RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780126|ref|YP_003064539.1| hypothetical protein
CLIBASIA_00025 [Candidatus Liberibacter asiaticus str. psy62]
         (216 letters)



>1uf2_K Structural protein P7; virus components, icosahedral virus;
           3.50A {Rice dwarf virus} (K:)
          Length = 506

 Score = 28.8 bits (64), Expect = 0.62
 Identities = 24/111 (21%), Positives = 38/111 (34%), Gaps = 14/111 (12%)

Query: 47  NAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRG-----VLRDGDAKIA-SSHKPENYT 100
            AV ACL T + E+F   S      A+  + ++ G     VL  G      SS  P  + 
Sbjct: 227 PAVAACLNTPIKELFSMGSGKREPLALEFRKDNEGQCIGIVLPKGHEGDTLSSRYPAVFI 286

Query: 101 QTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYE 151
                  +   +   +  L         SD  E  Y    +   ++ G+Y 
Sbjct: 287 N--ESEPFSDKERSELSELKRTD-----SDAYEKLYSET-ISKHVSDGSYG 329


>1mix_A Talin; focal adhesion, integrin binding, FERM domain,
           cytoskeleton, structural protein; 1.75A {Gallus gallus}
           (A:162-206)
          Length = 45

 Score = 28.6 bits (64), Expect = 0.68
 Identities = 11/19 (57%), Positives = 13/19 (68%)

Query: 175 RWGASPKSDTSEFKDYGEE 193
           RW ASPKS T +F DY + 
Sbjct: 3   RWAASPKSFTLDFGDYQDG 21


>1h2i_A RAD52, DNA repair protein RAD52 homolog; DNA-binding
          protein, DNA recombination; HET: DNA; 2.7A {Homo
          sapiens} (A:68-162)
          Length = 95

 Score = 26.6 bits (59), Expect = 2.9
 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 10/59 (16%)

Query: 17 TKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRS 75
            VR++L DGS  E  G  +   +    +  ++E   K AVT        D    A+RS
Sbjct: 42 AFVRVQLKDGSYHEDVGYGVS--EGLKSKALSLEKARKEAVT--------DGLKRALRS 90


>1v9n_A Malate dehydrogenase; riken structural genomics/proteomics
           initiative, RSGI, structural genomics, oxidoreductase;
           HET: NDP; 2.10A {Pyrococcus horikoshii OT3} (A:74-316)
          Length = 243

 Score = 25.1 bits (55), Expect = 7.7
 Identities = 13/72 (18%), Positives = 24/72 (33%), Gaps = 13/72 (18%)

Query: 118 PLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGF---------SCTLTGVQ 168
              ++R+    +   EVF  G      L +G +       KG+         S  L+G  
Sbjct: 135 GWAINREGNITTKVEEVFNGGAL----LPLGGFGELLGGHKGYGLSLXVDILSGILSGGT 190

Query: 169 FFKHDERWGASP 180
           + K+ +      
Sbjct: 191 WSKYVKNTSEKG 202


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.314    0.130    0.386 

Gapped
Lambda     K      H
   0.267   0.0570    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 1,530,690
Number of extensions: 61650
Number of successful extensions: 94
Number of sequences better than 10.0: 1
Number of HSP's gapped: 94
Number of HSP's successfully gapped: 8
Length of query: 216
Length of database: 4,956,049
Length adjustment: 85
Effective length of query: 131
Effective length of database: 2,082,624
Effective search space: 272823744
Effective search space used: 272823744
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 53 (24.5 bits)