RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780126|ref|YP_003064539.1| hypothetical protein CLIBASIA_00025 [Candidatus Liberibacter asiaticus str. psy62] (216 letters) >gnl|CDD|39462 KOG4261, KOG4261, KOG4261, Talin [Cytoskeleton]. Length = 1003 Score = 28.5 bits (63), Expect = 1.4 Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Query: 174 ERWGASPKSDTSEFKDYGEEQDSDTSV 200 RW ASPKS T +F DY QD SV Sbjct: 355 RRWAASPKSFTLDFGDY---QDGYYSV 378 >gnl|CDD|144226 pfam00557, Peptidase_M24, Metallopeptidase family M24. This family contains metallopeptidases. It also contains non-peptidase homologues such as the N terminal domain of Spt16 which is a histone H3-H4 binding module. Length = 207 Score = 27.2 bits (61), Expect = 3.2 Identities = 16/63 (25%), Positives = 24/63 (38%), Gaps = 7/63 (11%) Query: 26 GSSVEHYGCDI----VFPKADTKQ---INAVEACLKTAVTEIFPNVSPDAFLSAVRSKSE 78 G+ + Y DI V K +Q AV + A+ + P V+ +A R E Sbjct: 82 GAEYDGYHSDITRTFVVGKPTPEQRELYEAVLEAQEAAIAAVKPGVTGGDVDAAAREVLE 141 Query: 79 SRG 81 G Sbjct: 142 EGG 144 >gnl|CDD|32037 COG1852, COG1852, Uncharacterized conserved protein [Function unknown]. Length = 209 Score = 27.2 bits (60), Expect = 3.7 Identities = 18/94 (19%), Positives = 27/94 (28%), Gaps = 24/94 (25%) Query: 100 TQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKG 159 + D + I KNK + + R + P C K +L P G Sbjct: 62 DEDLFDRIGIEVKNKAYE----KDFKKIPVGKRLLLLPHCLRNPKCE---AKLTP---TG 111 Query: 160 FSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEE 193 + C G K E K+ E+ Sbjct: 112 YECKKCG--------------KCVIGEIKEIAEK 131 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.130 0.386 Gapped Lambda K H 0.267 0.0697 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,442,268 Number of extensions: 115069 Number of successful extensions: 175 Number of sequences better than 10.0: 1 Number of HSP's gapped: 175 Number of HSP's successfully gapped: 8 Length of query: 216 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 126 Effective length of database: 4,318,927 Effective search space: 544184802 Effective search space used: 544184802 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 55 (25.0 bits)