RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780126|ref|YP_003064539.1| hypothetical protein CLIBASIA_00025 [Candidatus Liberibacter asiaticus str. psy62] (216 letters) >gnl|CDD|151438 pfam10991, DUF2815, Protein of unknown function (DUF2815). This is a phage related family of proteins with unknown function. Length = 181 Score = 95.5 bits (238), Expect = 1e-20 Identities = 51/193 (26%), Positives = 82/193 (42%), Gaps = 16/193 (8%) Query: 5 TVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64 T RLSY L + +G Y + PK+DT+ I A++A +K A E + Sbjct: 5 TGNVRLSYANLFE--PKSIENGQGEPKYSASFIIPKSDTETIKAIKAAIKAAAEEGW--- 59 Query: 65 SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQ 124 + + + LRDGD + + Y +I+A +K +PL+VDR Sbjct: 60 --GKKADGKKIPATLKTPLRDGDLERPFDDE------AYAGHYFINASSK-TRPLIVDRN 110 Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184 +P++ Y GC+ A +N AY + KG + L VQF + E G + Sbjct: 111 VRPLALDEGEVYSGCYANASINFYAY--NNNGNKGIAAGLNNVQFVRDGEPLGGGRVAAE 168 Query: 185 SEFKDYGEEQDSD 197 +F +E + D Sbjct: 169 DDFDALADEDEDD 181 >gnl|CDD|178544 PLN02959, PLN02959, aminoacyl-tRNA ligase. Length = 1084 Score = 27.7 bits (62), Expect = 2.3 Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Query: 27 SSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESR 80 ++ YG VFP+ D + AV A PD F +SK+ ++ Sbjct: 107 REIQQYGNPPVFPEEDEDEAAAVAA---AKAEAEAAAAPPDKF-KGKKSKAVAK 156 >gnl|CDD|179442 PRK02546, PRK02546, NAD(P)H-quinone oxidoreductase subunit 4; Provisional. Length = 525 Score = 27.4 bits (61), Expect = 2.8 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 6/31 (19%) Query: 120 LVDRQAQPVSDPREVFYPGCWVIAKLNIGAY 150 LVD ++PREVF C ++ + IG Y Sbjct: 457 LVD------AEPREVFIIACLLVPIIGIGLY 481 >gnl|CDD|152978 pfam12544, LAM_C, Lysine-2,3-aminomutase. This domain family is found in bacteria, archaea and eukaryotes, and is typically between 111 and 127 amino acids in length. The family is found in association with pfam04055. LAM catalyses the interconversion of L-alpha-lysine and L-beta-lysine, which proceeds by migration of the amino group from C2 to C3 concomitant with cross-migration of the 3-pro-R hydrogen of L-alpha-lysine to the 2-pro-R position of L-beta-lysine. Length = 127 Score = 27.0 bits (60), Expect = 4.0 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Query: 75 SKSESRGVLRDGDAKIASSHKPENYT----QTYTDSVYISAKNKY 115 S+S + VLR+ + I + +PENY Y +Y + KY Sbjct: 36 SQSPDKVVLRNFEGVITTYPEPENYVPGRADDYFAEIYPLYEKKY 80 >gnl|CDD|177932 PLN02295, PLN02295, glycerol kinase. Length = 512 Score = 26.2 bits (58), Expect = 6.0 Identities = 10/27 (37%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 77 SESRGVLRDGDAKIASSHKPENYTQTY 103 + +R ++ D DA+ +SH+ E +TQ Y Sbjct: 10 TSTRFIIYDRDARPVASHQVE-FTQIY 35 >gnl|CDD|184601 PRK14279, PRK14279, chaperone protein DnaJ; Provisional. Length = 392 Score = 25.8 bits (57), Expect = 8.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 4 LTVKGRLSYPALDTKVRMKLPDGSS 28 L + LS P LD V +K+P G++ Sbjct: 306 LALGSTLSVPTLDGPVGVKVPAGTA 330 >gnl|CDD|161913 TIGR00524, eIF-2B_rel, eIF-2B alpha/beta/delta-related uncharacterized proteins. This model, eIF-2B_rel, describes half of a superfamily, where the other half consists of eukaryotic translation initiation factor 2B (eIF-2B) subunits alpha, beta, and delta. It is unclear whether the eIF-2B_rel set is monophyletic, or whether they are all more closely related to each other than to any eIF-2B subunit because the eIF-2B clade is highly derived. Members of this branch of the family are all uncharacterized with respect to function and are found in the Archaea, Bacteria, and Eukarya, although a number are described as putative translation intiation factor components. Proteins found by eIF-2B_rel include at least three clades, including a set of uncharacterized eukaryotic proteins, a set found in some but not all Archaea, and a set universal so far among the Archaea and closely related to several uncharacterized bacterial proteins. Length = 303 Score = 25.9 bits (57), Expect = 9.1 Identities = 9/21 (42%), Positives = 10/21 (47%) Query: 130 DPREVFYPGCWVIAKLNIGAY 150 DP EV G IA L + Y Sbjct: 259 DPEEVAQVGGVRIAPLGVKVY 279 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.130 0.386 Gapped Lambda K H 0.267 0.0665 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,322,147 Number of extensions: 190197 Number of successful extensions: 263 Number of sequences better than 10.0: 1 Number of HSP's gapped: 261 Number of HSP's successfully gapped: 9 Length of query: 216 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 127 Effective length of database: 4,071,361 Effective search space: 517062847 Effective search space used: 517062847 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 55 (25.1 bits)