HHsearch alignment for GI: 254780127 and conserved domain: PRK07983

>PRK07983 exodeoxyribonuclease X; Provisional.
Probab=98.60  E-value=8.6e-07  Score=63.09  Aligned_cols=84  Identities=21%  Similarity=0.244  Sum_probs=53.5

Q ss_pred             HHHHHHCCCCCEEEEEEHHHHHHHHHHHCCCCCCCCCEEEHHHHHHHHC--CCCCHHHHHHHHCCCCCCHHHHHCHHHHH
Q ss_conf             9999864889819986307759999986299878650454588999858--89997899998088986527663765766
Q gi|254780127|r   56 DLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNG--LPSSLKNACLALNFSEHLTKMEEGKALIA  133 (675)
Q Consensus        56 ~l~~~L~~~~~~kv~HNa~FD~~vL~~~lGi~i~~~~~~DTmi~A~~l~--~p~sL~~la~~lgl~~~~~kd~~gk~li~  133 (675)
T Consensus        66 ev~~~~~~-~~~lVaHNa~FD~~~L~~------~~~~~IcTl~lAR~l~p~~~~~l~~Lry~~~~~~~~~~---------  129 (219)
T PRK07983         66 DVIPHYYG-SEWYVAHNASFDRRVLPE------MPGEWICTMKLARRLWPGIKYSNMALYKSRKLNVQTPP---------  129 (219)
T ss_pred             HHHHHHCC-CCEEEECCCCCCHHHHCC------CCCCEEEHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCC---------
T ss_conf             99998628-987875365103866415------58756657899998767742418999998427613324---------


Q ss_pred             HHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             410023320134531125876899989887753999999998720
Q gi|254780127|r  134 RFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLI  178 (675)
Q Consensus       134 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ya~~Dv~~~~~L~~~L~  178 (675)
T Consensus       130 --------------~~---------~AHrAl~Dv~v~~~ll~~l~  151 (219)
T PRK07983        130 --------------GL---------HHHRALYDCYITAALLIDIM  151 (219)
T ss_pred             --------------CC---------CCCCHHHHHHHHHHHHHHHH
T ss_conf             --------------43---------33430787999999999999