HHsearch alignment for GI: 254780127 and conserved domain: KOG1798

>KOG1798 consensus.
Probab=97.38  E-value=0.0059  Score=37.72  Aligned_cols=149  Identities=21%  Similarity=0.251  Sum_probs=80.9

Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEECCCEEEEE--------EC-----CCC--------------C-HH
Q ss_conf             78999804067887000460000268829999999838228999--------78-----884--------------2-21
Q gi|254780127|r    2 SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLW--------DR-----TEQ--------------S-AM   53 (675)
Q Consensus         2 k~l~lD~ET~s~~dl~~~Gl~~y~~~~~I~~i~~a~~~~~~~~~--------d~-----~~~--------------~-~~   53 (675)
T Consensus       247 ~VlAFDIETt-KlPLKF----PDae~DqIMMISYMiDG-qGfLItNREiVs~DIedfEYTPKpE~eG~F~v~Ne~dEv~L  320 (2173)
T KOG1798         247 RVLAFDIETT-KLPLKF----PDAESDQIMMISYMIDG-QGFLITNREIVSEDIEDFEYTPKPEYEGPFCVFNEPDEVGL  320 (2173)
T ss_pred             EEEEEEEECC-CCCCCC----CCCCCCEEEEEEEEECC-CEEEEECHHHHCCCHHHCCCCCCCCCCCCEEEECCCCHHHH
T ss_conf             5899851035-578779----98665607899999647-46899622343052122236886325254588668768899


Q ss_pred             HHHHHHHHC--CCCCEEEEEE-HHHHHHHHHH---HCCCCCCC-CCE------------EEHHHH-HHHH-C--C---CC
Q ss_conf             799999864--8898199863-0775999998---62998786-504------------545889-9985-8--8---99
Q gi|254780127|r   54 PSDLLQYLR--DETVMCVAHN-SLFERILFKK---TLGIDIPS-KRW------------ICTSVL-ARTN-G--L---PS  107 (675)
Q Consensus        54 ~~~l~~~L~--~~~~~kv~HN-a~FD~~vL~~---~lGi~i~~-~~~------------~DTmi~-A~~l-~--~---p~  107 (675)
T Consensus       321 l~RfFeHiq~~kP~ii-vTyNGDFFDWPFve~Ra~~hGi~m~eEiGF~~D~~gEyks~~c~HmDcfrWVKRDSYLPqGSq  399 (2173)
T KOG1798         321 LQRFFEHIQEVKPTII-VTYNGDFFDWPFVEARAKIHGISMNEEIGFRRDSQGEYKSPFCIHMDCFRWVKRDSYLPQGSQ  399 (2173)
T ss_pred             HHHHHHHHHHCCCCEE-EEECCCCCCCHHHHHHHHHCCCCCCHHCCCEECCCCCCCCCCEEEHHHHHHHHHCCCCCCCCC
T ss_conf             9999999986189679-973686446666677887507771121085206533312563211266666520465777663


Q ss_pred             CHHHHHH-HHCCCCCCHHHHHCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9789999-808898652766376576641002332013453112587689998988775399999999872
Q gi|254780127|r  108 SLKNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL  177 (675)
Q Consensus       108 sL~~la~-~lgl~~~~~kd~~gk~li~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ya~~Dv~~~~~L~~~L  177 (675)
T Consensus       400 gLKAVTkaKLGYdPvEv-dPE--dM~~~A-----------------~EkPQ~lasYSVSDAVATYyLYMkY  450 (2173)
T KOG1798         400 GLKAVTKAKLGYDPVEV-DPE--DMVRMA-----------------MEKPQTLASYSVSDAVATYYLYMKY  450 (2173)
T ss_pred             CHHHHHHHHHCCCCCCC-CHH--HHHHHH-----------------HHCCHHHHHCCHHHHHHHHHHHHHH
T ss_conf             12688887507894437-988--854666-----------------5082565300057778888898987