HHsearch alignment for GI: 254780127 and conserved domain: TIGR01405

>TIGR01405 polC_Gram_pos DNA polymerase III, alpha subunit, Gram-positive type; InterPro: IPR006308 These are the polypeptide chains of DNA polymerase III. Full-length homologs of this protein are restricted to the Gram-positive lineages, including the Mycoplasmas. This protein is designated alpha chain and given the gene symbol polC, but is not a full-length homolog of other polC genes. The N-terminal region of about 200 amino acids is rich in low-complexity sequence and poorly alignable. ; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication, 0005737 cytoplasm.
Probab=98.92  E-value=2.4e-08  Score=73.43  Aligned_cols=65  Identities=22%  Similarity=0.246  Sum_probs=47.7

Q ss_pred             HHHHHHCCCCCEEEEEE-HHHHHHHHHHHC---CCCCCCCCEEEHHHHHHHHCC---CCCHHHHHHHHCCCCCC
Q ss_conf             99998648898199863-077599999862---998786504545889998588---99978999980889865
Q gi|254780127|r   56 DLLQYLRDETVMCVAHN-SLFERILFKKTL---GIDIPSKRWICTSVLARTNGL---PSSLKNACLALNFSEHL  122 (675)
Q Consensus        56 ~l~~~L~~~~~~kv~HN-a~FD~~vL~~~l---Gi~i~~~~~~DTmi~A~~l~~---p~sL~~la~~lgl~~~~  122 (675)
T Consensus       278 k~~~f~--~d~ilVAHNGasFD~~Fl~~~~~k~~~~~~~~p~IDTL~Lar~lnP~y~sh~Lg~~~~Kl~v~~~~  349 (1264)
T TIGR01405       278 KFKEFL--KDSILVAHNGASFDIGFLNTNFEKVGLEPLENPVIDTLELARALNPEYKSHRLGEIAKKLGVDLDD  349 (1264)
T ss_pred             HHHHHH--CCEEEEECCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHCCCCCCC
T ss_conf             999976--975888627610366889889876277423365113889999837311344542233320552153