>cd06143 PAN2_exo PAN2 is the catalytic subunit of poly(A) nuclease (PAN), a Pab1p-dependent 3'-5' exoribonuclease which plays an important role in the posttranscriptional maturation of pre-mRNAs. PAN catalyzes the deadenylation of poly(A) tails, which are initially synthesized to default lengths of 70 to 90, to mRNA-specific lengths of 55 to 71. Pab1p and PAN also play a role in the export and decay of mRNA. PAN2 contains a DEDDh-type DnaQ-like 3'-5' exonuclease domain with three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis.

Probab=91.11 E-value=0.47 Score=25.15 Aligned_cols=56 Identities=21% Similarity=0.115 Sum_probs=37.1 Q ss_pred HCCCCCEEEEEEHHHHHHHHHHHCCCCCCCCCEEEHHHHHHHH-CCCCCHHHHHHH-HCCCC Q ss_conf 6488981998630775999998629987865045458899985-889997899998-08898 Q gi|254780127|r 61 LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTN-GLPSSLKNACLA-LNFSE 120 (675) Q Consensus 61 L~~~~~~kv~HNa~FD~~vL~~~lGi~i~~~~~~DTmi~A~~l-~~p~sL~~la~~-lgl~~ 120 (675) T Consensus 98 li~~~~ILVGHsL~nDL~aL----~l~hP~~~i~DTs~l~~~~~~r~~sLk~La~~~Lg~~I 155 (174) T cd06143 98 LVDLGCIFVGHGLAKDFRVI----NIQVPKEQVIDTVELFHLPGQRKLSLRFLAWYLLGEKI 155 (174) T ss_pred HCCCCCEEECCCCHHHHHHH----CCCCCCCCEEECHHHCCCCCCCCCCHHHHHHHHCCCCC T ss_conf 54799689789636679885----06699866577788526899887089999999808104

HHsearch alignment for GI: 254780127 and conserved domain: cd06143