HHsearch alignment for GI: 254780127 and conserved domain: PRK07247

>PRK07247 DNA polymerase III subunit epsilon; Validated.
Probab=98.52  E-value=4.2e-06  Score=58.57  Aligned_cols=83  Identities=10%  Similarity=0.142  Sum_probs=53.7

Q ss_pred             HHHHHCCCCCEEEEEEH-HHHHHHHHHH---CCCCCCCCCEEEHHHHHHHHC----CCCCHHHHHHHHCCCCCCHHHHHC
Q ss_conf             99986488981998630-7759999986---299878650454588999858----899978999980889865276637
Q gi|254780127|r   57 LLQYLRDETVMCVAHNS-LFERILFKKT---LGIDIPSKRWICTSVLARTNG----LPSSLKNACLALNFSEHLTKMEEG  128 (675)
Q Consensus        57 l~~~L~~~~~~kv~HNa-~FD~~vL~~~---lGi~i~~~~~~DTmi~A~~l~----~p~sL~~la~~lgl~~~~~kd~~g  128 (675)
T Consensus        78 f~~Fi--gd~~lVaHNa~~FD~~fL~~~~~~~~~~~~-~~~~~~~~~~r~~~~p~l~n~kL~tLa~~f~I~~~-------  147 (195)
T PRK07247         78 FKNFV--GELPLIGYNAQKSDLPILAENGLDLRDQYQ-VDLFDEAFDRRSSDLNGIANLKLQTVATFLGIKGR-------  147 (195)
T ss_pred             HHHHH--CCCEEEEECCCHHHHHHHHHHHHHHCCCCC-CCHHHHHHHHHHHCCCCCCCCCHHHHHHHCCCCCC-------
T ss_conf             99996--899189908845149999998774157766-85699999998860588767778999997499998-------


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             6576641002332013453112587689998988775399999999872002
Q gi|254780127|r  129 KALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL  180 (675)
Q Consensus       129 k~li~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ya~~Dv~~~~~L~~~L~~~  180 (675)
T Consensus       148 -------------------------------~HRAl~DA~aTa~If~klLe~  168 (195)
T PRK07247        148 -------------------------------GHNSLEDARMTARIYESFLET  168 (195)
T ss_pred             -------------------------------CCCCHHHHHHHHHHHHHHHHH
T ss_conf             -------------------------------908189999999999999997