>cd06131 DNA_pol_III_epsilon_Ecoli_like This subfamily is composed of the epsilon subunit of Escherichia coli DNA polymerase III (polIII) and similar proteins. PolIII is the main DNA replicating enzyme in bacteria, functioning as the chromosomal replicase. It is a holoenzyme complex of ten different subunits, three of which (alpha, epsilon, and theta) compose the catalytic core. The polIII epsilon subunit, encoded by the dnaQ gene, is a DEDDh-type 3'-5' exonuclease which is responsible for the proofreading activity of the polymerase, increasing the fidelity of DNA synthesis. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The epsilon subunit of polIII also functions as a stabilizer of the holoenzyme complex.

Probab=99.02 E-value=1.8e-08 Score=74.26 Aligned_cols=79 Identities=25% Similarity=0.255 Sum_probs=55.0 Q ss_pred CCCEEEEEEHHHHHHHHHHH---CCCCCC---CCCEEEHHHHHHHHC--CCCCHHHHHHHHCCCCCCHHHHHCHHHHHHH Q ss_conf 89819986307759999986---299878---650454588999858--8999789999808898652766376576641 Q gi|254780127|r 64 ETVMCVAHNSLFERILFKKT---LGIDIP---SKRWICTSVLARTNG--LPSSLKNACLALNFSEHLTKMEEGKALIARF 135 (675) Q Consensus 64 ~~~~kv~HNa~FD~~vL~~~---lGi~i~---~~~~~DTmi~A~~l~--~p~sL~~la~~lgl~~~~~kd~~gk~li~~~ 135 (675) T Consensus 80 ~~~~lVaHN~~FD~~fL~~~~~r~~~~~~~~~~~~~~Dtl~l~r~~~p~~~~~L~~l~~~~gi~~~~~------------ 147 (167) T cd06131 80 RGAELVIHNASFDVGFLNAELSLLGLGKKIIDFCRVIDTLALARKKFPGKPNSLDALCKRFGIDNSHR------------ 147 (167) T ss_pred CCCEEEEECHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCCCCCHHHHHHHCCCCCCCC------------ T ss_conf 69999983718789999999998189977776554113999999984999888999998769799999------------ Q ss_pred HHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 002332013453112587689998988775399999999872 Q gi|254780127|r 136 CKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL 177 (675) Q Consensus 136 ~~~~~~~~~~~~~~~~~~~~~~~~~~Ya~~Dv~~~~~L~~~L 177 (675) T Consensus 148 --------------~---------~H~Al~Da~~ta~vf~~l 166 (167) T cd06131 148 --------------T---------LHGALLDAELLAEVYLEL 166 (167) T ss_pred --------------C---------CCCHHHHHHHHHHHHHHH T ss_conf --------------8---------758899999999999976

HHsearch alignment for GI: 254780127 and conserved domain: cd06131