +         Y   I+ PK D   I  ++   K A      N
Sbjct: 9   VTGKVRLSYAALLEPKAFE----GQEAKYSTVILIPKTDKVTIKKIKDAQKAAYEAAKDN 64

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                    V      +  LRDGD ++ +   PE     Y   +++S  +K  +P ++DR
Sbjct: 65  KLKGVKWERV------KTTLRDGDEEMDTEEHPE-----YAGHMFMSVSSK-TRPQIIDR 112

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
              PV    EV Y G +    LN  AY       KG SC L  VQ     +  G    +D
Sbjct: 113 YKNPVDSADEV-YSGVYARVSLNAYAYNTAGN--KGISCGLNNVQIVAKGDYLGGRSSAD 169

Query: 184 T 184
            
Sbjct: 170 A 170


>gi|293401132|ref|ZP_06645276.1| conserved hypothetical protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291305258|gb|EFE46503.1| conserved hypothetical protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 190

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/194 (21%), Positives = 77/194 (39%), Gaps = 18/194 (9%)

Query: 1   MQKLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M+ +T    R SY  +     +          Y   ++ PK+DTK +  ++A ++ A  E
Sbjct: 11  MKVITGPDTRWSYANVWEPKSI----NGGTPKYSVSLIIPKSDTKTVAKIKAAIEAAYKE 66

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                       +V + S  +  LRDGD +             Y ++ +++A N    P 
Sbjct: 67  --GESKLKGNGKSVPALSVIKTPLRDGDLERPDDA-------AYANAYFVNA-NATSAPG 116

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +VD    P+    EV Y G +  A ++   Y  +    KG +C L  +Q  +  E  G  
Sbjct: 117 IVDADRNPILTRSEV-YSGVYGRASISF--YAFNSSGNKGIACGLNNLQKIRDGEPLGGK 173

Query: 180 PKSDTSEFKDYGEE 193
             +++    D  ++
Sbjct: 174 ASAESDFASDEDDD 187


>gi|269120027|ref|YP_003308204.1| hypothetical protein Sterm_1410 [Sebaldella termitidis ATCC 33386]
 gi|268613905|gb|ACZ08273.1| hypothetical protein Sterm_1410 [Sebaldella termitidis ATCC 33386]
          Length = 195

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/194 (24%), Positives = 75/194 (38%), Gaps = 13/194 (6%)

Query: 2   QKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIF 61
           + +T K RL++PAL T V M        + YGC I+ PK+D   ++ ++A +  AV    
Sbjct: 7   EAVTGKVRLNFPALFTPVAMDKNKPE-DKKYGCQILVPKSDKATMDRLKAAIDEAVKSGI 65

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAK-NKYVQPLL 120
                        + +     + DGD     S   E+Y     D   ++A  N    P +
Sbjct: 66  SGAWGGV------TPAIIHKPVHDGDGTKPVSG--ESYGDECKDHYVLNATANVNYPPDV 117

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VD Q  P+ +  E  Y G +    LN   Y       KG   ++  VQ        G +P
Sbjct: 118 VDTQLNPILNQSE-IYSGVYARVLLNFYPYNYQGK--KGIGVSIGNVQKIADGTPLGGAP 174

Query: 181 KSDTSEFKDYGEEQ 194
           K     F +   + 
Sbjct: 175 KKSADVFGEVKYDD 188


>gi|300853538|ref|YP_003778522.1| phage-like protein [Clostridium ljungdahlii DSM 13528]
 gi|300433653|gb|ADK13420.1| phage-related protein [Clostridium ljungdahlii DSM 13528]
          Length = 182

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/192 (27%), Positives = 80/192 (41%), Gaps = 28/192 (14%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---IFP 62
           V  RLSY      V +      S E Y   ++ PK+D + INA+ A +  A+ E    F 
Sbjct: 13  VNTRLSYFHGWEPVSI----NGSAEKYSVSVLIPKSDKETINAINAAIDAAIEEGISKFG 68

Query: 63  NVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVD 122
              P+        K+  +  LRDGDA+           + Y    +++A N    P +VD
Sbjct: 69  GKKPN--------KAAIKLPLRDGDAERDD--------EAYKGHYFVNA-NSITAPQIVD 111

Query: 123 RQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS 182
           +  +P+ D  EV Y GC+    LN   Y  +    KG +C L  +Q  K  E  G    +
Sbjct: 112 KAVKPILDRNEV-YSGCYARVSLNF--YAFNSNGNKGVACGLGNIQKIKDGEPLGGRTNA 168

Query: 183 DTSEFKDYGEEQ 194
              +F    ++ 
Sbjct: 169 A-DDFTTVEDDD 179


>gi|269976593|ref|ZP_06183578.1| phage-associated protein [Mobiluncus mulieris 28-1]
 gi|269935394|gb|EEZ91943.1| phage-associated protein [Mobiluncus mulieris 28-1]
          Length = 162

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 71/170 (41%), Gaps = 18/170 (10%)

Query: 26  GSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRD 85
                 Y   ++ PK D   I+A+ A ++ A+TE         F   +  ++  +  LRD
Sbjct: 8   NGGKPKYSVSLLIPKDDAVTIDAINAAIEAAITEGIG-----KFGGKIPPRASLKLPLRD 62

Query: 86  GDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKL 145
           GD +             Y    +++A N    P +VD+   P+ D  EV Y GC+    +
Sbjct: 63  GDTERDD--------DAYAGHYFVNA-NSINAPQIVDQDVNPILDRSEV-YSGCYGRVSI 112

Query: 146 NIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQD 195
           N   Y  +    +G +C L  +Q  +  E  G    ++ SEF  +  ++D
Sbjct: 113 NF--YAFNTNGNRGVACGLGNIQKTRDGEPLGGHVSAE-SEFDTWDADED 159


>gi|28895333|ref|NP_801683.1| hypothetical protein SPs0421 [Streptococcus pyogenes SSI-1]
 gi|50913379|ref|YP_059351.1| unknown phage protein [Streptococcus pyogenes MGAS10394]
 gi|28810579|dbj|BAC63516.1| hypothetical protein (phage associated) [Streptococcus pyogenes
           SSI-1]
 gi|50902453|gb|AAT86168.1| unknown phage protein [Streptococcus pyogenes MGAS10394]
          Length = 194

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/181 (26%), Positives = 68/181 (37%), Gaps = 19/181 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K RLSY AL      +         Y   I+ PK D   I  ++   K A      N
Sbjct: 18  VTGKVRLSYVALLEPKAFE----GQEAKYSTVILIPKTDKVTIKKIKDAQKAAYEAAKDN 73

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                    V      +  LRDGD ++ +   PE     YT  +++S  +K  +P ++D+
Sbjct: 74  KLKGVKWERV------KTTLRDGDEEMDTEEHPE-----YTGHMFMSVSSK-TKPQIIDK 121

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
                 D  E  Y G +    LN  AY       KG SC L  VQ     +  G    +D
Sbjct: 122 YKN-FVDSAEEVYSGVYARVSLNAYAYNTAGN--KGISCGLNNVQIVAKGDYLGGRSSAD 178

Query: 184 T 184
            
Sbjct: 179 A 179


>gi|66395467|ref|YP_239830.1| ORF018 [Staphylococcus phage 2638A]
 gi|62635894|gb|AAX91005.1| ORF018 [Staphylococcus phage 2638A]
          Length = 184

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/180 (20%), Positives = 67/180 (37%), Gaps = 20/180 (11%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K R SY  +                Y   ++ PK+DT  I A+E  ++ A       
Sbjct: 11  ITGKVRASYAHIFEP---HSMQEGQDAKYSVSLIIPKSDTNTIEAIEKAIEEAKEAGKAT 67

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +  +  +  LRDGD               Y D+ +++  +K   P +VD+
Sbjct: 68  KFGG------KIPANLKTPLRDGDIDREDD-------PNYKDAYFMNVSSK-QAPGIVDQ 113

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
               ++DP  V   G ++ A +N+  Y       KG +  L  +Q  +  E    +  ++
Sbjct: 114 NKIRLTDPGTVV-SGDYIRASVNM--YAFSASGNKGIAAGLNNIQLVEKGEPLSGASSAE 170


>gi|205375253|ref|ZP_03228043.1| hypothetical protein Bcoam_19814 [Bacillus coahuilensis m4-4]
          Length = 179

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/198 (21%), Positives = 72/198 (36%), Gaps = 27/198 (13%)

Query: 1   MQKLTV-----KGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKT 55
           M K+T+       R SY  +   V +      S   Y   I+  K+D K I  +   ++ 
Sbjct: 1   MVKITIGTKENPVRFSYANVHQPVSV----NGSDLKYSLSIIISKSDKKTIKKINDAIQK 56

Query: 56  AVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKY 115
           A  E       +      +  S  +  LR                  YTD+ +I+A N  
Sbjct: 57  ATQE-------NKDKFGGKVPSNLKTPLR-------DGDVDREDDDAYTDAYFINA-NSK 101

Query: 116 VQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDER 175
           ++P +VD    P+ D  E FY GC+    L    Y  +    +G +  L  V   +  E 
Sbjct: 102 IKPGIVDADLNPMIDQSE-FYSGCYGRVSLTF--YGFNVNGNRGIAAGLQNVMKTEDGEP 158

Query: 176 WGASPKSDTSEFKDYGEE 193
            G    ++     + G++
Sbjct: 159 LGGRSSAENDFSDEEGDD 176


>gi|170730326|ref|YP_001775759.1| hypothetical protein Xfasm12_1178 [Xylella fastidiosa M12]
 gi|167965119|gb|ACA12129.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 188

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/191 (21%), Positives = 75/191 (39%), Gaps = 19/191 (9%)

Query: 3   KLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIF 61
           KLT+K  RL++P L      K  +G     +    +   AD  Q+ A+   +     + +
Sbjct: 2   KLTLKNVRLAFPVLFEP---KKVNGEGEAAFSACFLIDPADP-QVKALNQAIDKMANDKW 57

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLV 121
              +                 +R GD         +     +   +Y+SA+NK  + L++
Sbjct: 58  GVKAAGQLKQ-----------MRMGDRVALHDGDLKASYDGFAGHLYVSARNK-SRVLVI 105

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           DR   P++      Y GC+V A + +  +  D    K  + +L GVQF +  E +     
Sbjct: 106 DRDRTPLTAQDGRPYAGCYVNANIEL--WAQDNNYGKRINASLGGVQFLRDGEAFAGGGV 163

Query: 182 SDTSEFKDYGE 192
           +   +F+D   
Sbjct: 164 ASVEDFEDLSA 174


>gi|238917461|ref|YP_002930978.1| hypothetical protein EUBELI_01539 [Eubacterium eligens ATCC 27750]
 gi|238872821|gb|ACR72531.1| Hypothetical protein EUBELI_01539 [Eubacterium eligens ATCC 27750]
          Length = 190

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 44/194 (22%), Positives = 77/194 (39%), Gaps = 18/194 (9%)

Query: 1   MQKLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M+ +T    R SY  +     +          Y   ++ PK+DTK I  +EA ++ A  E
Sbjct: 11  MKVITGPDTRWSYANVWELKSI----NGGTPKYSVSLIIPKSDTKTIAKIEAAIEAAYKE 66

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                       +V + S  +  LRDGD +             Y ++ +++A N    P 
Sbjct: 67  --GEAKLKGNGKSVPALSVIKTPLRDGDMERPDD-------PAYANAYFVNA-NATSAPG 116

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +VD    P+    EV Y G +  A ++   Y  +    KG +C L  +Q  +  E  G  
Sbjct: 117 IVDADRNPILTRSEV-YSGVYGRASISF--YAFNSSGNKGIACGLNNLQKIRDGEPLGGK 173

Query: 180 PKSDTSEFKDYGEE 193
             +++    D  ++
Sbjct: 174 ASAESDFASDEDDD 187


>gi|262043419|ref|ZP_06016544.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039245|gb|EEW40391.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 182

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/190 (20%), Positives = 74/190 (38%), Gaps = 18/190 (9%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++P L      K  +G     +    +       Q++ V   LK    E +      
Sbjct: 8   VRLAFPTL---FEAKTVNGEGDPRFSAVFLMDPKHP-QLDEVRKALKQVAKEKWGEKWET 63

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
            +    +   +    L DGD K           + +  + +++A NK  +P ++DR    
Sbjct: 64  IYGQLEK---KLNLCLHDGDEKAE--------YEGFPGNFFLNAANK-ARPTVIDRDRTA 111

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           +       Y GC+V A ++I  +  D    K  + +L+GVQF +  + +     +   +F
Sbjct: 112 LIQADGRPYAGCFVNAVVDI--WAQDNNFGKRINASLSGVQFLRDGDAFAGGGVAAPDDF 169

Query: 188 KDYGEEQDSD 197
            D  E  D++
Sbjct: 170 DDISEGADAE 179


>gi|227889484|ref|ZP_04007289.1| site-specific recombinase [Lactobacillus johnsonii ATCC 33200]
 gi|227849962|gb|EEJ60048.1| site-specific recombinase [Lactobacillus johnsonii ATCC 33200]
          Length = 477

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/153 (26%), Positives = 63/153 (41%), Gaps = 25/153 (16%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE---IFP 62
           V  RLSY  +     +        E Y   ++ PK+D   I A+E  +   + E    F 
Sbjct: 19  VNTRLSYANVWKPKFI----NGGKEKYSVSLIIPKSDKLTITAIEKAIDATIQEGIGKFG 74

Query: 63  NVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVD 122
              P+        K+  +  LRDGD +   +         Y DS +I+A N    P +VD
Sbjct: 75  GKKPN--------KATLKLPLRDGDVERDDA--------AYQDSYFINA-NSITAPQIVD 117

Query: 123 RQAQPVSDPREVFYPGCWVIAKLNIGAYELDPY 155
           +  QP+ D  EV Y GC+    +N  A+  +  
Sbjct: 118 KHVQPILDRNEV-YSGCYARVSINFYAFNTNGN 149


>gi|139473889|ref|YP_001128605.1| hypothetical protein SpyM51056 [Streptococcus pyogenes str.
           Manfredo]
 gi|209559297|ref|YP_002285769.1| hypothetical protein Spy49_0761 [Streptococcus phage NZ131.2]
 gi|225871342|ref|YP_002747289.1| phage protein [Streptococcus equi subsp. equi 4047]
 gi|134272136|emb|CAM30381.1| hypothetical phage protein [Streptococcus pyogenes str. Manfredo]
 gi|209540498|gb|ACI61074.1| hypothetical protein Spy49_0761 [Streptococcus phage NZ131.2]
 gi|225700746|emb|CAW95389.1| hypothetical phage protein [Streptococcus equi subsp. equi 4047]
          Length = 185

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/181 (27%), Positives = 69/181 (38%), Gaps = 19/181 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K RLSY AL      +         Y   I+ PK D   I  ++   K A      N
Sbjct: 9   VTGKVRLSYVALLEPKAFE----GQEAKYSTVILIPKTDKVTIKKIKDAQKAAYEAAKDN 64

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                    V      +  LRDGD ++ +   PE     Y   V++S  +K  +P ++D+
Sbjct: 65  KLKGVKWERV------KTTLRDGDEEMDTEEHPE-----YAGHVFMSVSSK-TKPQIIDK 112

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
              PV    EV Y G +    LN  AY       KG SC L  VQ     +  G    +D
Sbjct: 113 YKNPVDSADEV-YSGVYARVSLNAYAYNTAGN--KGISCGLNNVQIVAKGDYLGGRSSAD 169

Query: 184 T 184
            
Sbjct: 170 A 170


>gi|21910980|ref|NP_665248.1| hypothetical protein SpyM3_1444 [Streptococcus pyogenes MGAS315]
 gi|28876474|ref|NP_795674.1| hypothetical protein SpyM3_1444 [Streptococcus pyogenes phage
           315.6]
 gi|21905188|gb|AAM80051.1| conserved hypothetical protein - phage-associated [Streptococcus
           pyogenes MGAS315]
          Length = 187

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/181 (26%), Positives = 68/181 (37%), Gaps = 19/181 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K RLSY AL      +         Y   I+ PK D   I  ++   K A      N
Sbjct: 11  VTGKVRLSYVALLEPKAFE----GQEAKYSTVILIPKTDKVTIKKIKDAQKAAYEAAKDN 66

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                    V      +  LRDGD ++ +   PE     YT  +++S  +K  +P ++D+
Sbjct: 67  KLKGVKWERV------KTTLRDGDEEMDTEEHPE-----YTGHMFMSVSSK-TKPQIIDK 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
                 D  E  Y G +    LN  AY       KG SC L  VQ     +  G    +D
Sbjct: 115 YKN-FVDSAEEVYSGVYARVSLNAYAYNTAGN--KGISCGLNNVQIVAKGDYLGGRSSAD 171

Query: 184 T 184
            
Sbjct: 172 A 172


>gi|41179400|ref|NP_958709.1| Bbp40 [Bordetella phage BPP-1]
 gi|45569533|ref|NP_996602.1| hypothetical protein BMP-1p39 [Bordetella phage BMP-1]
 gi|45580784|ref|NP_996650.1| hypothetical protein BIP-1p39 [Bordetella phage BIP-1]
 gi|40950139|gb|AAR97705.1| Bbp40 [Bordetella phage BPP-1]
          Length = 182

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/189 (20%), Positives = 77/189 (40%), Gaps = 18/189 (9%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++P L      K  +G     +    +   +D  Q+ A+   ++    E +   +  
Sbjct: 8   VRLAFPVL---FEAKTVNGEGKPAFSASFLIDPSDA-QVKALNQAIEQVAKEKWGAKADA 63

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
                   +++ +  L DGD K             +  ++Y+SA++   +PL++D+   P
Sbjct: 64  VLKQ---MRAQDKVCLHDGDLKAN--------YDGFPGNLYVSARS-ATRPLVIDKDRSP 111

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           +++     Y GC+V A + +  +  D    K  +  L GVQF +  + +     +   EF
Sbjct: 112 LAEADGKPYAGCYVNASIEL--WAQDNNYGKRVNAGLRGVQFLRDGDAFAGGGVASEDEF 169

Query: 188 KDYGEEQDS 196
            D  E   +
Sbjct: 170 DDITEGAAA 178


>gi|306826827|ref|ZP_07460128.1| phage protein [Streptococcus pyogenes ATCC 10782]
 gi|304430990|gb|EFM33998.1| phage protein [Streptococcus pyogenes ATCC 10782]
          Length = 187

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 48/181 (26%), Positives = 68/181 (37%), Gaps = 19/181 (10%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K RLSY AL      +         Y   I+ PK D   I  ++   K A      N
Sbjct: 11  VTGKVRLSYVALLEPKAFE----GQEAKYSTVILIPKTDKVTIKKIKDAQKAAYEAAKDN 66

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                    V      +  LRDGD ++ +   PE     Y   +++S  +K  +P ++D+
Sbjct: 67  KLKGVKWERV------KTTLRDGDEEMDTEEHPE-----YAGHMFMSISSK-TKPQIIDK 114

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
               V D  E  Y G +    LN  AY       KG SC L  VQ     +  G    +D
Sbjct: 115 YKNSV-DSAEEVYSGVYARVSLNAYAYNTAGN--KGISCGLNNVQIVAKGDYLGGRSSAD 171

Query: 184 T 184
            
Sbjct: 172 A 172


>gi|281416452|ref|YP_003347372.1| hypothetical protein [Enterococcus phage phiFL4A]
 gi|270209628|gb|ACZ64167.1| conserved hypothetical protein [Enterococcus phage phiFL4A]
          Length = 191

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 83/205 (40%), Gaps = 28/205 (13%)

Query: 1   MQKLTV------KGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLK 54
           M K+T       + RLS+  +         +    + Y C ++ PK D + + A++  +K
Sbjct: 1   MAKVTGTKVITNQVRLSFVHVLEP---HAMEEGQEKKYSCMLIIPKDDKETLKAMKEAIK 57

Query: 55  TAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNK 114
           TA      +                +  LRDGD ++ +  +PE     + ++++I+  +K
Sbjct: 58  TAYEGAKGDKLKGVKF------DRLKTTLRDGDEEMDTEERPE-----FENAMFINVSSK 106

Query: 115 YVQPLLV---DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFK 171
             +P +V   D       DP EV Y G + IA +N  AY       KG +  L  +    
Sbjct: 107 -TKPQVVKREDGVLVKTDDPDEV-YSGVYAIASINFYAYSTAGN--KGVTAGLNNILTLC 162

Query: 172 HDERWGASPKSDTSEFKDYGEEQDS 196
             +  G    ++ S+F D   E + 
Sbjct: 163 KGDFLGGRANAE-SDFGDLEWEDEE 186


>gi|307569598|emb|CAR82777.1| phage protein, putative [Listeria monocytogenes L99]
          Length = 220

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 31/185 (16%), Positives = 70/185 (37%), Gaps = 18/185 (9%)

Query: 1   MQKL-TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M K+ T K R SY  +         +    + +   ++  K D K + A++  +      
Sbjct: 28  MVKVKTGKVRFSYVHVFEPW---AGEEGQEKRFSVCLIIDKTDKKTLKAIKNAIAEIKES 84

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                         ++    +  LR          +     + +  + +++A N   QP 
Sbjct: 85  KEAINIWG--GKNGKAPKSLKTPLR-------DGDEEREDMEEFEGTYFVNA-NSKRQPG 134

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +++++ + ++   E FY GC+  A +++  Y  +   +KG +  L  + F +  E  G +
Sbjct: 135 VINKKRKELT--SEEFYSGCYGRASIDLFPY--NSNGSKGIAVGLNNLLFLEDGEPLGFA 190

Query: 180 PKSDT 184
             S  
Sbjct: 191 VVSAE 195


>gi|332160960|ref|YP_004297537.1| hypothetical protein YE105_C1338 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325665190|gb|ADZ41834.1| hypothetical protein YE105_C1338 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862116|emb|CBX72280.1| putative protein p50 [Yersinia enterocolitica W22703]
          Length = 182

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/193 (23%), Positives = 79/193 (40%), Gaps = 18/193 (9%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++P L         +G     +    +           +EA +K    + +   +  
Sbjct: 8   VRLAFPDL---FEATQVNGQGDHKFRATFLLTPDHPAN-KDIEAAIKKVAADKWGTKAEA 63

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
              + V   +  R   R GD K             Y  ++YI+A NK  +PL++DR   P
Sbjct: 64  VLKTIV--GNPMRYNYRSGDEKAE--------YDGYPGNMYIAASNK-ARPLVLDRDKSP 112

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           ++      Y GC+V A + I AY     + KG S +L GVQFFK  + +     +   +F
Sbjct: 113 LTAADGRPYSGCFVNATITIFAY---DNQGKGISASLGGVQFFKDGDAFAGGGIASEDDF 169

Query: 188 KDYGEEQDSDTSV 200
            +  E  D+++ +
Sbjct: 170 DEITEGADAESLI 182


>gi|217965858|ref|YP_002351536.1| conserved phage-associated protein [Listeria monocytogenes HCC23]
 gi|217335128|gb|ACK40922.1| conserved phage-associated protein [Listeria monocytogenes HCC23]
          Length = 193

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 31/185 (16%), Positives = 70/185 (37%), Gaps = 18/185 (9%)

Query: 1   MQKL-TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M K+ T K R SY  +         +    + +   ++  K D K + A++  +      
Sbjct: 1   MVKVKTGKVRFSYVHVFEPW---AGEEGQEKRFSVCLIIDKTDKKTLKAIKNAIAEIKES 57

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                         ++    +  LR          +     + +  + +++A N   QP 
Sbjct: 58  KEAINIWG--GKNGKAPKSLKTPLR-------DGDEEREDMEEFEGTYFVNA-NSKRQPG 107

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           +++++ + ++   E FY GC+  A +++  Y  +   +KG +  L  + F +  E  G +
Sbjct: 108 VINKKRKELT--SEEFYSGCYGRASIDLFPY--NSNGSKGIAVGLNNLLFLEDGEPLGFA 163

Query: 180 PKSDT 184
             S  
Sbjct: 164 VVSAE 168


>gi|313621749|gb|EFR92489.1| phage-associated protein [Listeria innocua FSL J1-023]
          Length = 220

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 68/178 (38%), Gaps = 18/178 (10%)

Query: 1   MQKL-TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M K+ T K R SY  +         +    + +   ++  K D K + A++  +      
Sbjct: 28  MVKVKTGKVRFSYVHVFEPW---AGEEGQEKRFSVCLIIDKTDKKTLKAIKNAIAEIKES 84

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                         ++    +  LR          +     + +  + +++A N   QP 
Sbjct: 85  KEAISLWG--GKNGKAPKNLKTPLR-------DGDEEREDMEEFEGTYFVNA-NSKRQPG 134

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWG 177
           +++++ + ++   E FY GC+  A +++  Y  +   +KG +  L  + F +  E  G
Sbjct: 135 VINKKRKELT--AEEFYSGCYGRASIDLFPY--NSNGSKGIAVGLNNLLFLEDGEPLG 188


>gi|29374961|ref|NP_814114.1| hypothetical protein EF0322 [Enterococcus faecalis V583]
 gi|227520152|ref|ZP_03950201.1| conserved hypothetical protein [Enterococcus faecalis TX0104]
 gi|29342419|gb|AAO80185.1| conserved hypothetical protein [Enterococcus faecalis V583]
 gi|227072397|gb|EEI10360.1| conserved hypothetical protein [Enterococcus faecalis TX0104]
 gi|315574070|gb|EFU86261.1| conserved hypothetical protein [Enterococcus faecalis TX0309B]
 gi|315582015|gb|EFU94206.1| conserved hypothetical protein [Enterococcus faecalis TX0309A]
          Length = 191

 Score =  128 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 42/194 (21%), Positives = 78/194 (40%), Gaps = 27/194 (13%)

Query: 1   MQKLTV------KGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLK 54
           M K+T       + RLS+  +         +    + Y C ++ PK D + + A++  +K
Sbjct: 1   MAKVTGTKVITNQVRLSFVHVLEP---HAMEEGQEKKYSCMLIIPKDDKETLKAMKEAIK 57

Query: 55  TAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNK 114
           TA      +                +  LRDGD ++ +  +PE     + ++++I+  +K
Sbjct: 58  TAYEGAKGDKLKGVKFE------RLKTTLRDGDEEMDTEERPE-----FENAMFINVSSK 106

Query: 115 YVQPLLV---DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFK 171
             +P +V   D       DP EV Y G + IA +N  AY       KG +  L  +    
Sbjct: 107 -TKPQVVKREDGVLVKTDDPDEV-YSGVYAIASINFYAYSTAGN--KGVTAGLNNILTLC 162

Query: 172 HDERWGASPKSDTS 185
             +  G    +++ 
Sbjct: 163 KGDFLGGRANAESD 176


>gi|257088830|ref|ZP_05583191.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|256997642|gb|EEU84162.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|315160600|gb|EFU04617.1| conserved hypothetical protein [Enterococcus faecalis TX0645]
 gi|315579446|gb|EFU91637.1| conserved hypothetical protein [Enterococcus faecalis TX0630]
          Length = 191

 Score =  128 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 42/194 (21%), Positives = 78/194 (40%), Gaps = 27/194 (13%)

Query: 1   MQKLTV------KGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLK 54
           M K+T       + RLS+  +         +    + Y C ++ PK D + + A++  +K
Sbjct: 1   MAKVTGTKVITNQVRLSFVHVLEP---HAMEEGQEKKYSCMLIIPKDDKETLKAMKEAIK 57

Query: 55  TAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNK 114
           TA      +                +  LRDGD ++ +  +PE     + ++++I+  +K
Sbjct: 58  TAYEGAKGDKLKGVKF------DRLKTTLRDGDEEMDTEERPE-----FENAMFINVSSK 106

Query: 115 YVQPLLV---DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFK 171
             +P +V   D       DP EV Y G + IA +N  AY       KG +  L  +    
Sbjct: 107 -TKPQVVKREDGVLVKTDDPDEV-YSGVYAIASINFYAYSTAGN--KGVTAGLNNILTLC 162

Query: 172 HDERWGASPKSDTS 185
             +  G    +++ 
Sbjct: 163 KGDFLGGRANAESD 176


>gi|304406770|ref|ZP_07388425.1| hypothetical protein PaecuDRAFT_3101 [Paenibacillus curdlanolyticus
           YK9]
 gi|304344303|gb|EFM10142.1| hypothetical protein PaecuDRAFT_3101 [Paenibacillus curdlanolyticus
           YK9]
          Length = 286

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/185 (18%), Positives = 60/185 (32%), Gaps = 16/185 (8%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T + RLS+  L                Y   I+ PK+DT  +  + A +  A+ +     
Sbjct: 40  TGEVRLSFVHLFQP---HANQPGQEPKYSTTILIPKSDTATMARIHAAIAAAIEKGVAGT 96

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ 124
              A         + +  + DGD         E +         ++A +K  Q  +V   
Sbjct: 97  WSGA------RPPQPKTPIWDGDGVRQ---NGEPFGPECKGHWVLTASSKQQQ-AIVAPD 146

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
             P+ D     Y G +  A +N   +       +G    L  VQ  +  E  G    ++ 
Sbjct: 147 MSPIIDQ-TRVYSGVYARANINFFPFSNSGN--RGIGAGLGPVQILRDGEPLGGRISAEQ 203

Query: 185 SEFKD 189
           +    
Sbjct: 204 AFGGA 208


>gi|288799804|ref|ZP_06405263.1| conserved hypothetical protein [Prevotella sp. oral taxon 299 str.
           F0039]
 gi|288333052|gb|EFC71531.1| conserved hypothetical protein [Prevotella sp. oral taxon 299 str.
           F0039]
          Length = 194

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/210 (23%), Positives = 80/210 (38%), Gaps = 33/210 (15%)

Query: 1   MQKLT-VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M K+   K R SY  +      K  +G +   Y   ++ PK +   +  +E  +K A   
Sbjct: 1   MTKVKIGKARASYVNV---FHAKGVEG-AEPKYSISLIIPKENKALVAQIEQAIKNAFDY 56

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
               +  +A L       + +  LRDGD +           + Y ++ +I+A  K  +P 
Sbjct: 57  GKTTLGANAKLE------KIKTPLRDGDEERPED-------EAYKNAYFINASCK-TKPG 102

Query: 120 --------LVDRQAQPV---SDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQ 168
                   +VD + Q +    D  E  Y GC+V A +N  AY       KG +  L  V 
Sbjct: 103 VSVFKGTKIVDGKKQNIIEALDDEEEMYSGCFVYASVNFYAYNTSGN--KGIAAGLNNVL 160

Query: 169 FFKHDERWGASPKSDTSEFK-DYGEEQDSD 197
                E  G    ++   +  D  EE  +D
Sbjct: 161 KVADGEPLGGRISAEADFYDMDIPEEAPAD 190


>gi|170023453|ref|YP_001719958.1| hypothetical protein YPK_1207 [Yersinia pseudotuberculosis YPIII]
 gi|169749987|gb|ACA67505.1| conserved hypothetical protein [Yersinia pseudotuberculosis YPIII]
          Length = 182

 Score =  125 bits (313), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 48/193 (24%), Positives = 80/193 (41%), Gaps = 18/193 (9%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++P L         +G     +    +           +EA +K   T+ +   +  
Sbjct: 8   VRLAFPDL---FEATQVNGQGDHKFRATFLLTPDHPAN-KDIEAAIKKVATDKWGARAEA 63

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
              + V   +  R   R GD K             Y  ++YI+A NK  +PL++DR   P
Sbjct: 64  VLKTIV--GNPMRYNYRSGDEKAD--------YDGYPGNMYIAAGNK-ARPLVLDRDKSP 112

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           ++      Y GC+V A + I AY     + KG S +L GVQFFK  + + A       +F
Sbjct: 113 LTAADGRPYSGCFVNATITIFAY---DNQGKGISASLGGVQFFKDGDAFAAGGIDSEDDF 169

Query: 188 KDYGEEQDSDTSV 200
            +  E  D+++ +
Sbjct: 170 DEITEGADAESLI 182


>gi|144452|gb|AAA23102.1| unknown [Citrus greening disease-associated bacterium]
          Length = 121

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 108/120 (90%), Positives = 115/120 (95%)

Query: 96  PENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPY 155
           PENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVS+PREVFY GCWVIAKLNIGAYELD Y
Sbjct: 1   PENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSNPREVFYAGCWVIAKLNIGAYELDLY 60

Query: 156 KTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPW 215
           KTKGF+CTLTGVQFFKHDERWGASPKSDTSEFK+YGEE+DSD SVSNFASA+++ D LPW
Sbjct: 61  KTKGFNCTLTGVQFFKHDERWGASPKSDTSEFKNYGEEEDSDISVSNFASADMEPDVLPW 120


>gi|238018840|ref|ZP_04599266.1| hypothetical protein VEIDISOL_00700 [Veillonella dispar ATCC 17748]
 gi|237864606|gb|EEP65896.1| hypothetical protein VEIDISOL_00700 [Veillonella dispar ATCC 17748]
          Length = 186

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 73/187 (39%), Gaps = 20/187 (10%)

Query: 1   MQKLT-VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M KLT    RLSY  +    +    +      Y   I+  K D K I A E  ++    +
Sbjct: 1   MAKLTTGIVRLSYANIAQPRK----NDDGKAKYSSQIIIDKTDKKTIKAFERAIEELKAD 56

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                 P A        +  +  LRDGD   A + +P    +TY    +I+A N   QP+
Sbjct: 57  ------PKAVAKVEGKAAYLKLNLRDGDTAEAVADQP----ETYAGKFFINA-NSDKQPI 105

Query: 120 LVDRQAQPV--SDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWG 177
           +  R    +   D  E  Y G +    L++ AY  +    KG    L GV+  K  +R G
Sbjct: 106 VFTRDKIKMDQFDIEEEIYSGVYAQVALSVFAYNFNGK--KGVGFGLNGVRKVKDGDRLG 163

Query: 178 ASPKSDT 184
               S +
Sbjct: 164 GVHVSAS 170


>gi|284048476|ref|YP_003398815.1| hypothetical protein Acfer_1133 [Acidaminococcus fermentans DSM
           20731]
 gi|283952697|gb|ADB47500.1| conserved hypothetical protein [Acidaminococcus fermentans DSM
           20731]
          Length = 151

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 35/137 (25%), Positives = 54/137 (39%), Gaps = 13/137 (9%)

Query: 47  NAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDS 106
             V A +K A  E             V +    +  LRDGD +             Y  S
Sbjct: 15  QKVRAAIKAAYQE--GEEKLKGNGRVVPALEAIKTPLRDGDLER-------PGDDAYKGS 65

Query: 107 VYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTG 166
            +I+A N   +P +VD   Q + +  EV Y G +  A +N   Y  +    KG +C L  
Sbjct: 66  FFINA-NSATKPGIVDADCQQILERPEV-YSGVYGRASINF--YAFNSNGNKGIACGLNN 121

Query: 167 VQFFKHDERWGASPKSD 183
           +Q  +  E  G  P+++
Sbjct: 122 LQKIRDGEPLGGKPRAE 138


>gi|312897721|ref|ZP_07757137.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
 gi|310621105|gb|EFQ04649.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
          Length = 211

 Score =  118 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 40/182 (21%), Positives = 72/182 (39%), Gaps = 15/182 (8%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RLSY  +            +   Y   I+ PK+D  Q  A++A +  AV E        
Sbjct: 19  VRLSYVHIMEPHTAPN---QTKPKYSTTILLPKSDVAQKQAIDAAIAAAVEEGRQ----- 70

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
               A    ++ +  + DGD    + +  E   +     V+ + ++   +  +VD    P
Sbjct: 71  -KYGAKSVPAKPKTPVWDGD--GYTQNGKEFGPEAKGHWVFTAWQDPKYKVEVVDMTGAP 127

Query: 128 VSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEF 187
           ++D  +V Y G +    +    Y     +++G +C+L  VQ  +  E  G +P S  S F
Sbjct: 128 ITDHAQV-YSGMYANVLVTFYYY---DNQSQGIACSLGPVQKVRDGEALGGAPASAASVF 183

Query: 188 KD 189
             
Sbjct: 184 GA 185


>gi|322382462|ref|ZP_08056357.1| hypothetical protein PL1_2401 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153575|gb|EFX45964.1| hypothetical protein PL1_2401 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 199

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/197 (17%), Positives = 71/197 (36%), Gaps = 35/197 (17%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVT---EI 60
           +T K RL+Y  +                Y   I+ PK D + +  ++A  + A       
Sbjct: 11  VTGKVRLNYANIWEPKEGDS----GEMKYSACILIPKEDKETLRKIKAATEAAKELGKSK 66

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKN----KYV 116
           +    P          ++ +  LRDGD +           + Y +  +++A +    +  
Sbjct: 67  WGGKIP----------AKCKTPLRDGDEERPDD-------EAYAEHYFLNASSYYKPRIA 109

Query: 117 QPLLVDRQAQ----PVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKH 172
           +P+      +     ++D  E  + GC+V   L   A+++     +G +  L  +   + 
Sbjct: 110 KPIGKGSDGKMKFEEITDSSE-LWSGCYVRVALTFNAFDVSGS--RGVNVYLNDIVKIQD 166

Query: 173 DERWGASPKSDTSEFKD 189
            ER G  P  +     +
Sbjct: 167 GERLGGRPSLEDEFADE 183


>gi|317500273|ref|ZP_07958500.1| hypothetical protein HMPREF1026_00443 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|316898316|gb|EFV20360.1| hypothetical protein HMPREF1026_00443 [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 133

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 52/131 (39%), Gaps = 13/131 (9%)

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                F     +K+  +  LRDGD +           + Y    +I+A N    P +VDR
Sbjct: 13  KGVAKFGGKKPNKAAIKLPLRDGDIERDD--------EAYKGHYFINA-NSTTAPQIVDR 63

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
             +P+ D  EV Y GC+    LN   Y  +    KG +C L  +Q  +  E  G    + 
Sbjct: 64  AVKPILDRSEV-YSGCYARVSLNF--YAFNSNGNKGIACGLGNIQKIRDGESLGGKTTAA 120

Query: 184 TSEFKDYGEEQ 194
             +F    ++ 
Sbjct: 121 -DDFGAVVDDD 130


>gi|331087494|ref|ZP_08336430.1| hypothetical protein HMPREF1025_00013 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330410474|gb|EGG89905.1| hypothetical protein HMPREF1025_00013 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 126

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 52/131 (39%), Gaps = 13/131 (9%)

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                F     +K+  +  LRDGD +           + Y    +I+A N    P +VDR
Sbjct: 6   KGVAKFGGKKPNKAAIKLPLRDGDIERDD--------EAYKGHYFINA-NSTTAPQIVDR 56

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
             +P+ D  EV Y GC+    LN   Y  +    KG +C L  +Q  +  E  G    + 
Sbjct: 57  AVKPILDRSEV-YSGCYARVSLNF--YAFNSNGNKGIACGLGNIQKIRDGESLGGKTTAA 113

Query: 184 TSEFKDYGEEQ 194
             +F    ++ 
Sbjct: 114 -DDFGAVVDDD 123


>gi|194473816|ref|YP_002048640.1| single-stranded DNA-binding protein [Morganella phage MmP1]
 gi|194307037|gb|ACF42019.1| single-stranded DNA-binding protein [Morganella phage MmP1]
          Length = 239

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 31/210 (14%), Positives = 66/210 (31%), Gaps = 8/210 (3%)

Query: 12  YPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLS 71
           Y  +           +    Y  D+   K +   +  ++A +  A  E         F  
Sbjct: 21  YAYIRQPDFGSENFKNPRGVYKVDLTLDKDNPSCVKMMDAII--ACHEENYAAKVAEFEE 78

Query: 72  AVRSKSESRGVL--RDGDAKIASSHKPENYTQTYT-DSVY--ISAKNKYVQPLLVDRQAQ 126
                +  +  L   +GD     +       +     S     + +N+ ++ L+VD + +
Sbjct: 79  NPPKVARGKKPLQPYEGDMPFIDNEDGTVTFKFKAYGSYTDKKTGENREIKLLVVDSKGK 138

Query: 127 PVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSE 186
            + +P  +   G  +  K  +  Y  +P         L  V   +  E  G S      +
Sbjct: 139 KL-EPVPIIAQGSKLKVKFKMIPYSWNPTVGASVKLQLESVMVVELAEFGGGSDLWGDDD 197

Query: 187 FKDYGEEQDSDTSVSNFASAEVDSDALPWN 216
           ++D     ++  +     S E   D   W+
Sbjct: 198 YEDGFSADENPAAKRGGGSTEDSQDEATWD 227


>gi|34610179|ref|NP_919004.1| conserved phage protein [Burkholderia phage BcepNazgul]
 gi|34304554|gb|AAQ63371.1| conserved phage protein [Burkholderia phage BcepNazgul]
          Length = 206

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/202 (17%), Positives = 61/202 (30%), Gaps = 27/202 (13%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQ-INAVEACLKTAVTEIFPNVSP 66
            R SYP L    +    D    E Y       K   K  +  ++      + E       
Sbjct: 25  VRASYPHLAKPYK--GDDQEGQEKYSLVGFIEKDLAKSVLEVMKKMRDEMLREKNDGKK- 81

Query: 67  DAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQ 126
                        +   RDGDA         +    Y     I+A ++  +P +     +
Sbjct: 82  ---------IPTDKFFFRDGDA---------SGKDEYEGCYTINA-SETKRPSVRGADKR 122

Query: 127 PVSDPR--EVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            + +       Y GC     + I  +  D    K  +  L  VQF + DE  G    S+ 
Sbjct: 123 LLGEREIENTIYAGC--RVNILINPWWQDNKFGKRINANLLAVQFVRDDEPIGEGRISED 180

Query: 185 SEFKDYGEEQDSDTSVSNFASA 206
                + +  D + +++     
Sbjct: 181 EIDDSFDDVSDGEEALAEGYDD 202


>gi|269975324|gb|ACZ55548.1| conserved phage protein [Staphylococcus phage SA1]
          Length = 198

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 33/181 (18%), Positives = 58/181 (32%), Gaps = 24/181 (13%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            R SYP LD        +      Y   ++ PK    +I  +   ++  +     N    
Sbjct: 27  VRASYPHLDKP---YGGEDGGEPKYSLTLLMPKESHGEIEKI---IREQIEVTKKNHKTG 80

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
           A   A          ++DGD                     ISA+    +P + + + + 
Sbjct: 81  ALKVAPSM-----LFIKDGDTDFPD-------KPECEGMWVISARESK-RPDVYNIEREE 127

Query: 128 VSDPREV---FYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
           ++   E+    Y GCW    + I  +  +    K  +  L  V   K DE +G      +
Sbjct: 128 LTTSSEILEEIYGGCW--VSVVIRPWSQENKFGKRVNANLISVLKRKDDEPFGEGRVDTS 185

Query: 185 S 185
            
Sbjct: 186 D 186


>gi|158425226|ref|YP_001526518.1| putative phage single-stranded DNA-binding protein [Azorhizobium
           caulinodans ORS 571]
 gi|158332115|dbj|BAF89600.1| putative phage single-stranded DNA-binding protein [Azorhizobium
           caulinodans ORS 571]
          Length = 238

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 32/226 (14%), Positives = 73/226 (32%), Gaps = 27/226 (11%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTK-QINAVEACLKTAVTEIFPN 63
           + KG   +P L         +G     Y   ++ P+ + +  I+ ++     A+      
Sbjct: 19  SPKGTFKFPRLTEPDFKYKAEGE----YSLKLIVPRPEAQPLIDKLQPLWDEAIDAGKAA 74

Query: 64  VSPDAFLSAVRSKSESRGVLRD-------GDAKIASSHKPENYTQTYTDSVYI---SAKN 113
                  +  + +++ +G   +       GD +  +      ++ T++        + + 
Sbjct: 75  FKELPVATRKKMEAQGKGFTANPFFSPVYGDDEEETGEVEFKFSMTHSGEYKKGPKAGQK 134

Query: 114 KYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHD 173
               P L D + +P+       + G        +  Y +    + G S  L  VQ     
Sbjct: 135 WTRSPSLFDAKGKPL-PKSVQIWGGTLGRVSFEVAPYWVPGQASAGLSLRLKAVQVIDLV 193

Query: 174 ERWGASPKSDTSEF---------KDYGEEQDSDTSVSNFASAEVDS 210
              G    + +  F          D  E  ++D+  +  A+ E D 
Sbjct: 194 S--GGQRSASSYGFTEEDGYQAPDDEPEGTEADSPDAGEATDEDDD 237


>gi|213692093|ref|YP_002322679.1| hypothetical protein Blon_1212 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|213523554|gb|ACJ52301.1| hypothetical protein Blon_1212 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|320458207|dbj|BAJ68828.1| hypothetical protein BLIJ_1240 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 222

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 59/221 (26%), Gaps = 41/221 (18%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKAD-----------TKQINAVEAC 52
           +TV G  ++P L                Y   ++F K D            K   A+   
Sbjct: 14  VTVPGIANFPHLFEPDSKNG-------KYTLTVLFDKKDPAVSQMMRDLQAKCAEAIRRG 66

Query: 53  LKTAVTEIFPNVSPDAF----LSAVRSKSESRGVLRDGDAKIASSHK-----PENYTQTY 103
           +           S   F    +         R  + DGD              ++  + Y
Sbjct: 67  ID--GEPGRDGKSYAPFSGHSMDDKEWVGRLRLPVEDGDTAKFDRGDNVGKLKKDVYEEY 124

Query: 104 TDSVYISAKNKYVQPL---LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGF 160
                +    K        +VD   + ++      Y G  V   + + AY+ D     G 
Sbjct: 125 EGRWVLKTGTKTDLAAAGWVVDSNRRRLTAAD--LYSGAIVRVNVWLYAYKQDNS---GV 179

Query: 161 SCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVS 201
              L  V      ER G     +T     +G     D S  
Sbjct: 180 GAMLNAVVKTGDGERIGG----ETDPLAAFGLPDAQDASNP 216


>gi|48697228|ref|YP_024958.1| hypothetical protein BcepC6B_gp38 [Burkholderia phage BcepC6B]
 gi|47779034|gb|AAT38397.1| gp38 [Burkholderia phage BcepC6B]
          Length = 201

 Score =  101 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 45/216 (20%), Positives = 81/216 (37%), Gaps = 36/216 (16%)

Query: 1   MQKLTV-KGRLSYPA-LDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVT 58
           M K+ +   R+++   L T        G     Y    +  K       A+EA +K+   
Sbjct: 1   MAKIKLTNVRIAFINNLRTPAEF--EAGDGKFRYSATFLVEKGSAND-KAIEAAIKSVAV 57

Query: 59  EIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNK---- 114
           E +     DA L + RS S  +   ++GD K             +  ++YI+A  K    
Sbjct: 58  EGWA-KKADAMLESFRSNSN-KFCYQNGDLK---------DFDGFEGNMYIAAHRKRDDG 106

Query: 115 ------------YVQPL-LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFS 161
                         +P  LVD   + ++      Y GC+V A ++I A         G  
Sbjct: 107 RPLLLDNVADPETGKPARLVDANGEWLAGKEGRIYAGCYVNATIDIYAQTKTNP---GIR 163

Query: 162 CTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSD 197
           C L GVQ+    + +  + +++  +F+    E + +
Sbjct: 164 CGLMGVQYHGPGDSFSGASRANEDDFEATAPETEDE 199


>gi|83311036|ref|YP_421300.1| hypothetical protein amb1937 [Magnetospirillum magneticum AMB-1]
 gi|82945877|dbj|BAE50741.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 218

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/214 (18%), Positives = 72/214 (33%), Gaps = 29/214 (13%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T   R ++             G + + +G   + P      +  V+A +  A T+++ + 
Sbjct: 13  TPLVRAAFFRGVEPEVRTNDKGVTEKTWGLTAIAP--AGSDLTGVKAAIVEAATKMWGST 70

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ 124
           + D          + +  L+DG  ++    K     +            K  +P LVDR+
Sbjct: 71  AGDKLKH-----PKFKSPLKDGATQVDKEGKLYAGFE--AGQTTFKLSTKSRKPGLVDRK 123

Query: 125 AQPVSDP-----------------REVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGV 167
            + + D                      Y GCW +A  +  AY+ D     G S  L  +
Sbjct: 124 VRAIIDEQGTTLVDKANGLHEIVAENEVYSGCWFLATFSAMAYDRDD--GFGVSLKLENL 181

Query: 168 QFFKHDERWGASPK-SDTSEFKDYGEEQDSDTSV 200
           Q  K DER G     +   +F    +    D + 
Sbjct: 182 QLVKQDERLGGGGAPAAEDQFGALADAGGDDLAD 215


>gi|26988991|ref|NP_744416.1| phage single-stranded DNA-binding protein, putative [Pseudomonas
           putida KT2440]
 gi|24983811|gb|AAN67880.1|AE016420_2 phage single-stranded DNA-binding protein, putative [Pseudomonas
           putida KT2440]
          Length = 226

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/199 (13%), Positives = 54/199 (27%), Gaps = 8/199 (4%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAV-----EACLKTAVTE 59
           + +G   YPAL                Y   ++  + +   + A      EA ++    E
Sbjct: 3   SPRGIFRYPALTKPDFGTDEYPKPDGEYKVTLILTQEEAAPLLAKLEPLHEAAIENGREE 62

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                          +         D + +  +     N     +            +P 
Sbjct: 63  FKKLKIEARKKLKDVTVQPLFTEEYDKETEEPTGRLFFNIKMAASGKSKKDGSVWTRKPA 122

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           L D + +P+       + G        +  Y +      G    L  VQ  +   R G +
Sbjct: 123 LFDAKGKPLL-KVPDIWGGTEGKVSFEVAPYFIPGTALAGIKLRLNAVQVIEL--RSGGN 179

Query: 180 PKSDTSEFKDYGEEQDSDT 198
             +    F +     D+++
Sbjct: 180 KSAGEYGFGEEEGGFDAES 198


>gi|212671396|ref|YP_002308395.1| single-stranded DNA-binding protein [Kluyvera phage Kvp1]
 gi|211997240|gb|ACJ14557.1| single-stranded DNA-binding protein [Kluyvera phage Kvp1]
          Length = 232

 Score = 98.8 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/210 (12%), Positives = 55/210 (26%), Gaps = 15/210 (7%)

Query: 12  YPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLS 71
           Y  L           +    Y   +     D +    ++  ++    E       + + +
Sbjct: 19  YCYLAKPDFGSGDFKNERGVYKVSLTVSNDDPRCQKMIDEIVEA--HETDYAARLEEYEA 76

Query: 72  AVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP---LLVDRQAQ 126
                 + +  L+   GD     +              +   K    +P    +VD + +
Sbjct: 77  NPPKVVKGKKPLKPYVGDMPFMDNEDGTTTFNFKCYGSFTDKKTGENKPIDLAIVDSKGK 136

Query: 127 PVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSE 186
            +   R     G  +  K  +  Y             L  V   K  E  G         
Sbjct: 137 RIRGERPAISGGSELKIKYTLFPYGWSAVAGASVKLQLDSVMLIKLVEFGGG-------- 188

Query: 187 FKDYGEEQDSDTSVSNFASAEVDSDALPWN 216
             D+ +E + D   ++ A      +   WN
Sbjct: 189 DDDWSDETEEDGYEADEAQTRKPQNGSGWN 218


>gi|325272853|ref|ZP_08139188.1| phage single-stranded DNA-binding protein, putative [Pseudomonas
           sp. TJI-51]
 gi|324102002|gb|EGB99513.1| phage single-stranded DNA-binding protein, putative [Pseudomonas
           sp. TJI-51]
          Length = 237

 Score = 98.4 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/199 (13%), Positives = 53/199 (26%), Gaps = 8/199 (4%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAV-----EACLKTAVTE 59
           + +G   YPAL                Y   ++  + +     A      EA ++    E
Sbjct: 14  SPRGIFRYPALTKPDFGTDEYPKPDGEYKVTLILTQEEAAPFLAKLEPLHEAAIENGREE 73

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL 119
                          +         D + +  +     N     +            +P 
Sbjct: 74  FKKLKIEARKKLKDVTVQPLYTEEYDKETEEPTGRLFFNIKMAASGKSKKDGSVWTRKPA 133

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           L D + +P+       + G        +  Y +      G    L  VQ  +   R G +
Sbjct: 134 LFDAKGKPML-KVPDIWGGTEGKVSFEVAPYFIPGTALAGIKLRLNAVQVIEL--RSGGN 190

Query: 180 PKSDTSEFKDYGEEQDSDT 198
             +    F +     D+++
Sbjct: 191 KSAGEYGFGEEEGGFDAES 209


>gi|294083964|ref|YP_003550721.1| putative DNA-dependent RNA polymerase [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663536|gb|ADE38637.1| possible DNA-dependent RNA polymerase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 188

 Score = 95.3 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 40/211 (18%), Positives = 68/211 (32%), Gaps = 38/211 (18%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T KG   YP L+        DG     +   +  P    +  + +   +K   ++ F   
Sbjct: 11  TSKGVAMYPHLNKPDFAFNTDGI----FSVKLRMP---AEAASGLVETVKKIASDEFG-- 61

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ 124
                    +S + +R                       T  + + AK+K+ +P L+D  
Sbjct: 62  ---------KSATSARMPY---------------TVDDETGDLLVLAKSKF-KPKLIDST 96

Query: 125 AQPVSDPR-EVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
              +++P     Y G  +     I  Y       KG S  L GVQ     +  G+S + +
Sbjct: 97  GAMIAEPSAPTIYAGSTLKLAGTIFPYTAGGN--KGVSLQLAGVQIVSLADPVGSSFEFE 154

Query: 184 TSEFKDYGEEQDS-DTSVSNFASAEVDSDAL 213
             +     E  D+   S  N  S E      
Sbjct: 155 AEDGGYVSEANDNMPASNDNDGSGEATEGEA 185


>gi|312436357|gb|ADQ83166.1| single stranded DNA binding protein [Yersinia phage Yep-phi]
          Length = 235

 Score = 94.9 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 54/209 (25%), Gaps = 14/209 (6%)

Query: 12  YPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLS 71
           Y  L           +    Y   +     D +    ++  ++    E       + + +
Sbjct: 19  YCYLAKPDFGSGDFKNERGVYKVSLTVSNDDPRCQKMIDEIVEA--HETDYAARMEEYEA 76

Query: 72  AVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP---LLVDRQAQ 126
                   +  L+   GD     +              Y   K    +P    +VD + +
Sbjct: 77  NPPKVVRGKKPLKPYVGDMPFMDNEDGTTTFTFKCYGSYTDRKTGENRPIDLAIVDSKGK 136

Query: 127 PVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSE 186
            +   R     G  +  K  +  Y             L  V   K  E  G       S 
Sbjct: 137 RIRGERPAISGGSELKIKYTLFPYGWSAVAGASVKLQLDSVMLIKLVEFGG-------SG 189

Query: 187 FKDYGEEQDSDTSVSNFASAEVDSDALPW 215
             D+ +E + D  V+  A      +   W
Sbjct: 190 EDDWADEIEEDGYVAVEAQTRKPQNDSGW 218


>gi|37956710|gb|AAP33979.1| gene 2.5 [Enterobacteria phage T7]
 gi|37956762|gb|AAP34030.1| gene 2.5 [Enterobacteria phage T7]
          Length = 232

 Score = 94.5 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 63/201 (31%), Gaps = 15/201 (7%)

Query: 12  YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
           Y  +          G       Y  D+  P  D +    V+  +K    E     + + +
Sbjct: 16  YAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVK--CHEEAYVAAVEEY 73

Query: 70  LSAVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLLVDRQ 124
            +   + +  +  L+  +GD     +       +    + +   K K  +    ++VD +
Sbjct: 74  EANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKRINLVVVDSK 133

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            + + D   +   G  +  K ++  Y+ +          L  V   +     G       
Sbjct: 134 GKKMED-VPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGG-----E 187

Query: 185 SEFKDYGEEQDSDTSVSNFAS 205
            ++ D  EE     S S  AS
Sbjct: 188 DDWADEVEENGYVASGSAKAS 208


>gi|119637757|ref|YP_918993.1| Single-stranded DNA-binding protein [Yersinia phage Berlin]
 gi|194100479|ref|YP_002003324.1| gp2.5 [Yersinia phage Yepe2]
 gi|119391788|emb|CAJ70661.1| hypothetical protein [Yersinia phage Berlin]
 gi|193201212|gb|ACF15693.1| gp2.5 [Yersinia phage Yepe2]
          Length = 235

 Score = 94.2 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/209 (13%), Positives = 54/209 (25%), Gaps = 14/209 (6%)

Query: 12  YPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLS 71
           Y  L           +    Y   +     D +    ++  ++    E       + + +
Sbjct: 19  YCYLAKPDFGSGDFKNERGVYKVSLTVSNDDPRCQKMIDEIVEA--HETDYAARMEEYAA 76

Query: 72  AVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP---LLVDRQAQ 126
                   +  L+   GD     +              Y   K    +P    +VD + +
Sbjct: 77  NPPKVVRGKKPLKPYVGDMPFMDNEDGTTTFTFKCYGSYTDRKTGENRPIDLAIVDSKGK 136

Query: 127 PVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSE 186
            +   R     G  +  K  +  Y             L  +   K  E  G       S 
Sbjct: 137 RIRGERPAISGGSELKIKYTLFPYGWSAVAGASVKLQLDSIMLIKLVEFGG-------SG 189

Query: 187 FKDYGEEQDSDTSVSNFASAEVDSDALPW 215
             D+ +E + D  V+  A      +   W
Sbjct: 190 EDDWADEIEEDGYVAVEAQTRKPQNDSGW 218


>gi|9627442|ref|NP_041970.1| single-stranded DNA-binding protein [Enterobacteria phage T7]
 gi|138392|sp|P03696|VHED_BPT7 RecName: Full=Helix-destabilizing protein; AltName:
           Full=Single-stranded DNA-binding protein; Short=SSB
           protein
 gi|15515|emb|CAA24343.1| unnamed protein product [Enterobacteria phage T7]
 gi|15579|emb|CAA24400.1| unnamed protein product [Enterobacteria phage T7]
 gi|37956654|gb|AAP33924.1| gene 2.5 [Enterobacteria phage T7]
 gi|265524981|gb|ACY75844.1| single-stranded DNA-binding protein [Enterobacteria phage T7]
          Length = 232

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 63/201 (31%), Gaps = 15/201 (7%)

Query: 12  YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
           Y  +          G       Y  D+  P  D +    V+  +K    E     + + +
Sbjct: 16  YAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVK--CHEEAYAAAVEEY 73

Query: 70  LSAVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLLVDRQ 124
            +   + +  +  L+  +GD     +       +    + +   K K  +    ++VD +
Sbjct: 74  EANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSK 133

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            + + D   +   G  +  K ++  Y+ +          L  V   +     G       
Sbjct: 134 GKKMED-VPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGG-----E 187

Query: 185 SEFKDYGEEQDSDTSVSNFAS 205
            ++ D  EE     S S  AS
Sbjct: 188 DDWADEVEENGYVASGSAKAS 208


>gi|331007090|ref|ZP_08330314.1| phage-like protein [gamma proteobacterium IMCC1989]
 gi|330419107|gb|EGG93549.1| phage-like protein [gamma proteobacterium IMCC1989]
          Length = 182

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/197 (20%), Positives = 70/197 (35%), Gaps = 29/197 (14%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVF-PKADTKQINAVEACLKTAVTEIFP 62
           +    R+S+P L  K  +   +G      G  ++  P+A +K I  +   ++    E F 
Sbjct: 6   MINNVRVSFPHLFKKPIINGEEG----KCGATLMLDPEAHSKSIAVINKQIEALFKEKFK 61

Query: 63  NVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVD 122
                A           +  LRDG+ K  +          Y     I + N   +PL++ 
Sbjct: 62  GRKLPA----------EKLCLRDGEDKGRT---------EYEG-FQILSANSKGKPLVIS 101

Query: 123 RQAQPVS--DPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
              +     +     Y GC+V AK+ +  +  D    K  +C L  +QF    E    + 
Sbjct: 102 TNGKDTVNDEDDCPIYAGCYVNAKVRL--WAQDNSYGKRVNCELVAIQFAADGETLDGTH 159

Query: 181 KSDTSEFKDYGEEQDSD 197
            S       +G   + D
Sbjct: 160 VSVDEAMDGFGGVTEDD 176


>gi|37956813|gb|AAP34080.1| gene 2.5 [Enterobacteria phage T7]
 gi|37956868|gb|AAP34134.1| gene 2.5 [Enterobacteria phage T7]
          Length = 232

 Score = 92.2 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 63/201 (31%), Gaps = 15/201 (7%)

Query: 12  YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
           Y  +          G       Y  D+  P  D +    V+  +K    E     + + +
Sbjct: 16  YAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVK--CHEEAYAAAVEEY 73

Query: 70  LSAVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLLVDRQ 124
            +   + +  +  L+  +GD     +       +    + +   K K  +    ++VD +
Sbjct: 74  EANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSK 133

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            + + D   +   G  +  K ++  Y+ +          L  V   +     G       
Sbjct: 134 GKKMKD-VPIIGGGSKLKVKYSLIPYKWNTAVGASVKLQLESVMLVELATFGGG-----E 187

Query: 185 SEFKDYGEEQDSDTSVSNFAS 205
            ++ D  EE     S S  AS
Sbjct: 188 DDWADEVEENGYVASGSAKAS 208


>gi|297590989|ref|ZP_06949627.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MN8]
 gi|297575875|gb|EFH94591.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MN8]
          Length = 133

 Score = 91.8 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 46/122 (37%), Gaps = 17/122 (13%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K R SY  +                Y   ++ PK+DT  I A+E  ++ A  E   +
Sbjct: 27  ITGKVRASYAHIFEP---HSMQEGQESKYSISLIIPKSDTSTIKAIEQAIEAAKEEGKVS 83

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                     +  +  +  LRDGD +             Y D+ +I+A +K   P ++ +
Sbjct: 84  KFGG------KVPANLKLPLRDGDTEREDDVN-------YQDAYFINASSK-QAPGIITK 129

Query: 124 QA 125
             
Sbjct: 130 TK 131


>gi|322691204|ref|YP_004220774.1| hypothetical protein BLLJ_1015 [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320456060|dbj|BAJ66682.1| hypothetical protein BLLJ_1015 [Bifidobacterium longum subsp.
           longum JCM 1217]
          Length = 224

 Score = 91.8 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 62/221 (28%), Gaps = 37/221 (16%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVE-------ACLKTA 56
           +TV G  ++P L                Y   I+F K D      +          ++  
Sbjct: 14  VTVPGIANFPHLFDTDPKNG-------KYTLSILFDKKDPDAQKMMRDLQAKCTEAIRRG 66

Query: 57  V--TEIFPNVSPDAF----LSAVRSKSESRGVLRDGDAKIASSHK-----PENYTQTYTD 105
           +         S   F    +            + DGD  + +         ++  + Y  
Sbjct: 67  IDGEPGRDGKSYAPFAGHSMDDADWVKRLGLPVEDGDTAVFTRGDNVGKLKKDVYKEYEG 126

Query: 106 SVYISAKNKYVQPL---LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSC 162
              + A  K        +VD+  + ++      Y G  V A + +  Y  D     G   
Sbjct: 127 HWILKAGTKNDLVAAGWVVDQNRRRLT--ANELYSGAIVRANIWLYPYRQDNS---GVGA 181

Query: 163 TLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNF 203
            L  V      ER G     +T     +G    S   V + 
Sbjct: 182 MLNAVVKTGDGERIGG----ETDPLAAFGLPDASAAGVPDP 218


>gi|71534868|gb|AAZ32836.1| single-stranded DNA-binding protein [Enterobacteria phage T7.1]
          Length = 241

 Score = 91.5 bits (225), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 63/201 (31%), Gaps = 15/201 (7%)

Query: 12  YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
           Y  +          G       Y  D+  P  D +    V+  +K    E     + + +
Sbjct: 16  YAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVK--CHEEAYAAAVEEY 73

Query: 70  LSAVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLLVDRQ 124
            +   + +  +  L+  +GD     +       +    + +   K K  +    ++VD +
Sbjct: 74  EANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSK 133

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            + + D   +   G  +  K ++  Y+ +          L  V   +     G       
Sbjct: 134 GKKMED-VPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGG-----E 187

Query: 185 SEFKDYGEEQDSDTSVSNFAS 205
            ++ D  EE     S S  AS
Sbjct: 188 DDWADEVEENGYVASGSAKAS 208


>gi|15826753|pdb|1JE5|A Chain A, Crystal Structure Of Gp2.5, A Single-Stranded Dna Binding
           Protein Encoded By Bacteriophage T7
 gi|15826754|pdb|1JE5|B Chain B, Crystal Structure Of Gp2.5, A Single-Stranded Dna Binding
           Protein Encoded By Bacteriophage T7
          Length = 206

 Score = 90.7 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/198 (14%), Positives = 61/198 (30%), Gaps = 15/198 (7%)

Query: 12  YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
           Y  +          G       Y  D+  P  D +    V+  +K    E     + + +
Sbjct: 16  YAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVK--CHEEAYAAAVEEY 73

Query: 70  LSAVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLLVDRQ 124
            +   + +  +  L+  +GD     +       +    + +   K K  +    ++VD +
Sbjct: 74  EANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSK 133

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            + + D   +   G  +  K ++  Y+ +          L  V   +     G       
Sbjct: 134 GKKMED-VPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGG-----E 187

Query: 185 SEFKDYGEEQDSDTSVSN 202
            ++ D  EE     S S 
Sbjct: 188 DDWADEVEENGYVASGSA 205


>gi|326536116|ref|YP_004300548.1| gp2.5 [Enterobacteria phage 285P]
 gi|256861505|gb|ACV32461.1| gp2.5 [Enterobacteria phage 285P]
          Length = 232

 Score = 90.7 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 49/192 (25%), Gaps = 7/192 (3%)

Query: 12  YPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLS 71
           Y  L           +    Y   +     D +    ++  ++    E       + + +
Sbjct: 19  YCYLAKPDFGSGDFKNERGVYKVSLTVSNDDPRCQKMIDEIVEA--HETDYAARLEEYEA 76

Query: 72  AVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP---LLVDRQAQ 126
                 + +  L+   GD     +              +   K    +P    +VD + +
Sbjct: 77  NPPKVVKGKKPLKPYVGDMPFMDNEDGTTTFNFKCYGSFTDKKTGENKPIDLAIVDSKGK 136

Query: 127 PVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSE 186
            +   R     G  +  K  +  Y             L  V   K  E  G         
Sbjct: 137 RIRGERPAISGGSELKIKYTLFPYGWSAVAGASVKLQLDSVMLIKLVEFGGGDDDWGDEI 196

Query: 187 FKDYGEEQDSDT 198
            +D  E  ++ T
Sbjct: 197 EEDGYEADEAQT 208


>gi|194100374|ref|YP_002003948.1| gp2.5 [Enterobacteria phage 13a]
 gi|193201421|gb|ACF15898.1| gp2.5 [Enterobacteria phage 13a]
          Length = 232

 Score = 90.7 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 63/201 (31%), Gaps = 15/201 (7%)

Query: 12  YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
           Y  +          G       Y  D+  P  D +    V+  +K    E     + + +
Sbjct: 16  YAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVK--CHEEAYAAAVEEY 73

Query: 70  LSAVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLLVDRQ 124
            +   + +  +  L+  +GD     +       +    + +   K K  +    ++VD +
Sbjct: 74  EANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSK 133

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            + + D   +   G  +  K ++  Y+ +          L  V   +     G       
Sbjct: 134 GKKMED-VPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGG-----E 187

Query: 185 SEFKDYGEEQDSDTSVSNFAS 205
            ++ D  EE     S S  AS
Sbjct: 188 DDWADEVEENGYVASGSAKAS 208


>gi|194100266|ref|YP_002003464.1| gp2.5 [Enterobacteria phage BA14]
 gi|193201261|gb|ACF15741.1| gp2.5 [Enterobacteria phage BA14]
          Length = 232

 Score = 90.7 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 49/192 (25%), Gaps = 7/192 (3%)

Query: 12  YPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLS 71
           Y  L           +    Y   +     D +    ++  ++    E       + + +
Sbjct: 19  YCYLAKPDFGSGDFKNERGVYKVSLTVSNDDPRCQKMIDEIVEA--HETDYAARLEEYEA 76

Query: 72  AVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP---LLVDRQAQ 126
                 + +  L+   GD     +              +   K    +P    +VD + +
Sbjct: 77  NPPKVVKGKKPLKPYVGDMPFMDNEDGTTTFNFKCYGSFTDKKTGENKPIDLAIVDSKGK 136

Query: 127 PVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSE 186
            +   R     G  +  K  +  Y             L  V   K  E  G         
Sbjct: 137 RIRGERPAISGGSELKIKYTLFPYGWSAVAGASVKLQLDSVMLIKLVEFGGGDDDWGDEI 196

Query: 187 FKDYGEEQDSDT 198
            +D  E  ++ T
Sbjct: 197 EEDGYEADEAQT 208


>gi|189427210|ref|YP_001949760.1| gp2.5 [Salmonella phage phiSG-JL2]
 gi|189085863|gb|ACD75678.1| gp2.5 [Salmonella phage phiSG-JL2]
          Length = 232

 Score = 90.3 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/211 (13%), Positives = 60/211 (28%), Gaps = 11/211 (5%)

Query: 12  YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
           Y  L          G       Y  D+     D +    V+  +KT   E     + + F
Sbjct: 19  YAYLSKPDYGNEERGFGNPRGVYKVDLTLSNKDPRCQAMVDEIVKT--HEEAYAAAVEEF 76

Query: 70  LSAVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLLVDRQ 124
            +        +  L+  +GD     +       +    + +   K K  +    ++VD +
Sbjct: 77  EANPPQVQRGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSK 136

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS-PKSD 183
            + + +   +   G  +  K ++  Y+ +          L  V   +     G    +  
Sbjct: 137 GKKIQE-VPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGGEDEWA 195

Query: 184 TSEFKDYGEEQDSDTSVSNFASAEVDSDALP 214
                      +S  S       E + +  P
Sbjct: 196 DEVEDGGYTASESRQSRDEQEWQEDEHEETP 226


>gi|326633053|ref|YP_004306664.1| predicted single-stranded DNA-binding protein [Salmonella phage
           Vi06]
 gi|301170526|emb|CBV65211.1| predicted single-stranded DNA-binding protein [Salmonella phage
           Vi06]
          Length = 234

 Score = 90.3 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/208 (15%), Positives = 66/208 (31%), Gaps = 15/208 (7%)

Query: 12  YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
           Y  +          G       Y  D+  P  D +    V+  +K    E     + + +
Sbjct: 16  YAYITKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVK--CHEEAYAAAVEEY 73

Query: 70  LSAVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPL---LVDRQ 124
            +   + +  +  LR  +GD     +       +    + Y   K K  + +   +VD +
Sbjct: 74  EANPPAVARGKKPLRPYEGDMPFFDNGDGTTTFKFKAYASYQDKKTKETKHINMVVVDSK 133

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            + + D   +   G  +  K ++  Y+ +          L  V   +     G       
Sbjct: 134 GKKIED-VPIIGGGSKLKVKYSLIPYKWNTAVGASVKLQLESVMLVELATFGGG-----E 187

Query: 185 SEFKDYGEEQDSDTSVSNFASAEVDSDA 212
            ++ D  EE     S S  AS   D ++
Sbjct: 188 DDWADEVEENGYVASGSAKASKPRDEES 215


>gi|17570802|ref|NP_523311.1| single-stranded DNA-binding protein [Enterobacteria phage T3]
 gi|138389|sp|P20313|VHED_BPT3 RecName: Full=Helix-destabilizing protein; AltName:
           Full=Single-stranded DNA-binding protein; Short=SSB
           protein
 gi|15693|emb|CAA35131.1| 2.5 [Enterobacteria phage T3]
 gi|17384286|emb|CAC86274.1| single-stranded DNA-binding protein [Enterobacteria phage T3]
          Length = 232

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/211 (13%), Positives = 59/211 (27%), Gaps = 11/211 (5%)

Query: 12  YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
           Y  L          G       Y  D+     D +    V+  +KT   E     + + F
Sbjct: 19  YAYLSKPDYGNEERGFGNPRGVYKVDLTLSNKDPRCQAMVDEIVKT--HEEAYAAAVEEF 76

Query: 70  LSAVRSKSESRGVL--RDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLLVDRQ 124
            +        +  L   +GD     +       +    + +   K K  +    ++VD +
Sbjct: 77  EANPPQVQRGKKPLTPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSK 136

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS-PKSD 183
            + + +   +   G  +  K ++  Y+ +          L  V   +     G    +  
Sbjct: 137 GKKIQE-VPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGGEDEWA 195

Query: 184 TSEFKDYGEEQDSDTSVSNFASAEVDSDALP 214
                      +S  S       E + +  P
Sbjct: 196 DEVEDGGYTASESRQSRDEQEWQEDEHEETP 226


>gi|30387465|ref|NP_848274.1| protein 2.5 [Yersinia pestis phage phiA1122]
 gi|30314102|gb|AAP20510.1| protein 2.5 [Yersinia pestis phage phiA1122]
          Length = 232

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/212 (15%), Positives = 66/212 (31%), Gaps = 17/212 (8%)

Query: 12  YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
           Y  +          G       Y  D+  P  D +    V+  +K    E     + + +
Sbjct: 16  YAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVK--CHEEAYAAAVEEY 73

Query: 70  LSAVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLLVDRQ 124
            +   + +  +  L+  +GD     +       +    + +   K K  +    ++VD +
Sbjct: 74  EANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSK 133

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            + + D   +   G  +  K ++  Y+ +          L  V   +     G       
Sbjct: 134 GKKMED-VPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGG-----E 187

Query: 185 SEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216
            ++ D  EE     S S  AS     D   W+
Sbjct: 188 DDWADEVEENGYVASGSAKASK--PRDEESWD 217


>gi|291335905|gb|ADD95500.1| T7-like ssDNA binding protein [uncultured phage MedDCM-OCT-S08-C41]
          Length = 187

 Score = 89.5 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 34/167 (20%), Positives = 55/167 (32%), Gaps = 16/167 (9%)

Query: 49  VEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVY 108
           ++A +   + E      PD    A    +  +           S+ KPE + +       
Sbjct: 30  LKAVVGADIVEQLEAERPDCLKWAESKLANPK----------RSTLKPEPWEEVADGQYT 79

Query: 109 ISAK-NKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGV 167
           +    N+ ++P +VD +  P+ D     Y GC V        Y L    T G S  L GV
Sbjct: 80  VKFSWNEEMKPGIVDTEGTPIEDVNTPLYSGCRVKLAFFQKPYVLKDKVTYGTSLKLQGV 139

Query: 168 QFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALP 214
           Q        G       +   D  +  +   +   F +AE      P
Sbjct: 140 QVVTLSTSAG-----IDTGDMDDVDVAELFGTTKGFKTAEPSVTPAP 181


>gi|282857710|ref|ZP_06266919.1| putative phage single-stranded DNA-binding protein [Pyramidobacter
           piscolens W5455]
 gi|282584380|gb|EFB89739.1| putative phage single-stranded DNA-binding protein [Pyramidobacter
           piscolens W5455]
          Length = 245

 Score = 89.5 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/219 (14%), Positives = 59/219 (26%), Gaps = 18/219 (8%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T  G+  +  +          G     Y   I+  K + + +  +E   +  + E     
Sbjct: 18  TPAGKALFCRVFEPDYQFDERGD----YSATILLSKDNPE-VAELERQFEALMAEAEAMA 72

Query: 65  SPDAFLSAVRSKSESRGVLRDG------DAKIASSHKPENYTQTYTDSVYISAKNKYVQP 118
             +A  +    K       +D       D     + +     +          K+    P
Sbjct: 73  QENAAKNKNPRKRNELPPRKDENHGDWFDKNGEPTGEYAIRAKAKASGTSKQGKDWTFSP 132

Query: 119 LLVDRQAQPVS-DPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWG 177
            + D Q  P   +P+ +   G  +   +    Y        G S  L  +Q     E   
Sbjct: 133 FVCDAQGVPFPEEPKRLIGNGSTIKLAVTAFPYA--SPIGYGISIRLDALQVLDLVEYN- 189

Query: 178 ASPKSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216
               + T  F    EE  S  S          +D   + 
Sbjct: 190 -KRDAKTYGFG--EEEGYSVASADEHDETAQFADEDKYE 225


>gi|9634008|ref|NP_052082.1| single-stranded DNA-binding protein [Yersinia phage phiYeO3-12]
 gi|6598999|emb|CAB63603.1| single-stranded DNA-binding protein [Yersinia phage phiYeO3-12]
          Length = 232

 Score = 88.4 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 62/205 (30%), Gaps = 14/205 (6%)

Query: 12  YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
           Y  L          G       Y  D+     D +    V+  +KT   E     + + F
Sbjct: 19  YAYLSKPDYGNEERGFGNPRGVYKVDLTLSNKDPRCQAMVDEIVKT--HEEAYAAAVEEF 76

Query: 70  LSAVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLLVDRQ 124
            +        +  L+  +GD     +       +    + +   K K  +    ++VD +
Sbjct: 77  EANPPQVQRGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSK 136

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            + + +   +   G  +  K ++  Y+ +          L  V   +     G       
Sbjct: 137 GKKIQE-VPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGG----E 191

Query: 185 SEFKDYGEEQDSDTSVSNFASAEVD 209
            E+ D  E+     S S  +  E +
Sbjct: 192 DEWADEVEDGGYTASESRQSRDEQE 216


>gi|254503854|ref|ZP_05116005.1| hypothetical protein SADFL11_3893 [Labrenzia alexandrii DFL-11]
 gi|254505326|ref|ZP_05117474.1| hypothetical protein SADFL11_PLAS24 [Labrenzia alexandrii DFL-11]
 gi|222436170|gb|EEE42852.1| hypothetical protein SADFL11_PLAS24 [Labrenzia alexandrii DFL-11]
 gi|222439925|gb|EEE46604.1| hypothetical protein SADFL11_3893 [Labrenzia alexandrii DFL-11]
          Length = 208

 Score = 88.4 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 59/194 (30%), Gaps = 29/194 (14%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
           T  G  +Y  L      +     S + +   +V  K D   +    A         +P  
Sbjct: 12  TGAGIAAYAYLVKADSGRKF---SDDKFKVTLVVDK-DAPWVEDFRAKCLAEAKTEWPKA 67

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ 124
            P+               ++DGD     +       + +     I+AK+K  +P +VD +
Sbjct: 68  KPERVS----------LPIKDGDEIADDAADKGQDKEEFRGKYLITAKSKK-RPTMVDAK 116

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            + +  P  V      +   + +          K  +  L  VQ              + 
Sbjct: 117 RKTL--PNNVIKSADEIKLNVALNPCTPSNN--KTIALWLNAVQLI----------TKNN 162

Query: 185 SEFKDYGEEQDSDT 198
           + F   GE +D D 
Sbjct: 163 NGFDAAGEFEDEDG 176


>gi|29366711|ref|NP_813756.1| single-stranded DNA-binding protein [Pseudomonas phage gh-1]
 gi|29243570|gb|AAO73149.1|AF493143_10 putative ssDNA-binding protein [Pseudomonas phage gh-1]
          Length = 233

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/216 (11%), Positives = 58/216 (26%), Gaps = 12/216 (5%)

Query: 5   TVKGRLS-YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTK-QINAVEACLK---TAV 57
           T  G    Y ++          G       Y   +  P  + +  I+ +          +
Sbjct: 11  TPVGTAEPYCSIQKPDFGNPEKGFGNPRGVYKVSLTIPSREAQPLIDKITKAYDKNWAEI 70

Query: 58  TEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYI---SAKNK 114
           +E + N    A  + +    +       G+     +       +    + Y    + +N+
Sbjct: 71  SEAWENGGRAAAQAKLARGKKL-LEAYQGELPFFENEDGTVTFKFSGYASYKDQKTGENR 129

Query: 115 YVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDE 174
            +   +VD + + + +       G  +  + +I  Y             L  V   +  E
Sbjct: 130 DIVLRVVDAKGKRI-EAVPAIAGGSKLKVRFSIFPYTFGAVVGASVKLQLDSVMLIELRE 188

Query: 175 RWGASPKSDTSEFKDYGEEQDSDTSVSNFASAEVDS 210
                      E + +    D +         E + 
Sbjct: 189 FAAGGDDWAGQEEEGFEAPDDREEGWRGEQGEEDED 224


>gi|273810595|ref|YP_003344976.1| gp41 [Sodalis phage SO-1]
 gi|258619880|gb|ACV84133.1| gp41 [Sodalis phage SO-1]
          Length = 261

 Score = 86.8 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/194 (19%), Positives = 78/194 (40%), Gaps = 25/194 (12%)

Query: 1   MQKLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M K+ +K  R+ +  +  +   K         Y   I+  K D  Q++ VEA  ++ +T+
Sbjct: 6   MAKVNLKNVRVCFLKIWERDTPKQD--GQKPAYRAVILLDKEDP-QVDKVEAAARSVLTD 62

Query: 60  IFPN-VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP 118
              +  + D ++    ++      +RDGD +   +       + +   +YI+AK+ + QP
Sbjct: 63  KLKSEKNADKWMDRHYAQDSKECAVRDGDERDEVT-------EEFEGMLYINAKS-FKQP 114

Query: 119 LLVDRQAQPVSDPR----------EVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQ 168
           ++     +  ++            +  Y GC+    L+I A+     K       L G++
Sbjct: 115 IIQTSLGEKQTEQGLTIDGDEIEGQEIYSGCYCNVSLDIWAWNNTNGKGL--GAGLLGLR 172

Query: 169 FFKHDERWGASPKS 182
           F    E +G    S
Sbjct: 173 FRDDGEAFGGGGSS 186


>gi|225220081|ref|YP_002720048.1| hypothetical protein EpSSL_gp09 [Enterobacteria phage SSL-2009a]
 gi|224986022|gb|ACN74586.1| hypothetical protein [Enterobacteria phage SSL-2009a]
          Length = 264

 Score = 86.5 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/194 (19%), Positives = 77/194 (39%), Gaps = 25/194 (12%)

Query: 1   MQKLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M K+ +K  R+ +  +  +   K         Y   I+  K D  Q++ VEA  +  +T+
Sbjct: 6   MAKVNLKKVRVCFLKIWERDTPKQD--GQKPAYRAVILLDKEDP-QVDKVEAAARAVLTD 62

Query: 60  IFPN-VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP 118
              +  + D ++    ++      +RDGD +   +       + +   +YI+AK+ + QP
Sbjct: 63  KLKSEKNADKWMDRHYAQDSKECAVRDGDERDEVT-------EEFEGMLYINAKS-FKQP 114

Query: 119 LLVDRQAQPVSDPR----------EVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQ 168
           ++     +  ++            +  Y GC+    L+I A+     K       L G++
Sbjct: 115 IIQTSLGEKQTEQGLTVEGDEIEGQEIYSGCYCNVSLDIWAWNNTNGKGL--GAGLLGLR 172

Query: 169 FFKHDERWGASPKS 182
           F    E +G    S
Sbjct: 173 FRDDGEAFGGGGPS 186


>gi|323159204|gb|EFZ45194.1| bbp40 domain protein [Escherichia coli E128010]
          Length = 125

 Score = 86.5 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 45/130 (34%), Gaps = 16/130 (12%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
            RL++P+L      K  +G     +    +       Q+  +   +K    E +      
Sbjct: 8   VRLAFPSL---FEAKTVNGEGDPRFSAVFLMSPKHP-QLEEIRKAMKQVAKEKWGEKWEP 63

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQP 127
            +    +   +    L DGD K           + +  + +++A NK  +P ++DR   P
Sbjct: 64  IYNQLEK---KLNLCLHDGDEKAE--------YEGFPGNFFLNAANK-ARPAVLDRDRSP 111

Query: 128 VSDPREVFYP 137
           +       Y 
Sbjct: 112 LIQADGRPYG 121


>gi|300858868|ref|YP_003783851.1| hypothetical protein cpfrc_01451 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300686322|gb|ADK29244.1| hypothetical protein cpfrc_01451 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302206575|gb|ADL10917.1| Hypothetical protein CpC231_1447 [Corynebacterium
           pseudotuberculosis C231]
 gi|302331130|gb|ADL21324.1| Putative phage-associated protein [Corynebacterium
           pseudotuberculosis 1002]
 gi|308276818|gb|ADO26717.1| Putative phage-associated protein [Corynebacterium
           pseudotuberculosis I19]
          Length = 130

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 49/135 (36%), Gaps = 24/135 (17%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T + RL Y  +            S   Y   ++ PK DT+ +  +E  +   +      
Sbjct: 10  VTGEVRLFYANIFEA----NSIQGSKPKYSVSLIIPKGDTEMLAKIERAIDATIEVGIG- 64

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                F     +K+  +  LRD               + Y  +++++A +K   P +VD 
Sbjct: 65  ----KFGGNRPNKAALKLPLRD--------------DEAYAGAMFVNADSK-TPPQVVDA 105

Query: 124 QAQPVSDPREVFYPG 138
             Q + DP    + G
Sbjct: 106 AMQAIVDPTGGDFGG 120


>gi|318064538|gb|ADV36498.1| gp41 [Edwardsiella phage eiDWF]
 gi|318064642|gb|ADV36550.1| gp41 [Edwardsiella phage eiMSLS]
          Length = 245

 Score = 83.4 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/197 (18%), Positives = 76/197 (38%), Gaps = 26/197 (13%)

Query: 1   MQKLTVK-GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE 59
           M K+ +K  RL +     +   K         Y   I+  K D +Q+  +E      +T 
Sbjct: 1   MAKVNLKNVRLCFLHAFERAEPKNK--GEKAAYKVCILLDKDD-QQVEKLEDTALEVLTA 57

Query: 60  IFPNVS-PDAFLSAVRSKSESRGV-LRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ 117
            +      + ++S   ++  S+   + DGD +       E  T  + +++YI+A++   Q
Sbjct: 58  KWGKREVAERWMSRNYAQDSSKECAVNDGDLR-------EEVTPEFENAIYINARS-PKQ 109

Query: 118 PLLVDRQAQPVSDPR----------EVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGV 167
           P +     +  ++P           +  Y GC+    + +  +  D    KG    + G+
Sbjct: 110 PKIQTSLGEDQTEPGITVDGDPIEGKEIYAGCYANVSIEL--WAQDNEHGKGLRAAILGL 167

Query: 168 QFFKHDERWGASPKSDT 184
           +F    E +G    + T
Sbjct: 168 RFRADGEAFGGGGSTAT 184


>gi|290466794|gb|ADD25724.1| hypothetical protein [Lactococcus phage 1358]
          Length = 290

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 52/172 (30%), Gaps = 17/172 (9%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T K   ++  L    R     G     +    + P  D K I A++  +  A       
Sbjct: 28  VTGKVTAAFAHLIEPDR--GQSGKDDPKWQVTAIIPADDKKTIKAIKEAVANA------K 79

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
              +     V  +S++   ++D                 Y  ++ +        P ++  
Sbjct: 80  AIGEEKGKVVGKQSKNGNPIKDACDIFD-----LEKYPEYEGAIAVKFSTNQGAPTVL-S 133

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDER 175
           +++ V D  E  Y G          A+        G S  L  V   +  ER
Sbjct: 134 KSKRVLDSDEDVYSGMLCAISGAAYAW---NNGGWGISFILGAVMKLEDGER 182


>gi|291335758|gb|ADD95361.1| T7-like ssDNA binding protein [uncultured phage
           MedDCM-OCT-S05-C243]
          Length = 190

 Score = 81.8 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 44/125 (35%), Gaps = 12/125 (9%)

Query: 95  KPENYTQTYTDSVYISAK-NKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELD 153
           KP  + +       I    N   +P +VD +  P+++     Y G  V        Y L 
Sbjct: 66  KPTPWEEVSDGKYLIKFSWNDEKRPPVVDTEGTPITNSETPVYSGSKVKLGFTQKPYILR 125

Query: 154 PYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSD--TSVSNFASAEVD-- 209
              T G S  L+GVQ        G        +  D  E   ++   + + F ++E +  
Sbjct: 126 DGVTYGTSLKLSGVQIVSIQSEVG-------VDTGDLDEAGVAEMFGNTAGFKASEPNVT 178

Query: 210 SDALP 214
            D  P
Sbjct: 179 VDTAP 183


>gi|291335379|gb|ADD94993.1| T7-like ssDNA binding protein [uncultured phage MedDCM-OCT-S04-C24]
          Length = 187

 Score = 81.4 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 41/127 (32%), Gaps = 6/127 (4%)

Query: 89  KIASSHKPENYTQTYTDSVYISAK-NKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNI 147
              S  KPE + +   +   +    N+  +P +VD +  PV+D     Y G  V      
Sbjct: 60  PKRSVLKPEPWEEVADNQFKVKFSWNEENRPPVVDTEGTPVTDENTPMYSGSRVNLAFYQ 119

Query: 148 GAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNFASAE 207
             Y L    T G S  L GVQ    +   G       +      +          F + +
Sbjct: 120 KPYILKDGVTYGTSLKLVGVQLVSLNSGAG-----VDTGDMAAEDVAALFGKTEGFKAND 174

Query: 208 VDSDALP 214
                LP
Sbjct: 175 PAVTVLP 181


>gi|157311149|ref|YP_001469194.1| hypothetical protein P9_gp14 [Streptococcus phage P9]
 gi|119104298|gb|ABL61043.1| hypothetical protein [Streptococcus phage P9]
          Length = 101

 Score = 81.1 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 4/84 (4%)

Query: 101 QTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGF 160
             Y   +++S  +K  +P ++D+    V D  E  Y G +    LN  AY       KG 
Sbjct: 7   PEYAGHMFMSISSK-TKPQIIDKYKNSV-DSAEEVYSGVYARVSLNAYAYNTAGN--KGI 62

Query: 161 SCTLTGVQFFKHDERWGASPKSDT 184
           SC L  VQ     +  G    +D 
Sbjct: 63  SCGLNNVQIVAKGDYLGGRSSADA 86


>gi|326536923|ref|YP_004306330.1| single-stranded DNA-binding protein [Pseudomonas phage phiIBB-PF7A]
 gi|318054499|gb|ADV35675.1| single-stranded DNA-binding protein [Pseudomonas phage phiIBB-PF7A]
          Length = 231

 Score = 78.8 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/223 (14%), Positives = 63/223 (28%), Gaps = 19/223 (8%)

Query: 4   LTVKGRLS-YPALDTKVRMKLPDGSSVEHYGCDIVFPKADTK-QINAVEACLKTAVTEIF 61
           ++ KG+ + Y A+                Y  +++ P  D +  I  +    + +  E  
Sbjct: 10  ISAKGKAAPYAAIQKPDFGTTEFPQPRGEYKVNLIVPLKDAQADIKRITKIYEESYAEFL 69

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---P 118
                +    A   +      +R GD             +    + + + K   +Q    
Sbjct: 70  AEHEANPPKVAPGKRP---VPVRQGDLPFFEDGNGNVVFKFKCYASWKNPKTDAMQDITL 126

Query: 119 LLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGA 178
            + D + + +         G  +  + ++  Y+ +          L GV      E  G 
Sbjct: 127 RVADSKGKTM-SVVPNISGGSTLKLRYSVFPYKWNTAVGASVKLQLEGVMLIDLVEFGGG 185

Query: 179 SPKS-----DTSEFKDYG----EEQDSDTSVSNFASAEVDSDA 212
                    +   F        EE   D S    A  E   DA
Sbjct: 186 GDDDWGDAVEEGGFVAEETTQREEWQEDRSDMGHA-GEDIPDA 227


>gi|326424975|ref|YP_004286197.1| putative ssDNA-binding protein [Pseudomonas phage phi15]
 gi|325048379|emb|CBZ41992.1| putative ssDNA-binding protein [Pseudomonas phage phi15]
          Length = 224

 Score = 77.6 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/213 (12%), Positives = 56/213 (26%), Gaps = 7/213 (3%)

Query: 5   TVKGRLS-YPALDTKVRMKLPDGSSVEHYGCDIVFPKADTK-QINAVEACLKTAVTEIFP 62
           T  G  + Y +L                Y  +++ P       +  ++     +  E+  
Sbjct: 10  TPIGIAAPYASLQKPDYGSAEFPQPRGEYKVNLIVPMDKAAPLMAKLQKIADDSYAEMLA 69

Query: 63  NVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTD-SVYISAKNKYVQPLLV 121
               +        K       R GD             +     S     + + +   + 
Sbjct: 70  EHKANPPKVQPGKKPVQP---RQGDMPWFEDGNGNVVFKFKCYASYEKDGEKRDINIKVA 126

Query: 122 DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181
           D + + + +       G  +  + ++  Y+ +P         L GV   K  E  G    
Sbjct: 127 DSRGKKI-EVVPNISGGSELKVRFSVFPYKWNPTVGASVKLQLDGVMLIKLVEFGGGDDD 185

Query: 182 SDTSEFKDYGEEQDSDTSVSNFASAEVDSDALP 214
                 +   E+   D    +    +   D  P
Sbjct: 186 WGDEVVEGGYEDDSYDREGFDQGHGDEPEDDTP 218


>gi|310005847|gb|ADP00232.1| ssDNA binding protein [Cyanophage Syn26]
          Length = 189

 Score = 77.6 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 43/122 (35%), Gaps = 6/122 (4%)

Query: 89  KIASSHKPENYTQTYTDSVYISAKN-KYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNI 147
              S+ +PE + +       I     +  +P +VD +  P+++     Y G  V    + 
Sbjct: 59  PKRSTCRPEPWEEVADGKFIIKFSWAEDKRPPVVDTEGTPITNIDTPVYEGSKVKLGFHQ 118

Query: 148 GAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNFASAE 207
             Y L    T G S  L+GVQ        GA   S   +        D     + F + E
Sbjct: 119 KPYILRDGVTYGTSLKLSGVQIVSIQT--GAGIDSGDLDEDGVA---DLFGKTAGFKADE 173

Query: 208 VD 209
            +
Sbjct: 174 PN 175


>gi|313892509|ref|ZP_07826098.1| hypothetical protein HMPREF9220_0740 [Dialister microaerophilus
           UPII 345-E]
 gi|313119088|gb|EFR42291.1| hypothetical protein HMPREF9220_0740 [Dialister microaerophilus
           UPII 345-E]
          Length = 206

 Score = 76.1 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/192 (14%), Positives = 54/192 (28%), Gaps = 23/192 (11%)

Query: 2   QKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIF 61
           Q +T KG   Y  L      +  D      +   I   K DT+   A+ A +   + +  
Sbjct: 9   QIVTPKGEALYAHLVKPEMYQGQDQG----FSIQIKLNKKDTE---ALIATIDKELEKAK 61

Query: 62  PNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ--PL 119
             +         +         ++GD             +    S+  +   + ++    
Sbjct: 62  QEMDLPTTAKWSKEPFLGYKEDKNGDIV----------FKFKASSMIKTRTGEELKRSIA 111

Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           + D Q   +S        G  +     +  +        G S  LT VQ       +G  
Sbjct: 112 VFDSQGNLISGEN--IGNGSTIRVSGYLMPF-YVSKIINGISLKLTAVQVIDLV-PYGGG 167

Query: 180 PKSDTSEFKDYG 191
             +    F+   
Sbjct: 168 RDAQAYGFEKEE 179


>gi|281416291|ref|YP_003347531.1| single-stranded DNA-binding protein [Klebsiella phage KP32]
 gi|262410410|gb|ACY66675.1| single-stranded DNA-binding protein [Klebsiella phage KP32]
          Length = 231

 Score = 75.7 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 53/202 (26%), Gaps = 11/202 (5%)

Query: 12  YPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLS 71
           Y   +          +    Y   + F   D +++  +         E       +A  +
Sbjct: 19  YAYFNKPDYGGEGFENPRGTYKGSVTFKNEDCQELVDLIV----KTHEENYAARLEAHEA 74

Query: 72  AVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVY---ISAKNKYVQPLLVDRQAQ 126
                 + +  L+  +GD     +              Y    + + K +   +VD + +
Sbjct: 75  NPPKVQKGKKPLKPYEGDMPFFDNGDGTTTFNFKCYGSYEDKKTGETKKIVLGVVDAKGK 134

Query: 127 PVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSE 186
            + D   +   G  V  + ++  Y             L GV   +     G         
Sbjct: 135 RIQD-VPIIGGGSKVKIRFSLVPYGWSAVAGASVKLQLEGVMLVELATFGGGEDDWADEA 193

Query: 187 FKDYGEEQDSDTSVSNFASAEV 208
            +  G E D   S       E 
Sbjct: 194 VEG-GYEADEPRSRKPQEDPED 214


>gi|307317152|ref|ZP_07596593.1| APSE-2 prophage [Sinorhizobium meliloti AK83]
 gi|306897240|gb|EFN27985.1| APSE-2 prophage [Sinorhizobium meliloti AK83]
          Length = 226

 Score = 75.7 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 40/180 (22%), Positives = 70/180 (38%), Gaps = 15/180 (8%)

Query: 2   QKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPK---ADTKQINAVEACLKTAVT 58
            ++ V  RLSY  +  K +           Y  + +  K           ++  ++  + 
Sbjct: 12  GRVKVLVRLSYCKITEKTKS---SDEGALKYRTNGLISKKTKEGKASKAVIDEAVEHLIE 68

Query: 59  EIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP 118
           + +P   P+  L   R+    R  + DGD  + S  +       Y D+ Y+   N    P
Sbjct: 69  KEWPGKDPEKLL---RAFDSKRLPIFDGDEYLTSDGEIR---DHYEDTWYLKLTN-DRLP 121

Query: 119 LLVDRQAQPVS--DPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERW 176
            L DRQ   ++  +  E+F  G   +A  +  A +       G   T+ G+QFFK DE +
Sbjct: 122 KLKDRQGNDLTIEEAEELFLSGYHAVAYYHYYAIKDKAKGGNGIFSTIDGLQFFKRDELF 181


>gi|325171302|ref|YP_004251273.1| ssDNA-binding protein [Vibrio phage ICP3]
 gi|323512008|gb|ADX87470.1| ssDNA-binding protein [Vibrio phage ICP3]
          Length = 239

 Score = 74.5 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 22/179 (12%), Positives = 47/179 (26%), Gaps = 20/179 (11%)

Query: 5   TVKGRL-SYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           T  G + +YP +          G     Y   +  P    +    +   +  A  +    
Sbjct: 26  TPIGVVGAYPYIQRPDTQFNDRGE----YRIKLAVPSDKAQ---KLINLITEAHEKNLEA 78

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLL 120
           +  +      R        +++GD       +          + +   +   ++     +
Sbjct: 79  LKKNPKYKGKR--------IKEGDMPFFEDDEGNVVFTFKMYASFKDKETGEMKDLTLRV 130

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
            D Q + + D       G     + ++ AY             L   Q  K  E  G  
Sbjct: 131 YDSQGKRIED-VPAISGGSEGRVEFSLFAYPPSGAVGASVKLQLAKFQLLKLVEWTGGG 188


>gi|194100429|ref|YP_002003802.1| gp2.5 [Klebsiella phage K11]
 gi|193201368|gb|ACF15846.1| gp2.5 [Klebsiella phage K11]
          Length = 231

 Score = 74.5 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 24/204 (11%), Positives = 55/204 (26%), Gaps = 13/204 (6%)

Query: 12  YPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLS 71
           Y   +          +    Y   + F   D +++  +         E       +A  +
Sbjct: 19  YAYFNKPDYGGEGFENPRGTYKGYVTFKNEDCQELVDLIV----KTHEENYAARLEAHEA 74

Query: 72  AVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVY---ISAKNKYVQPLLVDRQAQ 126
                 + +  L+  +GD     +              Y    + + K +   +VD + +
Sbjct: 75  NPPKVQKGKKPLKPYEGDMPFFDNGDGTTTFNFKCYGSYEDKKTGETKKIVLGVVDAKGK 134

Query: 127 PVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSE 186
            + D   +   G  V  + ++  Y             L GV   +     G         
Sbjct: 135 RIQD-VPIIGGGSKVKIRFSLVPYGWSAVAGASVKLQLEGVMLVELATFGGGEDDWAD-- 191

Query: 187 FKDYGEEQDSDTSVSNFASAEVDS 210
            +      ++D S S     + + 
Sbjct: 192 -EAVEGGYEADESRSRKPQEDPED 214


>gi|291335800|gb|ADD95400.1| T7-like ssDNA binding protein [uncultured phage
           MedDCM-OCT-S05-C849]
          Length = 190

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/197 (17%), Positives = 60/197 (30%), Gaps = 24/197 (12%)

Query: 23  LPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN--VSPDAFLSAVRSKSESR 80
             D  ++E Y   +   K        V + +  A+           ++ L   +      
Sbjct: 7   TKDPVTLEGYQAILKPSKFGYSLKAVVGSDIVDALETERAECLKWAESKLKNPK------ 60

Query: 81  GVLRDGDAKIASSHKPENYTQTYTDSVYISAKN-KYVQPLLVDRQAQPVSDPREVFYPGC 139
                      S+ KP  + +       +     +  +P +VD +  P+++     Y G 
Sbjct: 61  ----------RSTLKPTPWEEVSDGKFIVKFSWAEEKRPPVVDTEGSPITNADTPVYEGS 110

Query: 140 WVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK-----SDTSEFKDYGEEQ 194
            V    +   Y L    T G S  L+G+Q        G              F      +
Sbjct: 111 KVKIGFHQKPYILKDGTTYGTSLKLSGIQVVSVQSGAGVDTGDLDEIGVAELFGKTSGFK 170

Query: 195 DSDTSVSNFASAEVDSD 211
             D +V+  A AEV  D
Sbjct: 171 ADDPNVTPAAVAEVIPD 187


>gi|265525453|gb|ACY76219.1| predicted protein [Prochlorococcus phage P-SSP7]
          Length = 191

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 57/195 (29%), Gaps = 26/195 (13%)

Query: 23  LPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN--VSPDAFLSAVRSKSESR 80
             +  ++E Y   +   K        V + +  A+     +     ++ L   +      
Sbjct: 9   TKEPVTLEGYQAILKPSKFGYSLKAVVGSDIVDALETERADCLKWAESKLKNPKRA---- 64

Query: 81  GVLRDGDAKIASSHKPENYTQTYTDSVYISAKN-KYVQPLLVDRQAQPVSDPREVFYPGC 139
                       + KP  + +       +     +  +P +VD +  P+++     Y G 
Sbjct: 65  ------------TLKPTPWEEVEEGKFIVKFSWAEDKRPPVVDTEGTPITNEDVPVYEGS 112

Query: 140 WVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTS 199
            V    +   Y L    T G S  L+G+Q        G       +   D     +    
Sbjct: 113 KVKIGFHQKPYILRDGVTYGTSLKLSGIQVVSIQSGAG-----VDTGDLDQDGVAELFGK 167

Query: 200 VSNFASAEVDSDALP 214
              F +   D +  P
Sbjct: 168 TQGFKA--DDPNVTP 180


>gi|331028088|ref|YP_004421802.1| hypothetical protein RDJLphi1_gp34 [Roseobacter phage RDJL Phi 1]
 gi|301341551|gb|ADK73435.1| hypothetical protein RDJLphi1_gp34 [Roseobacter phage RDJL Phi 1]
          Length = 213

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 36/224 (16%), Positives = 71/224 (31%), Gaps = 45/224 (20%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIV-----FPKADTKQINAVEACLKTAVT 58
           LT   R ++            D +    YG   +     F KAD K+ +A+   L     
Sbjct: 8   LTPVFRGAFTKTVFTPEYFDDDKTGEPKYGITAIWDPEKFSKADQKRWDAIMEALDDESK 67

Query: 59  EIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQP 118
             F            +  +  +  +RDG+ K           + +   +  ++    ++P
Sbjct: 68  ARFKKSW-------DKLPANYKKGIRDGEEKAD--------KEGFEPGLQFASLTTKMRP 112

Query: 119 LLVDRQAQPVSDPREV-------------------FYPGCWVIAKLNIGAYELDPYKTKG 159
            +VD++ + ++   E                     Y G +  A +   +Y     K KG
Sbjct: 113 GVVDKERKAIAKNDEEREKWEEQDKDVSNEVGMDAVYSGAYYRATVVTYSY---DNKGKG 169

Query: 160 FSCTLTGVQFFKHDERWGASPKSDTSEFKDYGE---EQDSDTSV 200
            +  L  +Q  +  ER      +      +  +   E+D D   
Sbjct: 170 VALGLMNLQKVRDGERIDGRTDASADFEDELDDAWLEEDEDPLD 213


>gi|61806415|ref|YP_214192.1| T7-like ssDNA binding protein [Prochlorococcus phage P-SSP7]
 gi|61374340|gb|AAX44194.1| T7-like ssDNA binding protein [Prochlorococcus phage P-SSP7]
          Length = 189

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/195 (13%), Positives = 58/195 (29%), Gaps = 26/195 (13%)

Query: 23  LPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN--VSPDAFLSAVRSKSESR 80
             +  ++E Y   +   K        V + +  A+     +     ++ L   +      
Sbjct: 7   TKEPVTLEGYQAILKPSKFGYSLKAVVGSDIVDALETERADCLKWAESKLKNPKRA---- 62

Query: 81  GVLRDGDAKIASSHKPENYTQTYTDSVYISAKN-KYVQPLLVDRQAQPVSDPREVFYPGC 139
                       + KP  + +       +     +  +P +VD +  P+++     Y G 
Sbjct: 63  ------------TLKPTPWEEVEEGKFIVKFSWAEDKRPPVVDTEGTPITNEDVPVYEGS 110

Query: 140 WVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTS 199
            V    +   Y L    T G S  L+G+Q        G        +  D  ++  ++  
Sbjct: 111 KVKIGFHQKPYILRDGVTYGTSLKLSGIQVVSIQSGAG-------VDTGDLDQDGVAELF 163

Query: 200 VSNFASAEVDSDALP 214
                    D +  P
Sbjct: 164 GKTQGFKADDPNVTP 178


>gi|310005713|gb|ADP00100.1| ssDNA binding protein [Cyanophage NATL1A-7]
          Length = 190

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 44/129 (34%), Gaps = 8/129 (6%)

Query: 89  KIASSHKPENYTQTYTDSVYISAK-NKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNI 147
              ++ KPE + +   D   I    N+  +P +VD +   V+D +   Y G  V      
Sbjct: 60  PKRATLKPEPWEEVAKDKYKIKFSWNEDNRPPVVDTEGTQVTDTKTPLYAGSTVKLGFYQ 119

Query: 148 GAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNFASAE 207
             Y L    T G S  L GVQ                +   D     +     S F +A 
Sbjct: 120 KPYILRDGVTYGSSLKLVGVQVVSVK-----GDAGVDTGDLDADAVAELFGKSSGFKTA- 173

Query: 208 VDSDALPWN 216
            D +  P N
Sbjct: 174 -DPNVTPTN 181


>gi|160898856|ref|YP_001564438.1| hypothetical protein Daci_3415 [Delftia acidovorans SPH-1]
 gi|160364440|gb|ABX36053.1| hypothetical protein Daci_3415 [Delftia acidovorans SPH-1]
          Length = 228

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 37/217 (17%), Positives = 76/217 (35%), Gaps = 34/217 (15%)

Query: 9   RLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDA 68
           RL +  L      ++    +   +    +F   D+      +A L  A T ++   + + 
Sbjct: 17  RLQWGDLFQAASGEINGKKTEPKFKAVGLFAP-DSDAAAQAKAGLLEAATTLWGANAQNV 75

Query: 69  FLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ----PLLVDRQ 124
            ++   +       +R+G++KI  S         + D ++IS  NK       P L+D +
Sbjct: 76  LVNISANSKA----VRNGNSKIDDSGAVRP---EFKDMLFISCSNKQRPQIIAPKLLDGK 128

Query: 125 AQPVSDPR-----------------EVFYPGCWVIAKLNIGA-YELDPYKT----KGFSC 162
              +++                   +  Y GC+V  K+   A                  
Sbjct: 129 YVTITEDGRGMVNGIDVTDRLGYVLKAPYRGCYVNLKVQFVAGKAFKASSGEMIPNQVYA 188

Query: 163 TLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTS 199
            L  VQF +  + +GA P S     ++   ++  D++
Sbjct: 189 KLEAVQFLRDGDPFGAGPTSAEGFGEEEVSQEAVDSA 225


>gi|310005636|gb|ADP00024.1| ssDNA binding protein [Cyanophage 9515-10a]
          Length = 190

 Score = 71.8 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 51/193 (26%), Gaps = 39/193 (20%)

Query: 28  SVEHYGCDIVFPKADTKQIN-----AVEACLKTAVTEIFPNVSPDAFLS--AVRSKSESR 80
               Y   ++  K+  +Q+      A+E     A      +V P+ +          + R
Sbjct: 22  GDWGYKLSVLMDKSIVEQLETERESALEWARSKAKNPKRVSVKPEPWEELENQPGTYQVR 81

Query: 81  GVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCW 140
              +DGD                              P++VD +   ++D     Y G  
Sbjct: 82  FSWKDGDKVF---------------------------PVVVDTEGTAITDKDTPIYSGST 114

Query: 141 VIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSV 200
           V        Y L P    G S     +Q        G              E  D   + 
Sbjct: 115 VKVAFFQKPYVL-PTGDIGTSLKAKAIQLISLKSGAG----VVDDGDMSADEAVDLFGTS 169

Query: 201 SNFASAEVDSDAL 213
             F  +E +  A 
Sbjct: 170 KGFKVSEPNVSAE 182


>gi|310005802|gb|ADP00188.1| ssDNA binding protein [Cyanophage NATL2A-133]
          Length = 190

 Score = 71.8 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 51/193 (26%), Gaps = 39/193 (20%)

Query: 28  SVEHYGCDIVFPKADTKQINA-----VEACLKTAVTEIFPNVSPDAFLS--AVRSKSESR 80
               Y   ++  K+  +Q+ A     +E     A      +V P+ +          + R
Sbjct: 22  GDWGYKLSVLMDKSIVEQLEAERESALEWARSKAKNPKRVSVKPEPWEELENQPGTYQVR 81

Query: 81  GVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCW 140
              +DGD                              P++VD +   ++D     Y G  
Sbjct: 82  FSWKDGDKVF---------------------------PVVVDTEGTAITDKDTPIYSGST 114

Query: 141 VIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSV 200
           V        Y L P    G S     +Q        G              E  D   + 
Sbjct: 115 VKVAFFQKPYVL-PTGDIGTSLKAKAIQLISLKSGAG----VVDDGDMSADEAVDLFGTS 169

Query: 201 SNFASAEVDSDAL 213
             F  +E +  A 
Sbjct: 170 KGFKVSEPNVSAE 182


>gi|68299735|ref|YP_249584.1| ssDNA-binding protein [Vibriophage VP4]
 gi|66473274|gb|AAY46283.1| ssDNA-binding protein [Vibriophage VP4]
          Length = 223

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 47/176 (26%), Gaps = 14/176 (7%)

Query: 5   TVKGRL-SYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           T  G + +YP +          G     Y   +  P    +    +   +  A  +    
Sbjct: 10  TPIGVVGAYPYIQRPDTQFNDRGE----YRIKLAVPSEKAQ---KLINLITEAHEKNLEA 62

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
           +  +      R K        D +  +  + K     +        + + K +   + D 
Sbjct: 63  LKKNPKYKGKRIKEGDMPFFEDDEGNVVFTFKMYASFKDKE-----TGEMKDLTLRVYDS 117

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           Q + + D       G     + ++ AY             L   Q  K  E  G  
Sbjct: 118 QGKRIED-VPAISGGSEGRVEFSLFAYPPSGAVGASVKLQLAKFQLLKLVEWTGGG 172


>gi|281416189|ref|YP_003347924.1| ssDNA-binding protein [Vibrio phage N4]
 gi|237701496|gb|ACR16489.1| ssDNA-binding protein [Vibrio phage N4]
          Length = 223

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 47/176 (26%), Gaps = 14/176 (7%)

Query: 5   TVKGRL-SYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           T  G + +YP +          G     Y   +  P    +    +   +  A  +    
Sbjct: 10  TPIGVVGAYPYIQRPDTQFNDRGE----YRIKLAVPSEKAQ---KLINLITEAHEKNLEA 62

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
           +  +      R K        D +  +  + K     +        + + K +   + D 
Sbjct: 63  LKKNPKYKGKRIKEGDMPFFEDDEGNVVFTFKMYASFKDKE-----TGEMKDLTLRVYDS 117

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           Q + + D       G     + ++ AY             L   Q  K  E  G  
Sbjct: 118 QGKRIED-VPAISGGSEGRVEFSLFAYPPSGAVGASVKLQLAKFQLLKLVEWTGGG 172


>gi|323512055|gb|ADX87516.1| single-stranded DNA-binding protein [Vibrio phage ICP3_2009_B]
 gi|323512104|gb|ADX87564.1| single-stranded DNA-binding protein [Vibrio phage ICP3_2009_A]
 gi|323512153|gb|ADX87612.1| single-stranded DNA-binding protein [Vibrio phage ICP3_2008_A]
 gi|323512201|gb|ADX87659.1| single-stranded DNA-binding protein [Vibrio phage ICP3_2007_A]
          Length = 223

 Score = 71.0 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 47/176 (26%), Gaps = 14/176 (7%)

Query: 5   TVKGRL-SYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           T  G + +YP +          G     Y   +  P    +    +   +  A  +    
Sbjct: 10  TPIGVVGAYPYIQRPDTQFNDRGE----YRIKLAVPSDKAQ---KLINLITEAHEKNLEA 62

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
           +  +      R K        D +  +  + K     +        + + K +   + D 
Sbjct: 63  LKKNPKYKGKRIKEGDMPFFEDDEGNVVFTFKMYASFKDKE-----TGEMKDLTLRVYDS 117

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           Q + + D       G     + ++ AY             L   Q  K  E  G  
Sbjct: 118 QGKRIED-VPAISGGSEGRVEFSLFAYPPSGAVGASVKLQLAKFQLLKLVEWTGGG 172


>gi|320158398|ref|YP_004190776.1| phage single-stranded DNA-binding protein [Vibrio vulnificus
           MO6-24/O]
 gi|319933710|gb|ADV88573.1| phage single-stranded DNA-binding protein, putative [Vibrio
           vulnificus MO6-24/O]
          Length = 221

 Score = 68.0 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 25/210 (11%), Positives = 53/210 (25%), Gaps = 39/210 (18%)

Query: 6   VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKAD---TKQINAVEACLKTAVTEIFP 62
             G   +P L+        +G     Y  D+V    D    + +  +E  L+        
Sbjct: 14  PVGIAQFPWLNKPDTHYDKNG----AYKTDLVVNPEDSDVKETVEKLEDILRDYWQNEKG 69

Query: 63  NVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVD 122
                                   D  +    K   + +    +     +    +P+  D
Sbjct: 70  GKGEMV------------------DVLMEKDGK--FFFRVKQSAFEYKGELVLPKPVFYD 109

Query: 123 RQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYK----------TKGFSCTLTGVQFFKH 172
            + + +       Y G  +   + +  Y                T G +     VQ    
Sbjct: 110 ARGRRMV-KEPAIYGGSEIALSVEVWPYSRTETVREGGKRVTIETHGLTLKPKAVQVISL 168

Query: 173 -DERWGASPKSDTSEFKDYGEEQDSDTSVS 201
             +    +P +D   F  +    + D   +
Sbjct: 169 AAKGEAGAPSADYYGFGAHDGGYEYDEDDA 198


>gi|167564990|ref|ZP_02357906.1| hypothetical protein BoklE_20740 [Burkholderia oklahomensis EO147]
          Length = 202

 Score = 67.6 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 67/210 (31%), Gaps = 27/210 (12%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T KG   Y  LD     +   G     + C I+                +         
Sbjct: 16  VTPKGVFQYAWLDKPDNSEYGKG----KFKCAILLE--------------QGVKENDDFA 57

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTY-TDSVYISAKNKYVQPLLVD 122
              +    A R K++++   +DG A   ++ +  N  +        I+AK+K  +P    
Sbjct: 58  KKLNELHKAARGKADAK-PAKDGSALADAAAEEGNDKKERLRGFWVITAKSK-QKPEQKA 115

Query: 123 RQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKH--DERWGASP 180
              +     +E    G +    +    Y+      KG +  L G++  +       G   
Sbjct: 116 ADGKTTL--KETAKSGDYGRMSVAAAEYDTGSN--KGVTLYLNGIKLLERRAQSDLGFED 171

Query: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDS 210
           +S+  E        D D S  +  S++   
Sbjct: 172 ESEDYEVDAGTPSLDEDESEGSGKSSDDQD 201


>gi|317487304|ref|ZP_07946099.1| hypothetical protein HMPREF0179_03462 [Bilophila wadsworthia 3_1_6]
 gi|316921494|gb|EFV42785.1| hypothetical protein HMPREF0179_03462 [Bilophila wadsworthia 3_1_6]
          Length = 229

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 30/209 (14%), Positives = 52/209 (24%), Gaps = 14/209 (6%)

Query: 5   TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQ-----INAVEACLKTAVTE 59
           T KG   +  L                +   +        +      + V+     A  E
Sbjct: 15  TPKGESLFAHLVNVDYGTEQYPDEKGSFNVTLALDADAAAKLDSLIAHEVDTARAEA-EE 73

Query: 60  IFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYIS--AKNKYVQ 117
            F  + P              G   + D +   + +        T + Y +        +
Sbjct: 74  KFDGLKPQTKKKFGSVNFNEVGP-EEYDREGNPTGRRLFRF--KTGAFYENRQGVKVQRK 130

Query: 118 PLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWG 177
             L D   QPV    E    G  +        Y ++     G S  L  VQ  + +    
Sbjct: 131 VPLFDSMQQPVKLSDEP-GNGSVIRVAFCCAPYFVEGQGMGGLSLYLNAVQIIRLNTS-- 187

Query: 178 ASPKSDTSEFKDYGEEQDSDTSVSNFASA 206
               +    F        S+    + AS 
Sbjct: 188 GERSASDYGFGAEEGGFTSEGMDDDVAST 216


>gi|39935593|ref|NP_947869.1| DNA-dependent RNA polymerase [Rhodopseudomonas palustris CGA009]
 gi|39649446|emb|CAE27968.1| possible DNA-dependent RNA polymerase [Rhodopseudomonas palustris
           CGA009]
          Length = 540

 Score = 64.9 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 54/192 (28%), Gaps = 39/192 (20%)

Query: 10  LSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
            +YP L                Y  +    +  T+     +  ++    + FP       
Sbjct: 365 FAYPKLSEPDTKGEYADG---KYKTEGTATEDYTE---RFQEEIQKVADDNFPGKK---- 414

Query: 70  LSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVS 129
                                   +    + +T    +    KN   +P+L D + +P+ 
Sbjct: 415 ------------------------NVHLPWKETKEGDIAFIFKNPKKKPILTDSRGKPLK 450

Query: 130 DPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP--KSDTSEF 187
           +   V   G  +     I A+E      +G S     V+  K  E + A+    +    F
Sbjct: 451 E-GTVIRGGSKIRIAGVIAAWEKGAK--RGVSLWPDAVRVIKLSEGFDANAAFGAAEDGF 507

Query: 188 KDYGEEQDSDTS 199
                E  +  +
Sbjct: 508 NADDYEPTNFGN 519


>gi|152990204|ref|YP_001355926.1| hypothetical protein NIS_0455 [Nitratiruptor sp. SB155-2]
 gi|151422065|dbj|BAF69569.1| phage-related protein [Nitratiruptor sp. SB155-2]
          Length = 201

 Score = 62.2 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 65/211 (30%), Gaps = 26/211 (12%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T +G+L +  +  + R    + +    Y   +V P    +  + +       + + + +
Sbjct: 10  ITPRGKLRWVFVTGQGRP---NLNGENQYQAVLVLPDGSKEADDLI-----AQIEQFWED 61

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
             P            +    +DG+ +              T + +     K V+  + D 
Sbjct: 62  NKPKNARDPKSMGYRTN---KDGEIE----------FNFKTSTTFPDGTAKKVK--IFDS 106

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
           +A  V+        G        +  Y+  P   KG +  L  +Q  K+ E  G+S    
Sbjct: 107 RAVEVT-RELKIGNGSEGRISGMMAIYDNGPN--KGVTLYLNSIQLLKYKEYDGSSAAGF 163

Query: 184 TSEFKDYGEEQDSDTSVSNFASAEVDSDALP 214
                      D     S   +   D +  P
Sbjct: 164 EPVEDGGFTADDVPFDTSIEPAIAGDYEPQP 194


>gi|320540948|ref|ZP_08040430.1| putative conserved hypothetical protein [Serratia symbiotica str.
           Tucson]
 gi|320028989|gb|EFW11186.1| putative conserved hypothetical protein [Serratia symbiotica str.
           Tucson]
          Length = 85

 Score = 61.4 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 33/72 (45%), Gaps = 2/72 (2%)

Query: 131 PREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDY 190
                Y GC+V   ++I  + +D    K  + +L GVQ+++  + +     +   +F D 
Sbjct: 1   ADGKPYAGCYVNTNIDI--WAMDNNFGKRINASLGGVQYYRDGDAFAGGGVAIEDDFYDV 58

Query: 191 GEEQDSDTSVSN 202
            +  D ++ +S 
Sbjct: 59  SKGADVESLISP 70


>gi|320540887|ref|ZP_08040403.1| putative conserved hypothetical protein [Serratia symbiotica str.
           Tucson]
 gi|320029050|gb|EFW11213.1| putative conserved hypothetical protein [Serratia symbiotica str.
           Tucson]
          Length = 107

 Score = 61.0 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 43/101 (42%), Gaps = 13/101 (12%)

Query: 29  VEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDA 88
           V  Y    +FP  D   +  + A +     E +   + +  +S    ++  +  L +GD 
Sbjct: 19  VPRYSTAFIFPP-DYPCVKGITAAIAQVAKEKWGQKADNILMS---LRTGLKVCLHNGDE 74

Query: 89  KIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVS 129
           K   +         Y  S+++SA +K  +PL++DR    ++
Sbjct: 75  KAEYAG--------YPGSMFVSA-SKKARPLVIDRCRVALT 106


>gi|315518936|dbj|BAJ51813.1| putative ssDNA binding protein [Ralstonia phage RSB2]
          Length = 229

 Score = 57.9 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/202 (12%), Positives = 48/202 (23%), Gaps = 16/202 (7%)

Query: 9   RLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAV-TEIFPNVSPD 67
              +  +        P+G     +   +  PK   + +    A    A   E+      D
Sbjct: 21  VFGFVNITKPDTKYKPEGE----FKIRVKVPKEAAQDLYESLAQQAEAKLAEVVKRAKTD 76

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYIS----AKNKYVQPLLVDR 123
           A   A       +    D               ++    +        +       +   
Sbjct: 77  AKFKATLKGKAPKAA--DLPFYEDDEGNYVFTFKSKASFISKKPGSEGETINRTIPVWQG 134

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSD 183
             +   +    F  G  V        +        G +  L  V+  K  E  G      
Sbjct: 135 NKRLRPEDIPKFGEGSTVKVSFVAADF-FTAAVGAGITLRLEAVKLIKAVEYTGGG---- 189

Query: 184 TSEFKDYGEEQDSDTSVSNFAS 205
           ++ F D   E D   S +   +
Sbjct: 190 SNPFGDEDGESDYQESEAPGNA 211


>gi|134288572|ref|YP_001110811.1| hypothetical protein SPSV3_gp11 [Salmonella phage SETP3]
 gi|125631937|gb|ABN47340.1| hypothetical protein [Salmonella phage SETP3]
          Length = 208

 Score = 54.5 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 55/186 (29%), Gaps = 24/186 (12%)

Query: 13  PALDTKVRMKLPDGSS----VEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDA 68
             L+   R K  + S        Y    +       QI  +   +   V+E     + + 
Sbjct: 13  AWLNVFERAKDRENSDGSITKGTYNGTFILTPEHP-QIEELRDTVFAVVSEALGEAAAEK 71

Query: 69  FLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPV 128
           ++     + +      D  A    + +   +        +  AKNK    +L   + +  
Sbjct: 72  WMKQNYGEGKHM----DKCAVRDIAERDNPFEDFPEGFYF-QAKNKQQPLILTSVKGEKQ 126

Query: 129 SDPREVF----------YPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGA 178
            +P              Y GC     + I        + K     L G++F    + +G 
Sbjct: 127 VEPDFNIDGEQIEGKQVYSGCVANISIEIWF----SEQYKVLGAKLNGIKFAGEGKAFGG 182

Query: 179 SPKSDT 184
           S  S +
Sbjct: 183 SAVSAS 188


>gi|316934321|ref|YP_004109303.1| hypothetical protein Rpdx1_2989 [Rhodopseudomonas palustris DX-1]
 gi|315602035|gb|ADU44570.1| hypothetical protein Rpdx1_2989 [Rhodopseudomonas palustris DX-1]
          Length = 193

 Score = 53.7 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/198 (14%), Positives = 49/198 (24%), Gaps = 39/198 (19%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T      YP L                Y                 E       TE F  
Sbjct: 12  VTEIITARYPKLSEPDTKGAYADG---KYKT---------------EGTATEDYTERFQE 53

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDR 123
                       K                      + +T    +    K+   +P+L D 
Sbjct: 54  EIQKVADGNFPGKKNVHLP----------------WKETKEGDIAFIFKSPKKKPILTDS 97

Query: 124 QAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP--K 181
           + +P+ +   V   G  +     I A+E      +G S     V+  K  E + A+    
Sbjct: 98  RGKPLKE-GTVIRGGSKIRIAGVIAAWEKGAK--RGVSLWPDAVRVIKLSEGFDANAAFG 154

Query: 182 SDTSEFKDYGEEQDSDTS 199
           +    F     E  +  +
Sbjct: 155 AAEDGFDADDYEPTNFGN 172


>gi|317500272|ref|ZP_07958499.1| hypothetical protein HMPREF1026_00442 [Lachnospiraceae bacterium
          8_1_57FAA]
 gi|331087495|ref|ZP_08336431.1| hypothetical protein HMPREF1025_00014 [Lachnospiraceae bacterium
          3_1_46FAA]
 gi|316898315|gb|EFV20359.1| hypothetical protein HMPREF1026_00442 [Lachnospiraceae bacterium
          8_1_57FAA]
 gi|330410475|gb|EGG89906.1| hypothetical protein HMPREF1025_00014 [Lachnospiraceae bacterium
          3_1_46FAA]
          Length = 69

 Score = 53.7 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 4/55 (7%)

Query: 6  VKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
          +  +LSY      V +        E Y   ++ PK DT+ +NAV   +  A+ E 
Sbjct: 13 INTKLSYFHGWEPVSI----NGGAEKYSVSVLIPKDDTETVNAVNKAIDAAIEEG 63


>gi|282534223|gb|ADA82331.1| hypothetical protein [Escherichia phage K1H]
          Length = 208

 Score = 52.2 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 58/179 (32%), Gaps = 22/179 (12%)

Query: 17  TKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSK 76
            K R       +   Y   I+ P +D  QI+A+   +   V E     + + ++ +   +
Sbjct: 21  EKDRENDDGSITKGQYSATIILP-SDHAQIDALYDTVYAVVEEALGAAAAEKWMKSNYGE 79

Query: 77  SESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ-AQPVSDPR--- 132
            +      D  A    + +   +        + +   K  QPL+V  +  +   +     
Sbjct: 80  GKHM----DKCAIKDIAERDNPFEDFPEGFYFKAKAQK--QPLIVTSKKGETQVEQDFNV 133

Query: 133 -------EVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
                  E  Y GC     + I        K K     L  +++    + +G S  + +
Sbjct: 134 DGEQIEGEQVYSGCVANVSVEIWF----SQKYKVLGVNLLAIKYIGEGKAFGGSKVAAS 188


>gi|282533172|gb|ADA82281.1| hypothetical protein [Escherichia phage K1G]
          Length = 208

 Score = 52.2 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 58/179 (32%), Gaps = 22/179 (12%)

Query: 17  TKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSK 76
            K R       +   Y   I+ P +D  QI+A+   +   V E     + + ++ +   +
Sbjct: 21  EKDRENDDGSITKGQYSATIILP-SDHAQIDALYDTVYAVVEEALGAAAAEKWMKSNYGE 79

Query: 77  SESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ-AQPVSDPR--- 132
            +      D  A    + +   +        + +   K  QPL+V  +  +   +     
Sbjct: 80  GKHM----DKCAIKDIAERDNPFEDFPEGFYFKAKAQK--QPLIVTSKKGETQVEQDFNV 133

Query: 133 -------EVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
                  E  Y GC     + I        K K     L  +++    + +G S  + +
Sbjct: 134 DGEQIEGEQVYSGCVANVSVEIWF----SQKYKVLGVNLLAIKYVGEGKAFGGSKVAAS 188


>gi|282535273|gb|ADA82479.1| hypothetical protein [Escherichia phage K1ind3]
 gi|282547374|gb|ADA82430.1| hypothetical protein [Escherichia phage K1ind2]
          Length = 208

 Score = 52.2 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 58/179 (32%), Gaps = 22/179 (12%)

Query: 17  TKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSK 76
            K R       +   Y   I+ P +D  QI+A+   +   V E     + + ++ +   +
Sbjct: 21  EKDRENDDGSITKGQYSATIILP-SDHAQIDALYDTVYAVVEEALGAAAAEKWMKSNYGE 79

Query: 77  SESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ-AQPVSDPR--- 132
            +      D  A    + +   +        + +   K  QPL+V  +  +   +     
Sbjct: 80  GKHM----DKCAIKDIAERDNPFEDFPEGFYFKAKAQK--QPLIVTSKKGETQVEQDFNV 133

Query: 133 -------EVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
                  E  Y GC     + I        K K     L  +++    + +G S  + +
Sbjct: 134 DGEQIEGEQVYSGCVANVSVEIWF----SQKYKVLGVNLLAIKYVGEGKAFGGSKVAAS 188


>gi|169823576|ref|YP_001691079.1| hypothetical protein FMG_P0062 [Finegoldia magna ATCC 29328]
 gi|167832196|dbj|BAG09111.1| hypothetical protein [Finegoldia magna ATCC 29328]
          Length = 231

 Score = 49.1 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 19/159 (11%), Positives = 41/159 (25%), Gaps = 15/159 (9%)

Query: 8   GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPD 67
             L YP L+        +    E     ++ P  D   +N +      A           
Sbjct: 57  VVLLYPNLNIS----NYNPDVDEGLSTLVLIP-NDKDIVNEINKAYLNAFDYGIKKGIYP 111

Query: 68  AFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTD--------SVYISAKNKYVQPL 119
              +    K ++   L   D     +++ ++  +                   ++  +  
Sbjct: 112 KNTTMDMIKKKTNESLF-IDVNSFVANQKDDNKEFCQSLAQNKLMIRNVKVGNDETGKLS 170

Query: 120 LVDRQAQ-PVSDPREVFYPGCWVIAKLNIGAYELDPYKT 157
           +V R  +  + DP E    G      +    Y       
Sbjct: 171 VVLRDKEGKLLDPNERISSGDTGEIVIKFYPYSHKGKVG 209


>gi|316933244|ref|YP_004108226.1| hypothetical protein Rpdx1_1881 [Rhodopseudomonas palustris DX-1]
 gi|315600958|gb|ADU43493.1| hypothetical protein Rpdx1_1881 [Rhodopseudomonas palustris DX-1]
          Length = 163

 Score = 45.6 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 28/91 (30%), Gaps = 3/91 (3%)

Query: 98  NYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKT 157
            + +T    +  + K+    P L+D +  P+         G  +     +  +       
Sbjct: 72  PWRKTKEGVITFNFKSPKKTPQLMDSRGTPL-PQGITIRDGSLIRIAGVMACW--QKGAI 128

Query: 158 KGFSCTLTGVQFFKHDERWGASPKSDTSEFK 188
            G S     V+  K  E + AS      +  
Sbjct: 129 CGVSLWPDAVRVIKLVEGFDASKSFGPPDEG 159


>gi|62327349|ref|YP_224062.1| hypothetical protein BPKS7gp40 [Salmonella phage SS3e]
 gi|57472383|gb|AAW51245.1| hypothetical protein [Salmonella phage SS3e]
          Length = 126

 Score = 42.5 bits (98), Expect = 0.043,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 35/110 (31%), Gaps = 15/110 (13%)

Query: 85  DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPR----------EV 134
           D  A    + +   +        +  AKNK    +L   + +   +P           E 
Sbjct: 2   DKCAVRDIAERDNPFEDFPEGFYF-QAKNKQQPLILTSVKGEKQVEPDFNIDGEQIEGEQ 60

Query: 135 FYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            Y GC     + I        + K     L G++F    + +G S  S +
Sbjct: 61  VYSGCVANISIEIWF----SEQYKVLGAKLNGIKFAGEGKAFGGSAVSAS 106


>gi|296284184|ref|ZP_06862182.1| WalW protein [Citromicrobium bathyomarinum JL354]
          Length = 326

 Score = 42.2 bits (97), Expect = 0.045,   Method: Composition-based stats.
 Identities = 20/140 (14%), Positives = 42/140 (30%), Gaps = 6/140 (4%)

Query: 53  LKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAK 112
           L+ A+ E F                 ++ +L D   ++ +S +            Y   +
Sbjct: 128 LRDAIEEGFGTAPISYRAGRYGLGPSTKAILHDTGIRVDTSVRALFDYSEQDGPNY---E 184

Query: 113 NKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCT---LTGVQF 169
           +    P  V R+ + +  P    Y G    +   +        +  G +     L  V+ 
Sbjct: 185 DFPNHPYWVSREPELLELPVTSVYRGALRRSGATLFPKLTRLPRGAGIASRTGLLERVRL 244

Query: 170 FKHDERWGASPKSDTSEFKD 189
                  GA+ K+  +    
Sbjct: 245 TPEGTPLGAAKKAVDAALDA 264


>gi|83311818|ref|YP_422082.1| hypothetical protein amb2719 [Magnetospirillum magneticum AMB-1]
 gi|82946659|dbj|BAE51523.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 101

 Score = 41.0 bits (94), Expect = 0.10,   Method: Composition-based stats.
 Identities = 13/91 (14%), Positives = 34/91 (37%), Gaps = 7/91 (7%)

Query: 5  TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
          T   R ++             G + + +G   + P      +  V+A +  A T+++ + 
Sbjct: 13 TPLVRAAFFRGVEPEVRTNDKGVTEKTWGLTAIAP--AGSDLTGVKAAIVEAATKMWGST 70

Query: 65 SPDAFLSAVRSKSESRGVLRDGDAKIASSHK 95
          + D          + +  L+DG  ++  + +
Sbjct: 71 AGDKLKH-----PKFKSPLKDGATQVDKAAR 96


>gi|70944707|ref|XP_742256.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 gi|56521130|emb|CAH74309.1| hypothetical protein PC000031.00.0 [Plasmodium chabaudi chabaudi]
          Length = 867

 Score = 40.2 bits (92), Expect = 0.19,   Method: Composition-based stats.
 Identities = 14/124 (11%), Positives = 37/124 (29%), Gaps = 14/124 (11%)

Query: 2   QKLTVKGRLSY---PALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQ--------INAVE 50
             + +K + SY     L+             + Y  ++   K   K            ++
Sbjct: 272 AHIFLKSKFSYYSFVKLN--YNSFSGLTVDQKKYSTNVFVKKEKQKNAKGAQKAKGKKIK 329

Query: 51  ACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYIS 110
             ++  + +     +  A  +     S  +  ++ G  +   + K  +  +      Y  
Sbjct: 330 NIIRQILEKSKGETAEIAKDADKTIASIEKKKMQYG-KQWKRNEKGNDKRKGKKGHNYQK 388

Query: 111 AKNK 114
            +NK
Sbjct: 389 GQNK 392


>gi|148243097|ref|YP_001228254.1| hypothetical protein SynRCC307_1998 [Synechococcus sp. RCC307]
 gi|147851407|emb|CAK28901.1| Hypothetical protein SynRCC307_1998 [Synechococcus sp. RCC307]
          Length = 174

 Score = 39.5 bits (90), Expect = 0.30,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 21/75 (28%), Gaps = 1/75 (1%)

Query: 96  PENYTQTYTDSVYISAKNKY-VQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDP 154
           P  +T        I+ +      P  +D   QPV            V   +    Y    
Sbjct: 58  PTPWTPHDEQCHAIALQWSDATGPHRLDSDCQPVMGDEVAAQSAELVRLAMLQKPYLQQD 117

Query: 155 YKTKGFSCTLTGVQF 169
               G    L G+Q+
Sbjct: 118 GMGCGTVLRLIGIQY 132


>gi|307105815|gb|EFN54063.1| hypothetical protein CHLNCDRAFT_58393 [Chlorella variabilis]
          Length = 398

 Score = 39.5 bits (90), Expect = 0.31,   Method: Composition-based stats.
 Identities = 15/121 (12%), Positives = 35/121 (28%), Gaps = 7/121 (5%)

Query: 31  HYGCD-IVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAK 89
            Y     +  K +   + +  A   TA   +F       + +      ++  +L+ G+  
Sbjct: 72  RYKESAFLVSKGEKHTLGSYAAAQSTATLHVFDGGDVADYRNGKPQFYKAMVMLKCGEGS 131

Query: 90  IASSHKPENY--TQTYTDSVYISAKNK----YVQPLLVDRQAQPVSDPREVFYPGCWVIA 143
                   +      Y  +   + +         P  VD   +P+ +   V Y       
Sbjct: 132 EGDELVSVSSSLEDEYKHTYVFNIRTSRVCPDQPPCPVDVDVEPIPEGDYVIYKPSLQRL 191

Query: 144 K 144
           +
Sbjct: 192 R 192


>gi|154332462|ref|XP_001562605.1| cation-transporting ATPase [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134059495|emb|CAM41723.1| putative cation-transporting ATPase [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 1243

 Score = 39.1 bits (89), Expect = 0.42,   Method: Composition-based stats.
 Identities = 31/212 (14%), Positives = 59/212 (27%), Gaps = 16/212 (7%)

Query: 7   KGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSP 66
           K  L +P L T  RM     +    Y    +  K   + I A+   +     +I    + 
Sbjct: 600 KVLLRFPFLATLRRMACVVSAPDGKY----IVAKGSPESIAALCESVPANCLKI----AE 651

Query: 67  DAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQ 126
           +      R  + +   L D +     + +           +  +    YV PL  D +  
Sbjct: 652 ETAAKGYRVIALAYRPLTDAERASKDTIRALRRDDVEEG-LRFAGLAVYVCPLKKDAK-- 708

Query: 127 PVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSE 186
              +  E    G      +   + +      K  S  L   Q    ++  G   +   S 
Sbjct: 709 ---ETIENLTGGSHRCVIITGDSVQTAISVGKDVSMLLCKRQLVAKEKETGGGVEWADSV 765

Query: 187 FKDYGEEQDSDTSVSNFASA--EVDSDALPWN 216
                     D   + F  +  +       W+
Sbjct: 766 SGAVQSGTAKDILTNTFQRSRRKRTPHEDEWD 797


>gi|45188010|ref|NP_984233.1| ADR137Wp [Ashbya gossypii ATCC 10895]
 gi|74694229|sp|Q759Y6|RNA14_ASHGO RecName: Full=mRNA 3'-end-processing protein RNA14
 gi|44982827|gb|AAS52057.1| ADR137Wp [Ashbya gossypii ATCC 10895]
          Length = 661

 Score = 39.1 bits (89), Expect = 0.47,   Method: Composition-based stats.
 Identities = 21/157 (13%), Positives = 49/157 (31%), Gaps = 15/157 (9%)

Query: 4   LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPN 63
           +T   R+    L+  ++    +G+ +  Y   ++  K D +  +  E+C+          
Sbjct: 464 VTTPCRV----LEFGLKYFQDNGNYINKYLDFLILVKQDAQIKSLFESCIDKIYNLDQLK 519

Query: 64  VSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLL 120
                 ++           + + + +           + +TD   +  +N   +   P L
Sbjct: 520 EIYKKVINYESKFGNLN-NVYELERRFFEKFPEAEKIEVFTDRYQLQGENLLKRLEFPYL 578

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKT 157
           +D    PV         G  V   L+      D   +
Sbjct: 579 MDEYGIPVL-------SGYAVKRSLHSAGIVFDDNGS 608


>gi|313836333|gb|EFS74047.1| conserved domain protein [Propionibacterium acnes HL037PA2]
 gi|314928797|gb|EFS92628.1| conserved domain protein [Propionibacterium acnes HL044PA1]
 gi|314971167|gb|EFT15265.1| conserved domain protein [Propionibacterium acnes HL037PA3]
 gi|328906453|gb|EGG26228.1| phage-associated protein [Propionibacterium sp. P08]
          Length = 73

 Score = 37.9 bits (86), Expect = 0.93,   Method: Composition-based stats.
 Identities = 8/42 (19%), Positives = 15/42 (35%), Gaps = 4/42 (9%)

Query: 4  LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQ 45
          +T + RLSY  +     +          Y   ++ PK +   
Sbjct: 10 VTGEVRLSYTNIFEAKSI----QGGKPKYSVSVIIPKGERVT 47


>gi|39944058|ref|XP_361566.1| hypothetical protein MGG_04040 [Magnaporthe oryzae 70-15]
 gi|145014763|gb|EDJ99331.1| hypothetical protein MGG_04040 [Magnaporthe oryzae 70-15]
          Length = 1185

 Score = 37.9 bits (86), Expect = 0.96,   Method: Composition-based stats.
 Identities = 26/196 (13%), Positives = 47/196 (23%), Gaps = 38/196 (19%)

Query: 39  PKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPEN 98
            K   +        L  A+ E    +  +A    +  +      + D +    S  + + 
Sbjct: 102 SKTLGQTRQTKRQALSQALNEERAGLPGNATREELLYEKREERNVSDQEEDSESEAQAQP 161

Query: 99  YTQ---------TYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGA 149
                               +A +   +PL VD   +PV   R+    G      L    
Sbjct: 162 KPDVLVSSTTAPAADSKTTTAAGSGLKRPLEVDDDGRPVIQKRQKR-GGVKTKVSLAPKP 220

Query: 150 YELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTS---------- 199
                                   + WG    ++  +  D  E    +            
Sbjct: 221 PVESS-----------------DSDEWGGFSSAEDEQDGDNEELGTEEKPSEEEASEDES 263

Query: 200 -VSNFASAEVDSDALP 214
                 SA+ D   LP
Sbjct: 264 SEDGSDSADEDDGDLP 279


>gi|296811774|ref|XP_002846225.1| coatomer subunit alpha [Arthroderma otae CBS 113480]
 gi|238843613|gb|EEQ33275.1| coatomer subunit alpha [Arthroderma otae CBS 113480]
          Length = 1216

 Score = 37.5 bits (85), Expect = 1.3,   Method: Composition-based stats.
 Identities = 8/42 (19%), Positives = 18/42 (42%)

Query: 175 RWGASPKSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216
             G +   D + F+D   E++ D + +     + + D   W+
Sbjct: 839 EVGGADNEDANGFEDQDGERELDGAAAGLGDEQEEEDVAGWD 880


>gi|284006857|emb|CBA72123.1| conserved hypothetical phage protein [Arsenophonus nasoniae]
          Length = 51

 Score = 36.4 bits (82), Expect = 3.1,   Method: Composition-based stats.
 Identities = 13/61 (21%), Positives = 23/61 (37%), Gaps = 10/61 (16%)

Query: 56  AVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKY 115
            + E +     +   +++   +  R   RDGD K             Y  ++YI+A NK 
Sbjct: 1   MIGEKWGAKEVEKIYNSICHSNN-RFCFRDGDNKE---------YDGYAGNMYITASNKD 50

Query: 116 V 116
            
Sbjct: 51  R 51


>gi|84662670|ref|YP_453634.1| hypothetical protein OP2_ORF17 [Xanthomonas phage OP2]
 gi|84570719|dbj|BAE72781.1| conserved hypothetical protein [Xanthomonas oryzae phage OP2]
          Length = 210

 Score = 36.0 bits (81), Expect = 3.2,   Method: Composition-based stats.
 Identities = 11/41 (26%), Positives = 14/41 (34%)

Query: 135 FYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDER 175
            + G  V    +  AY        G S +L GV      ER
Sbjct: 119 LFAGQKVRVNAHGFAYPPKNGGPAGVSFSLDGVMAVGGGER 159


>gi|225575050|ref|ZP_03783660.1| hypothetical protein RUMHYD_03139 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037720|gb|EEG47966.1| hypothetical protein RUMHYD_03139 [Blautia hydrogenotrophica DSM
           10507]
          Length = 484

 Score = 35.6 bits (80), Expect = 4.7,   Method: Composition-based stats.
 Identities = 15/106 (14%), Positives = 29/106 (27%), Gaps = 10/106 (9%)

Query: 44  KQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTY 103
           K+ + ++  L     E   +  P       + + +      DG     +S   ++     
Sbjct: 29  KKADLIQKMLLEDEKEKIQSQEPGMKEEEGKQQQDEYVPSFDGQRSNENSRNLDHGRYGE 88

Query: 104 TDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGA 149
               Y +  N   +P L            EV   G      L +  
Sbjct: 89  GGRNYENGHNSERKPTL----------NNEVLDSGEKANGILEVLP 124


>gi|328697641|ref|XP_003240396.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells
           3-like isoform 2 [Acyrthosiphon pisum]
          Length = 854

 Score = 35.2 bits (79), Expect = 5.7,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 22/80 (27%), Gaps = 5/80 (6%)

Query: 29  VEHYGCDIV----FPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLR 84
            E Y   +       + D K  N +    K A    +    P    +  +S    +    
Sbjct: 517 KEKYKTKMKQVQETHEKDPKTENKIGTKEKEAKKRKWDEKEPTKTHNE-KSNGNFKVPYA 575

Query: 85  DGDAKIASSHKPENYTQTYT 104
             D K  S   P    +T  
Sbjct: 576 KNDNKQESESSPVKKFKTTE 595


>gi|328697639|ref|XP_001946245.2| PREDICTED: squamous cell carcinoma antigen recognized by T-cells
           3-like isoform 1 [Acyrthosiphon pisum]
          Length = 854

 Score = 35.2 bits (79), Expect = 5.7,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 22/80 (27%), Gaps = 5/80 (6%)

Query: 29  VEHYGCDIV----FPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLR 84
            E Y   +       + D K  N +    K A    +    P    +  +S    +    
Sbjct: 517 KEKYKTKMKQVQETHEKDPKTENKIGTKEKEAKKRKWDEKEPTKTHNE-KSNGNFKVPYA 575

Query: 85  DGDAKIASSHKPENYTQTYT 104
             D K  S   P    +T  
Sbjct: 576 KNDNKQESESSPVKKFKTTE 595


  Database: nr
    Posted date:  May 13, 2011  4:10 AM
  Number of letters in database: 999,999,932
  Number of sequences in database:  2,987,209
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 13, 2011  4:17 AM
  Number of letters in database: 999,998,956
  Number of sequences in database:  2,896,973
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 13, 2011  4:23 AM
  Number of letters in database: 999,999,979
  Number of sequences in database:  2,907,862
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 13, 2011  4:29 AM
  Number of letters in database: 999,999,513
  Number of sequences in database:  2,932,190
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 13, 2011  4:33 AM
  Number of letters in database: 792,586,372
  Number of sequences in database:  2,260,650
  
Lambda     K      H
   0.303    0.118    0.296 

Lambda     K      H
   0.267   0.0367    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,067,087,280
Number of Sequences: 13984884
Number of extensions: 22994709
Number of successful extensions: 125582
Number of sequences better than 10.0: 352
Number of HSP's better than 10.0 without gapping: 243
Number of HSP's successfully gapped in prelim test: 109
Number of HSP's that attempted gapping in prelim test: 124281
Number of HSP's gapped (non-prelim): 493
length of query: 216
length of database: 4,792,584,752
effective HSP length: 133
effective length of query: 83
effective length of database: 2,932,595,180
effective search space: 243405399940
effective search space used: 243405399940
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.5 bits)
S2: 78 (34.8 bits)