HHsearch alignment for GI: 254780127 and conserved domain: PRK08076

>PRK08076 consensus.
Probab=100.00  E-value=0  Score=841.14  Aligned_cols=531  Identities=18%  Similarity=0.186  Sum_probs=439.3

Q ss_pred             EEEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEECCCEEEEEECCCCCHHHHHHHHHHCCCCCEEEEEEHHHHHHHHHHH
Q ss_conf             99980406788700046000026882999999983822899978884221799999864889819986307759999986
Q gi|254780127|r    4 LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRDETVMCVAHNSLFERILFKKT   83 (675)
Q Consensus         4 l~lD~ET~s~~dl~~~Gl~~y~~~~~I~~i~~a~~~~~~~~~d~~~~~~~~~~l~~~L~~~~~~kv~HNa~FD~~vL~~~   83 (675)
T Consensus       317 ~a~~~Et~~~~~----------~~a~lvGis~s~~~~-a~yiP~~~~-~~~~~lk~~Led~~i~KighNlK~dl~vL~~~  384 (877)
T PRK08076        317 SALVVEVLEDNY----------HKADIQGFAIVNENG-CYFIPTEIA-LKSDAFKEWLEDEEKKKWVFDAKRAIVALKWN  384 (877)
T ss_pred             CEEEEEECCCCC----------CCCCEEEEEEECCCC-EEEECCCHH-HHHHHHHHHHCCCCCCEEEECHHHHHHHHHHC
T ss_conf             549999647885----------637789999985894-599550044-21589999853976540265479999999968


Q ss_pred             CCCCCCCCCEEEHHHHHHHHCC---CCCHHHHHHHH-CCCCCCHHHHHCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHH
Q ss_conf             2998786504545889998588---99978999980-8898652766376576641002332013453112587689998
Q gi|254780127|r   84 LGIDIPSKRWICTSVLARTNGL---PSSLKNACLAL-NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLF  159 (675)
Q Consensus        84 lGi~i~~~~~~DTmi~A~~l~~---p~sL~~la~~l-gl~~~~~kd~~gk~li~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (675)
T Consensus       385 -GI~l~g-i~FDTMLAAYLLdP~~~~~~Ld~La~~yl~~~~~~~e~v~Gkg~k~-----------------~~p~-~~~~  444 (877)
T PRK08076        385 -GIDLQG-IDFDLLLAAYLLNPADSDDDFASVAKMKETHAVKSDEAVYGKGAKR-----------------AVPE-EEIL  444 (877)
T ss_pred             -CCCCCC-CCCCHHHHHHHCCCCCCCCCHHHHHHHHCCCCCCCHHHHCCCCCCC-----------------CCCC-HHHH
T ss_conf             -964477-6402999998718876766699999985577776347653765222-----------------4877-8999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCC----------HHHHHHHHHHHHHHHHCCEECCHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             988775399999999872002----------1431017899998751684308899999999999999999999986305
Q gi|254780127|r  160 GEYCKRDVEATRELFKRLIPL----------SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD  229 (675)
Q Consensus       160 ~~Ya~~Dv~~~~~L~~~L~~~----------~~~E~~l~~~~~~me~~Gi~vD~e~l~~~~~~~~~~~~~~~~~i~~~~g  229 (675)
T Consensus       445 ~eYaaedA~~t~~L~~~L~~~L~~~~l~~Ly~~IE~PLi~VLa~ME~~GI~VD~~~L~~ls~~l~~~l~~le~~I~~laG  524 (877)
T PRK08076        445 AEHLARKAHAIYDLKQTFVEELEKNEQLELFEELELPLARVLAEMEVKGVKVDTERLENMGEELAGRLKELEQEIHELAG  524 (877)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999986557899999997048899999985483898999999999999999999999999728


Q ss_pred             CCCCCCCCHHHHHHHHHHHCCCCCCCCCH---HHHHHHHHH-CCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHCCC-CC
Q ss_conf             76688885688999999972899988896---588999974-48985489999999997543000356688730568-84
Q gi|254780127|r  230 GIIRSSRQTYALRMYLFLITGIDLVDMSE---GTLKSILSH-SNITQLAKDLILNRLASSGSAILKLNTLSEAVSSD-GR  304 (675)
Q Consensus       230 ~~~~n~~S~~ql~~~L~~~~g~~~~~~~k---~~~~~~l~~-~~~~~~~~~ll~~r~~~~~~~~~~~~~l~~~~~~d-GR  304 (675)
T Consensus       525 ~eF-NinSpKQL~~ILFekL~Lp~~KKTKtG~STd~~vLe~L~~~h~i~~~iLeyR~l~KL~s-TY~d~L~~~i~~~tgR  602 (877)
T PRK08076        525 EEF-NINSPKQLGVILFEKLGLPVIKKTKTGYSTSADVLEKLADKHEIIPNILHYRQLGKLQS-TYIEGLLKVVHKDTHK  602 (877)
T ss_pred             CCC-CCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHH-HHHHHHHHHHCCCCCE
T ss_conf             987-88999999999998538988887889987869999975432854799999989988874-8999988741877545


Q ss_pred             CCCCEEECCCCCCHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCHHHHEEEEC-CCCCEEEEEECCC
Q ss_conf             522002113221001110688855477776652345654431024445544432210132121476-9987899973354
Q gi|254780127|r  305 LRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIA-SNGKKLVVADLAG  383 (675)
Q Consensus       305 ih~~~~~~gAt~TGR~S~~~pNlQnlPr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iR~~f~a-~~G~~lv~aDySq  383 (675)
T Consensus       603 iHt~fnQ~~-t~TGRLSS~~PNLQNIP------------------------irt~~G~~IR~aFi~~~~g~~l~saDYSQ  657 (877)
T PRK08076        603 VHTRFNQAL-TQTGRLSSTDPNLQNIP------------------------IRLEEGRKIRQAFVPSEEGWIMFAADYSQ  657 (877)
T ss_pred             EECCCCHHC-CCCCCCCCCCCCCCCCC------------------------CCCHHHHHHHHEEEECCCCCEEEEECHHH
T ss_conf             630100000-45564025787523677------------------------77644577876143079996799832668


Q ss_pred             CCEEEEEEECCCHHHHHHHHCCCCCCCCCHHHHHCCCCCCCCHHHHHCCCCCHHHHHHCCCHHHHHHHHHHCCCCCCHHH
Q ss_conf             85058866228767866540444100001577608751105702210064210013307887789887887088864036
Q gi|254780127|r  384 IEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS  463 (675)
Q Consensus       384 iElRvlA~ls~d~~li~~f~~g~D~h~~tA~~~~~~~~~~v~~~~R~~aK~~~~gl~YG~G~~~l~~~~~~~G~~~~~~~  463 (675)
T Consensus       658 IELRilAh~s~d~~l~~af~~~~DiH~~tA~~if~~~~~~vt~~~R~~AK~infGiiYG~~~~gLs~-------------  724 (877)
T PRK08076        658 IELRVLAHIAEDENLIEAFQHDMDIHTKTAMDVFHVEKDEVTSNMRRQAKAVNFGIVYGISDYGLSQ-------------  724 (877)
T ss_pred             HHHHHHHHHHCCHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHH-------------
T ss_conf             8999999982789999987159757588889984898010899999998898877876558788998-------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEECCC
Q ss_conf             66665666765478899999999987511101031088978899999986730789999999999999633721420132
Q gi|254780127|r  464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRV  543 (675)
Q Consensus       464 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ea~~~~~~~~~~~p~i~~~~~~~~~~~~~~~~~~~~~~~~~~  543 (675)
T Consensus       725 -------------------------------~l~i~~~eA~~~i~~Yf~~yp~v~~~~~~~~~~a~~---~G--------  762 (877)
T PRK08076        725 -------------------------------NLGITRKEAAEFIERYFESFPGVKEYMEDIVQEAKQ---KG--------  762 (877)
T ss_pred             -------------------------------HCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHH---CC--------
T ss_conf             -------------------------------629899999999999999782499999999999997---68--------


Q ss_pred             CCCCCCCCCCCCCCCEEECCCCHHHCCCCCCHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----
Q ss_conf             2234432124456411224631131024520123320310012357765335577767479899999999999996----
Q gi|254780127|r  544 ANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK----  619 (675)
Q Consensus       544 ~~~~~~~~~~~~~~l~i~~psGR~l~~~~~~~~~~~~~~~~~~~~r~~~~g~k~~n~~iQgtAaDi~k~am~~l~~----  619 (675)
T Consensus       763 ---------------yv~Tl~gRrr~~p~i~s~n~~~r---~~~eR~------A~N~piQGtAADiiK~AMi~i~~~l~~  818 (877)
T PRK08076        763 ---------------YVTTLLHRRRYIPEITSRNFNLR---SFAERT------AMNTPIQGSAADIIKKAMIDMADRLKE  818 (877)
T ss_pred             ---------------CEECCCCCEEECCCCCCCCHHHH---HHHHHH------HHCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             ---------------88646777030876557787788---889999------936144567999999999999999984


Q ss_pred             C--CCCEEEEECCEEEEECCCCHHHHHHH-HHHHHCCCCCCCCCCCCEEECCCCCCCC
Q ss_conf             7--98189995358999678478999999-9998467630216984157303114631
Q gi|254780127|r  620 N--GYDIVLTVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRYR  674 (675)
Q Consensus       620 ~--g~~ivl~VHDElv~evp~~~~~~~~~-i~~~M~~~p~wa~~~pl~a~~~~~~~y~  674 (675)
T Consensus       819 ~~~~~~mlLqVHDELvfev~~~~~~~~~~~~~~~Me~a~~L--~VPL~v~~~~G~nW~  874 (877)
T PRK08076        819 EGLQARLLLQVHDELIFEAPKEEIEKLEKLVPEVMEHAVEL--DVPLKVDYSYGPTWY  874 (877)
T ss_pred             CCCCCEEEEEEEEEEEEEECHHHHHHHHHHHHHHHHCCCCC--CCCEEEECCCCCCHH
T ss_conf             69985189986426689616889999999999998274236--887584138387967