BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780127|ref|YP_003064540.1| putative DNA polymerase from
bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62]
         (675 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780127|ref|YP_003064540.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039804|gb|ACT56600.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|317120698|gb|ADV02521.1| DNA polymerase A [Liberibacter phage SC1]
 gi|317120741|gb|ADV02563.1| DNA polymerase A [Liberibacter phage SC2]
 gi|317120802|gb|ADV02623.1| DNA polymerase A [Liberibacter phage SC2]
 gi|317120842|gb|ADV02663.1| DNA polymerase A [Liberibacter phage SC1]
          Length = 675

 Score = 1398 bits (3619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/675 (100%), Positives = 675/675 (100%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
Sbjct: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
Sbjct: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
Sbjct: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
Sbjct: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
           HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
Sbjct: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
Sbjct: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG
Sbjct: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEAKRYRK
Sbjct: 661 LPLKAEGYEAKRYRK 675


>gi|255957611|dbj|BAH96662.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957616|dbj|BAH96666.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957626|dbj|BAH96674.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957641|dbj|BAH96686.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957661|dbj|BAH96702.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957666|dbj|BAH96706.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957671|dbj|BAH96710.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957676|dbj|BAH96714.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957686|dbj|BAH96722.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score = 1396 bits (3613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/675 (99%), Positives = 674/675 (99%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
Sbjct: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
Sbjct: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
Sbjct: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
Sbjct: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
           HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
Sbjct: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
Sbjct: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG
Sbjct: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEAKRYRK
Sbjct: 661 LPLKAEGYEAKRYRK 675


>gi|255957621|dbj|BAH96670.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score = 1395 bits (3612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/675 (99%), Positives = 673/675 (99%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
Sbjct: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSE VS
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSETVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
Sbjct: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
Sbjct: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
Sbjct: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
           HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
Sbjct: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
Sbjct: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG
Sbjct: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEAKRYRK
Sbjct: 661 LPLKAEGYEAKRYRK 675


>gi|255957561|dbj|BAH96622.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957566|dbj|BAH96626.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957571|dbj|BAH96630.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957576|dbj|BAH96634.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957581|dbj|BAH96638.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957586|dbj|BAH96642.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957591|dbj|BAH96646.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957601|dbj|BAH96654.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957631|dbj|BAH96678.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957636|dbj|BAH96682.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957646|dbj|BAH96690.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957651|dbj|BAH96694.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957656|dbj|BAH96698.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957681|dbj|BAH96718.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score = 1395 bits (3611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/675 (99%), Positives = 673/675 (99%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTKMEEGKALIARFC GSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
Sbjct: 121 HLTKMEEGKALIARFCNGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
Sbjct: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
Sbjct: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
Sbjct: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
           HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
Sbjct: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
Sbjct: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG
Sbjct: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEAKRYRK
Sbjct: 661 LPLKAEGYEAKRYRK 675


>gi|255957596|dbj|BAH96650.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957606|dbj|BAH96658.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score = 1394 bits (3607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/675 (99%), Positives = 672/675 (99%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTKMEEGKALIARFC GSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
Sbjct: 121 HLTKMEEGKALIARFCNGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
Sbjct: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
Sbjct: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
Sbjct: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
           HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
Sbjct: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
Sbjct: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPD PYFSVGTLCSLMTKNPSWAKG
Sbjct: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDIPYFSVGTLCSLMTKNPSWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEAKRYRK
Sbjct: 661 LPLKAEGYEAKRYRK 675


>gi|255957556|dbj|BAH96618.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score = 1393 bits (3606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/675 (99%), Positives = 672/675 (99%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTKMEEGKALIARFC GSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
Sbjct: 121 HLTKMEEGKALIARFCNGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
Sbjct: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
Sbjct: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
Sbjct: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
           HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
Sbjct: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
Sbjct: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG
Sbjct: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
            PLKAEGYEAKRYRK
Sbjct: 661 FPLKAEGYEAKRYRK 675


>gi|315121967|ref|YP_004062456.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495369|gb|ADR51968.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 673

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/675 (73%), Positives = 564/675 (83%), Gaps = 2/675 (0%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           M KLFIDIETRSP+PLPKVGVWAYAE+A ITLCAYA +DE +KLWD T    MPSDLL++
Sbjct: 1   MPKLFIDIETRSPKPLPKVGVWAYAEEAKITLCAYAHNDETIKLWDCTANPVMPSDLLKH 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           L+D+TV+CVAHNSLFERILFKK+L I IP +RWICTS LAR NGLP+SLKNAC+AL F E
Sbjct: 61  LKDDTVVCVAHNSLFERILFKKSLNITIPPRRWICTSTLARINGLPASLKNACMALKFPE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
            LTKMEEGKALIARFCKGSI+  PYD  RANHVQAWQLFGEYCKRDVEATREL+KRL PL
Sbjct: 121 TLTKMEEGKALIARFCKGSIEESPYDAKRANHVQAWQLFGEYCKRDVEATRELYKRLTPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           S+ ER LWLLDQ INDRGY IDL+LV KLQELIA ER+KLDE++  LT G+I SSR+T  
Sbjct: 181 SENERHLWLLDQEINDRGYAIDLNLVKKLQELIAFEREKLDEELKTLTFGVIGSSRKTDL 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           L  YLFL  G+DL DM+E T+ + LS  NITQ AKD++ NRL+SS SAILKLNTLS AVS
Sbjct: 241 LNKYLFLYMGLDLPDMAESTIATALSQPNITQRAKDILNNRLSSSQSAILKLNTLSGAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
            D RLRGTLQFYGASRTGRWSGCVFQPQNLPR   S E + + I++ N      DPL  A
Sbjct: 301 PDLRLRGTLQFYGASRTGRWSGCVFQPQNLPRPNTSHETIEEAIESSNFPSD--DPLRFA 358

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIAS GKKLVVADLAGIEARVLAWIAGE WK+ AFANGEDIY T Y+KAFN P
Sbjct: 359 SDCVRSCIIASTGKKLVVADLAGIEARVLAWIAGEQWKLNAFANGEDIYKTAYSKAFNIP 418

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           +  V+K+QRAIGKVMELALGYQGGA+VF+TMAS+ GLDL+QFS+++K T+T +DWEQA+ 
Sbjct: 419 LSNVTKDQRAIGKVMELALGYQGGARVFQTMASNLGLDLKQFSKSIKQTATGDDWEQAQR 478

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
             LWMQ+ YPEFAV D  IGTACELVK AWRAKH+GV+QLWKD  E F CV+++G SISA
Sbjct: 479 RCLWMQETYPEFAVHDPFIGTACELVKTAWRAKHKGVVQLWKDCEEAFDCVIKDGRSISA 538

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVA VP L+M++  ++V I LPS+R+LVY DVK D SYLNTAT+Q+MRERTYGGKLTEN
Sbjct: 539 RRVAGVPPLLMKKQHQNVFITLPSNRKLVYRDVKSDRSYLNTATAQIMRERTYGGKLTEN 598

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDIL  GM NAT+ GYDIVLTVHDEIV ETPDTP FS   LC LMT+NP WAKG
Sbjct: 599 IVQAISRDILACGMINATRAGYDIVLTVHDEIVCETPDTPEFSSDELCFLMTQNPKWAKG 658

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEA RYRK
Sbjct: 659 LPLKAEGYEALRYRK 673


>gi|315122935|ref|YP_004063424.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496337|gb|ADR52936.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 675

 Score = 1022 bits (2642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/675 (72%), Positives = 567/675 (84%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           M KLFIDIETRSP+PLPKVGVWAYAE+A ITLCAYA +DE +KLWD T    MPSDLL++
Sbjct: 1   MPKLFIDIETRSPKPLPKVGVWAYAEEAKITLCAYAHNDETIKLWDCTANPVMPSDLLKH 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           L+D+TV+CVAHNSLFERILFKK+L I IP +RWICTS LAR NGLP+SLKNAC+AL F E
Sbjct: 61  LKDDTVVCVAHNSLFERILFKKSLNITIPPRRWICTSTLARINGLPASLKNACMALKFPE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
            LTKMEEGKALIARFCKGSI+  PYD  RANHVQAWQLFGEYCKRDVEATREL+KRL PL
Sbjct: 121 TLTKMEEGKALIARFCKGSIEESPYDAKRANHVQAWQLFGEYCKRDVEATRELYKRLTPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           S+ ER LWLLDQ INDRGY IDL+LV KLQELIA ER++LDE+  +LT G+I S+R+T  
Sbjct: 181 SENERHLWLLDQEINDRGYAIDLNLVKKLQELIAFERERLDEEFKELTAGVIGSARKTDL 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           L  YLFL TG+DL DM+E T+ + LS  +I QL+K ++ NRL+SS SAILKLNTLS AVS
Sbjct: 241 LNKYLFLYTGLDLPDMAESTVLTALSQPDIPQLSKAILNNRLSSSQSAILKLNTLSGAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
            D RLRGTLQF+GASRTGRWSGCVFQPQNLPRQ  + + + + I+ L+ G  I DPL  A
Sbjct: 301 PDNRLRGTLQFFGASRTGRWSGCVFQPQNLPRQTLAVDEIERLIRGLDSGVPIKDPLRFA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIAS GKKL+VADLAGIEARVLAW+AGE WK+ AFANGEDIY T Y+KAFN P
Sbjct: 361 SDCVRSCIIASPGKKLIVADLAGIEARVLAWVAGEQWKLNAFANGEDIYKTAYSKAFNVP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           +  V+K+QRAIGKVMELALGYQGGA+VF+ MAS  GL+LQQFS+++K+T+T EDWEQA+ 
Sbjct: 421 LSDVTKDQRAIGKVMELALGYQGGARVFQKMASTLGLNLQQFSKSIKNTATSEDWEQAQR 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
             LWMQ+ +PEFAV D  IGTACELVK+AWRAKH+GV+QLWKD  E F CV+++G SISA
Sbjct: 481 RCLWMQETHPEFAVPDPFIGTACELVKEAWRAKHKGVVQLWKDCEEAFDCVIKDGRSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRV  VP L+M++  ++V I LPS+R+LVY DVK D SYLNTAT+Q+MRERTYGGKLTEN
Sbjct: 541 RRVLGVPPLLMKKQHQNVFITLPSNRKLVYRDVKSDRSYLNTATAQIMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDIL  GM NATK GYDIVLTVHDEIV E PDTP FS   LCSLMT+NP+WAKG
Sbjct: 601 IVQAISRDILATGMINATKAGYDIVLTVHDEIVCEVPDTPEFSSDDLCSLMTRNPTWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEA RYRK
Sbjct: 661 LPLKAEGYEAVRYRK 675


>gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040870|gb|ACT57666.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|317120755|gb|ADV02576.1| DNA polymerase A [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/677 (59%), Positives = 484/677 (71%), Gaps = 4/677 (0%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
              KMEEGK LIARFCKG      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL EA+
Sbjct: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358

Query: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418

Query: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478

Query: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538

Query: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598

Query: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPDT  F+   L  LMT NPSWA
Sbjct: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658

Query: 659 KGLPLKAEGYEAKRYRK 675
           KGLPLKAEGYE+KRYRK
Sbjct: 659 KGLPLKAEGYESKRYRK 675


>gi|212712317|ref|ZP_03320445.1| hypothetical protein PROVALCAL_03405 [Providencia alcalifaciens DSM
           30120]
 gi|212685063|gb|EEB44591.1| hypothetical protein PROVALCAL_03405 [Providencia alcalifaciens DSM
           30120]
          Length = 685

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 273/688 (39%), Positives = 380/688 (55%), Gaps = 24/688 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L++D+ET S +P+ K G  +YAE   I L A+A ++  V++WD T++S +P++L Q L D
Sbjct: 5   LWLDLETFSEKPI-KYGTHSYAETVEIMLFAWALNNNLVQVWDVTDKSPIPTELKQALSD 63

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLT 123
              +  AHNS F+R +   + GI I   RW  T V A  +GLP +L   C  L       
Sbjct: 64  PNTIIYAHNSHFDRTMLNHS-GIKIDVSRWRDTMVQALAHGLPGALGALCEVLGVPLDKA 122

Query: 124 KMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS- 181
           K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE+ KRL   + 
Sbjct: 123 KDKEGKALIQLFCKPRPKNSALRRATSKTHPEEWKRFVAYAGLDIEAMREVHKRLPSWNY 182

Query: 182 -DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
            D E + W  DQ INDRG  +D+ L     E +  E+K+L +    LTD  ++++ Q  A
Sbjct: 183 CDNELEHWHRDQRINDRGVYMDIQLATAAIEAVEIEQKRLAKLTQDLTDNEVQAATQRDA 242

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           L  ++    G+DL DM + TL+  ++  +I    ++L+  RL SS ++  K   L   VS
Sbjct: 243 LLQHISAAFGVDLPDMQKSTLERRINDPDIPLPLRELLAIRLQSSTTSTSKYKALMNGVS 302

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP-L 357
           SDGRLRGTLQF GASRTGRW+G +FQPQNLPR    +  + + I+AL  G  + I D  +
Sbjct: 303 SDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPTLDQNTIDKGIEALKAGCADLIYDDIM 362

Query: 358 GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN-----GEDIYVTT 412
            L S  +R CI+A  GKKLVV+DL+ IE R+LAW+AGE WKI AF+      G D+Y   
Sbjct: 363 QLTSSTLRGCIMAPEGKKLVVSDLSNIEGRMLAWLAGEAWKITAFSEFDKGIGADLYKLA 422

Query: 413 YAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTF 472
           YA+AFN   + V K  R IGKVMEL LGY GG   F T A    LDL + ++        
Sbjct: 423 YARAFNISPEDVDKHMRQIGKVMELGLGYGGGVAAFLTFALTYSLDLDELAEAALPNIPP 482

Query: 473 EDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVV 532
           +    A S +    +    + + + +  T C+ +K+ WR  H   +  W +L +     +
Sbjct: 483 KVKHDALSWYQKSVETKKTYGLSETVFIT-CDSLKRMWRNAHPETVSFWYELEDTVRHAI 541

Query: 533 QEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD---CSYL--NTATSQL 587
              G     R     +L +RR K  + IVLPS R + Y   + D    SY+  N  + + 
Sbjct: 542 SSPGITFPCR-----KLKVRRDKAWLRIVLPSGRAVCYPSPRNDNGQISYMGVNPYSRKW 596

Query: 588 MRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTL 647
            R +TYGGKL EN+ QA +RD+L   M     +GYDIVLTVHDE+++E PD P F+   L
Sbjct: 597 QRLKTYGGKLVENVTQAAARDVLAGNMPTIEDHGYDIVLTVHDEVLTEAPDNPAFNHEHL 656

Query: 648 CSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L+  NP WA  LPL A G+EA  YRK
Sbjct: 657 SELLATNPEWALDLPLSAGGFEAYHYRK 684


>gi|291283829|ref|YP_003500647.1| DNA polymerase I - 3''''-5'''' exonuclease and polymerase domains
           [Escherichia coli O55:H7 str. CB9615]
 gi|290763702|gb|ADD57663.1| DNA polymerase I - 3''''-5'''' exonuclease and polymerase domains
           [Escherichia coli O55:H7 str. CB9615]
          Length = 687

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 262/689 (38%), Positives = 373/689 (54%), Gaps = 24/689 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + + D
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAD 63

Query: 64  ETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +  
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEILGVPQDK 123

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS 181
            K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL   +
Sbjct: 124 AKNKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 182 --DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG  +D+ L     E + QE+K+L +   ++TDG ++++ Q  
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDMQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L + V
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIADPHLPSAVKELLAIRLQASTTSTSKYKALMKGV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       + 
Sbjct: 304 SHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCAGLLFDNI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGEDIYVT 411
           + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF       G D+Y  
Sbjct: 364 MELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL + +        
Sbjct: 424 AYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPNIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
            +   +A+S +         F + +++   AC+ +K+ WR  H      W +L       
Sbjct: 484 RDVIREAKSWYNESVKHKSTFGLSERVF-IACDSLKRLWRRAHPATCDFWYELERTVRTA 542

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTATSQ 586
           +      + ++      L +RR    + I LPS R + Y      KG+ +Y+  N+ + +
Sbjct: 543 IA-----TPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPIIEKGNITYMGVNSYSRK 597

Query: 587 LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGT 646
             R +TYGGKL EN+ QA +RD+L   M      GY IVLTVHDE+++E PDT  F+   
Sbjct: 598 WQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITEAPDTEDFNDKA 657

Query: 647 LCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           L +L++ NP WA  +PL A G+EA  YRK
Sbjct: 658 LSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|330862112|emb|CBX72276.1| putative DNA polymerase [Yersinia enterocolitica W22703]
          Length = 699

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 268/707 (37%), Positives = 381/707 (53%), Gaps = 46/707 (6%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLR 62
           KL+ D ET    P+ K G  AYAE   + +  YA +D+PV  WD T  + MP DL  YL+
Sbjct: 4   KLWFDSETFCETPI-KNGTHAYAEHVEVMIITYALNDDPVSEWDITSGAKMPEDLKAYLQ 62

Query: 63  DETVMCVAHNSLFERILFKKTLGIDIPS------KRWICTSVLARTNGLPSSLKNACLAL 116
           D ++   A NS F+R + +     D+PS      +RW  T V A  +GLP  L   C  L
Sbjct: 63  DPSIEIYAQNSHFDRTMMRH----DMPSVIAGGIERWRDTMVKALAHGLPGGLGVLCEIL 118

Query: 117 NFSEHLTKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFK 175
             ++   K +EGKALI  FCK  + +S  +  T   H + W+ F +Y   D+EA R + K
Sbjct: 119 GITQDKAKDKEGKALIQLFCKPRAKNSTIHRATSKTHPEEWKRFLKYAGNDIEAMRAIDK 178

Query: 176 RLIPL---SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           +L P+      E  LW  DQ INDRG ++D  L       +  E+K L +    LTD  +
Sbjct: 179 KL-PVWNYQGKELALWHFDQLINDRGVQMDTVLAEAAVTAVVDEQKLLAKRTQNLTDNEV 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
           +++ Q  AL  ++    G+DL DM + TL+  ++   +  + ++L+  RL +S ++  K 
Sbjct: 238 QAATQRDALLRHIVESFGVDLPDMQKSTLERRIADPELPSVLRELLAIRLQASTTSTSKY 297

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
            TL + VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E +   I+AL  G  
Sbjct: 298 KTLLKGVSKDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPVLDQETIDTGIEALKAGCA 357

Query: 353 ---IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN----- 404
                + + L S  +R CI+A  GKKLVV+DL+ IE RVLAW+AGE+WK++AF +     
Sbjct: 358 DLLFDNVMELISSALRGCIVAPKGKKLVVSDLSNIEGRVLAWLAGEEWKLEAFRDYDTII 417

Query: 405 -----------GEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
                      G D+Y   YA+AFN   D V+K QR IGKVMEL LG+ GG   F T A 
Sbjct: 418 GYDEGGEALREGPDLYKLAYARAFNISPDDVTKLQRQIGKVMELGLGFGGGVAAFLTFAL 477

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             GLDL + +             +A+S +     Q   F + +++   AC+ +K+ WR  
Sbjct: 478 VYGLDLDELANAALPNVPTSIQREAQSWYQASVKQKRTFGLSEQVF-IACDSLKRMWRNA 536

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           H   +  W ++       +     I+ ++     +L +RR    + I LPS R + Y  +
Sbjct: 537 HPETVSFWSEIENTVRRAI-----INPKQTFVCRKLKIRRDGSWLRIQLPSGRSVCYPGI 591

Query: 574 K--GD-CSYL--NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTV 628
           +  GD  SY+  NT + +  R +TYGGKL EN  QA +RD++   M      GY+I LTV
Sbjct: 592 RIEGDKISYMGVNTYSRKWQRLKTYGGKLAENATQAAARDVMANNMPLIEARGYEITLTV 651

Query: 629 HDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           HDE+++E PDT  F+   L  L+  NP WA  LPL A G+EA  YRK
Sbjct: 652 HDEVLTEAPDTDAFTSDKLSELLATNPEWALDLPLSAGGFEAYHYRK 698


>gi|191173996|ref|ZP_03035513.1| DNA polymerase [Escherichia coli F11]
 gi|190905687|gb|EDV65309.1| DNA polymerase [Escherichia coli F11]
 gi|324014350|gb|EGB83569.1| hypothetical protein HMPREF9533_01582 [Escherichia coli MS 60-1]
          Length = 687

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 262/689 (38%), Positives = 374/689 (54%), Gaps = 24/689 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A +DEPV +WD T    +P  L + +  
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDEPVNVWDITAGGGIPHGLYEAIAA 63

Query: 64  ETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +  
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDK 123

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS 181
            K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 182 --DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG  +D+ L     E + QE+K+L +   ++TDG ++++ Q  
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDIQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L + V
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMKGV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       + 
Sbjct: 304 SHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDNI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGEDIYVT 411
           + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF       G D+Y  
Sbjct: 364 MELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL + +        
Sbjct: 424 AYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPNIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
            +   +A+S +     +   F + +++   AC+ +K+ WR  H      W +L       
Sbjct: 484 RDVIREAKSWYNESVKRKSTFGLSERVF-IACDSLKRLWRRAHPATCDFWYELERTVRTA 542

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTATSQ 586
           +      + ++      L +RR    + I LPS R + Y      KG+ +Y+  N+ + +
Sbjct: 543 IA-----TPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSYSRK 597

Query: 587 LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGT 646
             R +TYGGKL EN+ QA +RD+L   M      GY IVLTVHDE+++E PDT  F+   
Sbjct: 598 WQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITEAPDTEDFNDKA 657

Query: 647 LCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           L +L++ NP WA  +PL A G+EA  YRK
Sbjct: 658 LSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|41179402|ref|NP_958711.1| Bbp42 [Bordetella phage BPP-1]
 gi|45569535|ref|NP_996604.1| DNA polymerase [Bordetella phage BMP-1]
 gi|45580786|ref|NP_996652.1| DNA polymerase [Bordetella phage BIP-1]
 gi|40950141|gb|AAR97707.1| Bbp42 [Bordetella phage BPP-1]
          Length = 688

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 281/695 (40%), Positives = 372/695 (53%), Gaps = 28/695 (4%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MS LF+D+ET    P+ + G  AYAE+A + L AYA D+ PV +WD      MP DL   
Sbjct: 1   MSTLFLDLETYCEVPI-QNGTHAYAEKAEVLLFAYALDNGPVYVWDAASGEKMPDDLRWA 59

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPS--KRWICTSVLARTNGLPSSLKNACLALNF 118
           L DE V   AHNS F+R + +  +  D P    RW  T V A  + LP +L + C  L  
Sbjct: 60  LIDENVALCAHNSHFDRTVLRHAMP-DYPLALPRWRDTMVKALAHSLPGALGDLCDILKV 118

Query: 119 SEHLTKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL 177
                K + GK LI  FCK     S     TR  H   W  F EY   D+EA R + ++L
Sbjct: 119 PTDKAKDKAGKQLIMLFCKPRPATSKLRRATRETHPAEWAKFVEYAGLDIEAMRVIDQKL 178

Query: 178 IPLS--DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSS 235
              +    E  LW LDQTINDRG  +D DL       + + +K L      +T G ++++
Sbjct: 179 PAWNYQGTELALWHLDQTINDRGVMVDTDLAHAAIRAVERTQKVLAARTSDITLGAVQAA 238

Query: 236 RQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTL 295
            Q  A+  ++    G+DL DM + TL+  ++  ++    ++L+  RL +S ++  K  TL
Sbjct: 239 TQRDAMLRHVLAAYGLDLPDMQQSTLERRIADPDLPAELRELLGIRLQASTTSTSKYKTL 298

Query: 296 SEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET--- 352
           ++ VSSDGRLRGTLQF GASRTGRW+G +FQPQNLPR    ++ + + I AL        
Sbjct: 299 AKGVSSDGRLRGTLQFNGASRTGRWAGRLFQPQNLPRPVLKQDAIERGIAALKADCADLL 358

Query: 353 IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGED 407
            A+ + L S  +R CI+A  GKKLVVADL+ IE R++AW+AGEDWK+ AF       G D
Sbjct: 359 FANVMELTSSAIRGCIVAPEGKKLVVADLSNIEGRMIAWLAGEDWKLAAFREFDDGAGPD 418

Query: 408 IYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVK 467
           +Y   YAKAF    D V K+QR IGKVMEL LGY+GG   F T A+  G+DL   +    
Sbjct: 419 LYKLAYAKAFAVSPDSVDKDQRQIGKVMELMLGYEGGVGAFLTGAATYGIDLDAMADAAW 478

Query: 468 STSTFEDWEQAESHHLWMQDQ-YPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
            +   +   +AE    W  +Q   +F +K K     C+ +K+ WR  H  V   WK+L E
Sbjct: 479 PSIPADIIAEAEQFLAWRTEQRLGDFGLKPKTF-VVCDALKRLWRRAHPAVSSFWKELEE 537

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS----DVKGDCSYL-- 580
                V   G+    R      L  RR    + I LPS R L Y     D  G  SY+  
Sbjct: 538 AARLAVLRPGTTYDCRT-----LKARRDGAWLRIRLPSGRFLCYPSPQLDDAGKLSYMGV 592

Query: 581 NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTP 640
           N  + +  R +TYGGKL EN+ QA SRD+L   M      GY IVL+VHDE ++E  D  
Sbjct: 593 NQYSRKWSRLKTYGGKLAENVTQAASRDVLAANMPAIEAAGYQIVLSVHDENITEADDRD 652

Query: 641 YFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            FS   L  LM  NP WA GLPL A G+EA RYRK
Sbjct: 653 EFSAAHLAGLMATNPPWAAGLPLAAAGFEAYRYRK 687


>gi|331648300|ref|ZP_08349389.1| putative DNA polymerase (P45) [Escherichia coli M605]
 gi|331042849|gb|EGI14990.1| putative DNA polymerase (P45) [Escherichia coli M605]
          Length = 687

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 260/689 (37%), Positives = 374/689 (54%), Gaps = 24/689 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + + D
Sbjct: 5   LWGDLETYCDIPINN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAD 63

Query: 64  ETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +  
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEILGVPQDK 123

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS 181
            K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE+ KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVCKRLPKWN 183

Query: 182 --DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG  +D+ L     E + QE+K+L +   ++TDG ++++ Q  
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDMQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L + V
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMKGV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       + 
Sbjct: 304 SHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDNI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGEDIYVT 411
           + L S  +R CIIA  GKK+VV+DL+ IE R+LAW+AGE+WK+ AF       G D+Y  
Sbjct: 364 MELTSSALRGCIIAPTGKKMVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL + +        
Sbjct: 424 AYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPNIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
            +   +A+S +     +   + + +++   AC+ +K+ WR  H      W +L       
Sbjct: 484 RDVIREAKSWYGESVKRKSTYGLSERVF-IACDSLKRLWRRAHPATCDFWYELERTVRTA 542

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTATSQ 586
           +      + ++      L +RR    + I LPS R + Y      KG+ +Y+  N+ + +
Sbjct: 543 IA-----TPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSYSRK 597

Query: 587 LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGT 646
             R +TYGGKL EN+ QA +RD+L   M      GY IVLTVHDE+++E+PDT  F+   
Sbjct: 598 WQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITESPDTEDFNDKA 657

Query: 647 LCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           L +L++ NP WA  +PL A G+EA  YRK
Sbjct: 658 LSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|323159211|gb|EFZ45201.1| DNA-directed DNA polymerase [Escherichia coli E128010]
          Length = 687

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 260/689 (37%), Positives = 375/689 (54%), Gaps = 24/689 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + + D
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAD 63

Query: 64  ETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +  
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDK 123

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS 181
            K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 182 --DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG  +D++L     + + QE+K+L +   ++TDG ++++ Q  
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L + V
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMKGV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       + 
Sbjct: 304 SHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDNI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGEDIYVT 411
           + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF       G D+Y  
Sbjct: 364 MELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL + +        
Sbjct: 424 AYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPNIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
            +   +A+S +     +   + + +++   AC+ +K+ WR  H      W +L       
Sbjct: 484 RDVIREAKSWYDESVKRKSTYGLSERVF-IACDSLKRLWRRAHPATCDFWYELERTVRTA 542

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTATSQ 586
           +      + ++      L +RR    + I LPS R + Y      KG+ +Y+  N+ + +
Sbjct: 543 IA-----TPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSYSRK 597

Query: 587 LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGT 646
             R +TYGGKL ENI QA +RDIL   M      GY IVLTVHDE+++E PDT  F+   
Sbjct: 598 WQRLKTYGGKLVENITQAAARDILAGNMPLIEDAGYSIVLTVHDEVITEAPDTEDFNDKA 657

Query: 647 LCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           L +L++ +P WA  +PL A G+EA  Y+K
Sbjct: 658 LSALLSTDPEWAPDIPLNAGGFEAYHYKK 686


>gi|218555134|ref|YP_002388047.1| putative DNA polymerase from bacteriophage origin [Escherichia coli
           IAI1]
 gi|218361902|emb|CAQ99502.1| putative DNA polymerase from bacteriophage origin [Escherichia coli
           IAI1]
          Length = 687

 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 260/689 (37%), Positives = 375/689 (54%), Gaps = 24/689 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + + D
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGVGIPHGLYEAIAD 63

Query: 64  ETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +  
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDK 123

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS 181
            K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 182 --DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG  +D++L     + + QE+K+L +   ++TDG ++++ Q  
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L + V
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMKGV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       + 
Sbjct: 304 SHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDNI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGEDIYVT 411
           + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF       G D+Y  
Sbjct: 364 MELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL + +        
Sbjct: 424 AYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPNIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
            +   +A+S +     +   + + +++   AC+ +K+ WR  H      W +L       
Sbjct: 484 RDVIREAKSWYDESVKRKSTYGLSERVF-IACDSLKRLWRRAHPATCDFWYELERTVRTA 542

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTATSQ 586
           +      + ++      L +RR    + I LPS R + Y      KG+ +Y+  N+ + +
Sbjct: 543 IA-----TPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSYSRK 597

Query: 587 LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGT 646
             R +TYGGKL ENI QA +RDIL   M      GY IVLTVHDE+++E PDT  F+   
Sbjct: 598 WQRLKTYGGKLVENITQAAARDILAGNMPLIEDAGYSIVLTVHDEVITEAPDTEDFNDKA 657

Query: 647 LCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           L +L++ +P WA  +PL A G+EA  Y+K
Sbjct: 658 LSALLSTDPEWAPDIPLNAGGFEAYHYKK 686


>gi|194429286|ref|ZP_03061813.1| DNA polymerase [Escherichia coli B171]
 gi|194412694|gb|EDX28989.1| DNA polymerase [Escherichia coli B171]
          Length = 687

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 260/689 (37%), Positives = 377/689 (54%), Gaps = 24/689 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + + D
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAD 63

Query: 64  ETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +  
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDK 123

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS 181
            K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 182 --DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG  +D++L     + + QE+K+L +   ++TDG ++++ Q  
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L + V
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMKGV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP- 356
           S DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G  + + D  
Sbjct: 304 SHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDNI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGEDIYVT 411
           + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF       G D+Y  
Sbjct: 364 MELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL + +        
Sbjct: 424 AYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPNIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
            +   +A+S +     +   + + +++   AC+ +K+ WR  H      W +L       
Sbjct: 484 RDVIREAKSWYDESVKRKSTYGLSERVF-IACDSLKRLWRRAHPATCDFWYELERTVRTA 542

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTATSQ 586
           +      + ++      L +RR    + I LPS R + Y      KG+ +Y+  N+ + +
Sbjct: 543 IA-----TPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSYSRK 597

Query: 587 LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGT 646
             R +TYGGKL ENI QA +RDIL   M      GY IVLTVH+E+++E PDT  F+   
Sbjct: 598 WQRLKTYGGKLVENITQAAARDILAGNMPLIEDAGYSIVLTVHNEVITEAPDTEDFNDKA 657

Query: 647 LCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           L +L++ +P WA  +PL A G+EA  Y+K
Sbjct: 658 LSALLSTDPEWAPDIPLNAGGFEAYHYKK 686


>gi|331654014|ref|ZP_08355015.1| putative DNA polymerase (P45) [Escherichia coli M718]
 gi|331048863|gb|EGI20939.1| putative DNA polymerase (P45) [Escherichia coli M718]
          Length = 687

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 260/689 (37%), Positives = 377/689 (54%), Gaps = 24/689 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + +  
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAA 63

Query: 64  ETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +  
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDK 123

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS 181
            K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 182 --DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG  +D++L     + + QE+K+L +   ++TDG ++++ Q  
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L + V
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMKGV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       + 
Sbjct: 304 SHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDNI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGEDIYVT 411
           + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF       G D+Y  
Sbjct: 364 MELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL   +        
Sbjct: 424 AYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDGLANAALPNIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
            +   +A+S +     +   + + +++   AC+ +K+ WR  H      W +L     C 
Sbjct: 484 RDVIREAKSWYDESVKRKSTYGLSERVF-IACDSLKRLWRRAHPATCDFWYELE----CT 538

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTATSQ 586
           V+   + + ++      L +RR    + I LPS R + Y      +G+ +Y+  N+ + +
Sbjct: 539 VRTAIA-TPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEQGNITYMGVNSYSRK 597

Query: 587 LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGT 646
             R +TYGGKL EN+ QA +RD+L   M      GY IVLTVHDE+++E+PDT  F+   
Sbjct: 598 WQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITESPDTEDFNDKA 657

Query: 647 LCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           L +L++ NP WA  +PL A G+EA  YRK
Sbjct: 658 LSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|260845239|ref|YP_003223017.1| putative DNA polymerase [Escherichia coli O103:H2 str. 12009]
 gi|257760386|dbj|BAI31883.1| putative DNA polymerase [Escherichia coli O103:H2 str. 12009]
          Length = 687

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 259/689 (37%), Positives = 377/689 (54%), Gaps = 24/689 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + +  
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAA 63

Query: 64  ETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +  +  P +RW  T V A  +GLP +L   C  L   +  
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGALGELCEVLGVPQDK 123

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS 181
            K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 182 --DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG  +D++L     + + QE+K+L +   ++TDG ++++ Q  
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L + V
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMKGV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       + 
Sbjct: 304 SHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDNI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGEDIYVT 411
           + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF       G D+Y  
Sbjct: 364 MELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL   +        
Sbjct: 424 AYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDGLANAALPNIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
            +   +A+S +     +   + + +++   AC+ +K+ WR  H      W +L     C 
Sbjct: 484 RDVIREAKSWYDESVKRKSTYGLSERVF-IACDSLKRLWRRAHPATCDFWYELE----CT 538

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTATSQ 586
           V+   + + ++      L +RR    + I LPS R + Y      +G+ +Y+  N+ + +
Sbjct: 539 VRTAIA-TPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEQGNITYMGVNSYSRK 597

Query: 587 LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGT 646
             R +TYGGKL EN+ QA +RD+L   M      GY IVLTVHDE+++E+PDT  F+   
Sbjct: 598 WQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITESPDTEDFNDKA 657

Query: 647 LCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           L +L++ NP WA  +PL A G+EA  YRK
Sbjct: 658 LSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|170023450|ref|YP_001719955.1| DNA-directed DNA polymerase [Yersinia pseudotuberculosis YPIII]
 gi|169749984|gb|ACA67502.1| DNA-directed DNA polymerase [Yersinia pseudotuberculosis YPIII]
          Length = 693

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 261/696 (37%), Positives = 377/696 (54%), Gaps = 32/696 (4%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L++D+ET S  P+ + G  AYA  A I L A+A DD PV + + TE   +P  L   LRD
Sbjct: 5   LWLDLETYSETPI-RNGTHAYAANAEIMLIAWAIDDGPVSVHEFTEPKNLPVPLCTALRD 63

Query: 64  ETVMCVAHNSLFERILFKKTL-GIDIPS------KRWICTSVLARTNGLPSSLKNACLAL 116
              +  AHNS F+R + +  L     P+       RW  T V A  +GLP SL + C  L
Sbjct: 64  GETLVYAHNSQFDRTVLRTHLKSYKWPNVAARDVTRWRDTMVKALAHGLPGSLSDLCDIL 123

Query: 117 NFSEHLTKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFK 175
             ++   K + GKALI  FCK  + +S     T+  H + W+ F +Y   D+EA RE+ K
Sbjct: 124 GVAQDKAKDKAGKALIQLFCKPRAKNSAIRRATKQTHPEEWKRFIDYAGLDIEAMREIDK 183

Query: 176 RLIPL---SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           +L P+      E  LW  DQ INDRG ++D  L       +  E+K+L      LTD  +
Sbjct: 184 KL-PVWNYQSNELALWHFDQRINDRGVQMDTVLAEAAVSAVEIEQKRLAVRTQDLTDNEV 242

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
           +++ Q   L  ++    G+ L DM   T++  +S  ++    ++L+  RL +S ++  K 
Sbjct: 243 QAATQRDVLLKHIVEAFGVTLPDMQASTIQRRVSDPDLPIELRELLAIRLQASTTSTSKY 302

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
            TL + VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E +   I+AL  G  
Sbjct: 303 KTLLKGVSKDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPVLGQETIDTGIEALKAGCA 362

Query: 353 ---IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----AN 404
                + + L S  +R CI+A  GKKLVV+DL+ IE R L W++GE+WK++AF       
Sbjct: 363 DLLFDNVMELISSALRGCIVAPEGKKLVVSDLSNIEGRALVWLSGEEWKLQAFRDYDAGT 422

Query: 405 GEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
           G D+Y+  YA+AFN   D V K QR IGKVMEL LG+ GG   F T A   GLDL   ++
Sbjct: 423 GHDLYMLAYARAFNISPDNVDKIQRQIGKVMELGLGFGGGVAAFLTFALVYGLDLDGLAK 482

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDL 524
                       +A+S +     Q   + + +++   AC+ +K+ WR  H   +  W ++
Sbjct: 483 AALPNVPASIQREAQSWYKASVKQKRTYGLSEQVF-IACDSLKRMWRNAHPKTVSFWYEI 541

Query: 525 TEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK---GDCSYL- 580
            +     +      + R+     +L +RR    + I LPS R + Y  ++   G  SY+ 
Sbjct: 542 EDTVRRAIA-----APRQTFTCRKLKIRRDGSWLRIQLPSGRAVCYPGIRIDEGKISYMG 596

Query: 581 -NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDT 639
            N+ + +  R +TYGGKLTEN+ QA +RD++   M     +GY+I LTVHDE+++E PDT
Sbjct: 597 INSYSRKWQRLKTYGGKLTENVTQAAARDVMANNMPLIETSGYEITLTVHDEVLTEAPDT 656

Query: 640 PYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             F+   L  L+  NP WA  LPL A G+EA  YRK
Sbjct: 657 EQFTSDKLSELLATNPEWALDLPLSAGGFEAYHYRK 692


>gi|332160957|ref|YP_004297534.1| putative DNA polymerase from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325665187|gb|ADZ41831.1| Putative DNA polymerase from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 669

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 256/678 (37%), Positives = 366/678 (53%), Gaps = 45/678 (6%)

Query: 32  LCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPS- 90
           +  YA +D+PV  WD T  + MP DL  YL+D ++   A NS F+R + +     D+PS 
Sbjct: 2   IITYALNDDPVSEWDITSGAKMPEDLKAYLQDPSIEIYAQNSHFDRTMMRH----DMPSV 57

Query: 91  -----KRWICTSVLARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKG-SIDSPP 144
                +RW  T V A  +GLP  L   C  L  ++   K +EGKALI  FCK  + +S  
Sbjct: 58  IAGGIERWRDTMVKALAHGLPGGLGVLCEILGITQDKAKDKEGKALIQLFCKPRAKNSTI 117

Query: 145 YDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL---SDGERDLWLLDQTINDRGYRI 201
           +  T   H + W+ F +Y   D+EA R + K+L P+      E  LW  DQ INDRG ++
Sbjct: 118 HRATSKTHPEEWKRFLKYAGNDIEAMRAIDKKL-PVWNYQGKELALWHFDQLINDRGVQM 176

Query: 202 DLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTL 261
           D  L       +  E+K L +    LTD  ++++ Q  AL  ++    G+DL DM + TL
Sbjct: 177 DTVLAEAAVTAVVDEQKLLAKRTQNLTDNEVQAATQRDALLRHIVESFGVDLPDMQKSTL 236

Query: 262 KSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWS 321
           +  ++   +  + ++L+  RL +S ++  K  TL + VS DGRLRGTLQF GASRTGRW+
Sbjct: 237 ERRIADPELPSVLRELLAIRLQASTTSTSKYKTLLKGVSKDGRLRGTLQFCGASRTGRWA 296

Query: 322 GCVFQPQNLPRQERSEEILTQTIQALNRGET---IADPLGLASDCVRSCIIASNGKKLVV 378
           G +FQPQNLPR    +E +   I+AL  G       + + L S  +R CI+A  GKKLVV
Sbjct: 297 GRLFQPQNLPRPVLDQETIDTGIEALKAGCADLLFDNVMELISSALRGCIVAPKGKKLVV 356

Query: 379 ADLAGIEARVLAWIAGEDWKIKAFAN----------------GEDIYVTTYAKAFNTPID 422
           +DL+ IE RVLAW+AGE+WK++AF +                G D+Y   YA+AFN   D
Sbjct: 357 SDLSNIEGRVLAWLAGEEWKLEAFRDYDTIIGYDEGGEALREGPDLYKLAYARAFNISPD 416

Query: 423 KVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHH 482
            V+K QR IGKVMEL LG+ GG   F T A   GLDL + +             +A+S +
Sbjct: 417 DVTKLQRQIGKVMELGLGFGGGVAAFLTFALVYGLDLDELANAALPNVPTSIQREAQSWY 476

Query: 483 LWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARR 542
                Q   F + +++   AC+ +K+ WR  H   +  W ++       +     I+ ++
Sbjct: 477 QASVKQKRTFGLSEQVF-IACDSLKRMWRNAHPETVSFWSEIENTVRRAI-----INPKQ 530

Query: 543 VANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK--GD-CSYL--NTATSQLMRERTYGGKL 597
                +L +RR    + I LPS R + Y  ++  GD  SY+  NT + +  R +TYGGKL
Sbjct: 531 TFVCRKLKIRRDGSWLRIQLPSGRSVCYPGIRIEGDKISYMGVNTYSRKWQRLKTYGGKL 590

Query: 598 TENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSW 657
            EN  QA +RD++   M      GY+I LTVHDE+++E PDT  F+   L  L+  NP W
Sbjct: 591 AENATQAAARDVMANNMPLIEARGYEITLTVHDEVLTEAPDTDAFTSDKLSELLATNPEW 650

Query: 658 AKGLPLKAEGYEAKRYRK 675
           A  LPL A G+EA  YRK
Sbjct: 651 ALDLPLSAGGFEAYHYRK 668


>gi|15837285|ref|NP_297973.1| phage-related DNA polymerase [Xylella fastidiosa 9a5c]
 gi|9105565|gb|AAF83493.1|AE003912_5 phage-related DNA polymerase [Xylella fastidiosa 9a5c]
          Length = 726

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 277/736 (37%), Positives = 374/736 (50%), Gaps = 85/736 (11%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET SP P+   GV AYAE A + L AYA  + PV++WD T  + +P DL   L D
Sbjct: 11  LWGDLETYSPVPMAH-GVHAYAEHAELLLFAYALGEGPVQVWDCTATATLPDDLSAALHD 69

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLT 123
             V+   HNS F+R + +   GIDIP +RW  +   A  + LP +L   C  L       
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEHA 128

Query: 124 KMEEGKALIARFCKGSIDSPPYDCT-----RANHVQAWQLFGEYCKRDVEATRELFKRLI 178
           K ++GK L+A FCK      P  CT     R  H   W  F EY +RDV A R++ KRL 
Sbjct: 129 KDKDGKRLVALFCKPR----PAHCTLRRATRDTHPTDWAQFVEYAQRDVAAMRDVVKRLP 184

Query: 179 P--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
               +  E  LW LDQTINDRG  ID DLV      + + ++ L +    LT G ++++ 
Sbjct: 185 SHNYAGAELALWFLDQTINDRGVLIDTDLVQAAIRAVERAKQTLAQRTEALTGGAVQAAT 244

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
           Q  AL  +L    G+ L DM + T+   +    + +  ++L+  R  +S ++  K   L 
Sbjct: 245 QRDALLQHLNTAHGVALPDMQQHTVARCVDDPALPETVRELLSIRRQASSTSTAKYQALL 304

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG---ETI 353
              S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+E++   I A+  G      
Sbjct: 305 HCTSPDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEVIAVGIDAMKAGCVDLVF 364

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN--------- 404
            D + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF           
Sbjct: 365 DDVMALTSSALRSCLIAPKNKKLVVADLSNIEGRVLAWLAGETPKLHAFREFDTCQGVDG 424

Query: 405 -------------------------------GEDIYVTTYAKAFNTPIDKVSKEQRAIGK 433
                                          G+DIY   YA +F      VSKEQR IGK
Sbjct: 425 TWHTGAAITHGALRGAPIALQRNADHAPIRRGDDIYKRAYAHSFGIAPQAVSKEQRQIGK 484

Query: 434 VMELALGYQGGAKVFKTMASHCGLDLQQFSQN-------VKSTSTFEDWEQAESHHLWMQ 486
           V ELALGY GG   F   A+   +DL+  +         ++  +   +W +A        
Sbjct: 485 VQELALGYGGGVGAFAAFAAMYHIDLEAMAAQAALPPLLLQQATELLEWTKA-------- 536

Query: 487 DQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANV 546
           +  P F + D+    AC++ K+AWR  H  +   W+ L   FA       +I     A+ 
Sbjct: 537 NHRPTFDLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ--FAVT----DAIHHPETAHT 589

Query: 547 PRLVMRRHKRD-VHIVLPSSRRLVYS----DVKGDCSYLNTA--TSQLMRERTYGGKLTE 599
              +  +++R  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL E
Sbjct: 590 CCGITVQYRRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRLTTYGGKLVE 649

Query: 600 NIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAK 659
           NI QA+SRD+L   M      GY IVLTVHDEI++E  D P F+   L +LM   P WA+
Sbjct: 650 NITQAVSRDVLAACMPAIEAAGYSIVLTVHDEIITEADDHPCFNAAHLAALMATPPPWAE 709

Query: 660 GLPLKAEGYEAKRYRK 675
           GLPL AEG++  RYRK
Sbjct: 710 GLPLAAEGFDTYRYRK 725


>gi|15839115|ref|NP_299803.1| phage-related DNA polymerase [Xylella fastidiosa 9a5c]
 gi|9107731|gb|AAF85323.1|AE004059_13 phage-related DNA polymerase [Xylella fastidiosa 9a5c]
          Length = 726

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 271/735 (36%), Positives = 368/735 (50%), Gaps = 83/735 (11%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET SP P+   GV AYAE A + L AYA  + PV++WD T  + +P DL   L D
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEHAELLLFAYALGEGPVQVWDCTATATLPDDLSAALHD 69

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLT 123
             V+   HNS F+R + +   GIDIP +RW  +   A  + LP +L   C  L       
Sbjct: 70  PGVLLYFHNSHFDRTVLRHC-GIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEHA 128

Query: 124 KMEEGKALIARFCKGSIDSPPYDCT-----RANHVQAWQLFGEYCKRDVEATRELFKRLI 178
           K ++GK L+A FCK      P  CT     R  H   W  F EY +RDV A R++ KRL 
Sbjct: 129 KDKDGKRLVALFCKPR----PAHCTLRRATRDTHPTDWAQFVEYAQRDVAAMRDVVKRLP 184

Query: 179 P--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
               +  E  LW LDQTINDRG  ID DLV      + + ++ L +    LT G ++++ 
Sbjct: 185 SHNYAGAELALWFLDQTINDRGVLIDTDLVQAAIRAVERAKQTLAQRTEALTGGAVQAAT 244

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
           Q  AL  +L    G+ L DM + T+   +    + +  ++L+  R  +S ++  K   L 
Sbjct: 245 QRDALLQHLNTAHGVALPDMQQHTVARCVDDPALPETVRELLSIRRQASSTSTAKYQALL 304

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNR---GETI 353
              S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+E++   I A+         
Sbjct: 305 HCTSPDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEVIAVGIDAMKADCVDLVF 364

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN--------- 404
            D + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF           
Sbjct: 365 DDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFREFDTCQGVDG 424

Query: 405 -------------------------------GEDIYVTTYAKAFNTPIDKVSKEQRAIGK 433
                                          G+DIY   YA +F      VSKEQR IGK
Sbjct: 425 CWHTGAAITHGALRAAPLALQRNADHAPIRRGDDIYKRAYAHSFGIAPQAVSKEQRQIGK 484

Query: 434 VMELALGYQGGAKVFKTMASHCGLDLQQFSQN-------VKSTSTFEDWEQAESHHLWMQ 486
           V ELALGY GG   F   A+   +DL+  +         ++  +   +W +A        
Sbjct: 485 VQELALGYGGGVGAFAAFAALYHIDLEAMAAQAVFPPLLLQEATELLEWTKA-------- 536

Query: 487 DQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANV 546
           +  P F + D+    AC++ K+AWR  H  +   W+ L       +    +         
Sbjct: 537 NHRPTFDLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQFAVTDAIHHPETTH-----TC 590

Query: 547 PRLVMRRHKRDVHIVLPSSRRLVYS----DVKGDCSYLNTA--TSQLMRERTYGGKLTEN 600
             + ++  +  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL EN
Sbjct: 591 CGITVQYRRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRLTTYGGKLVEN 650

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           I QA+SRD+L   M      GY IVLTVHDEI++E  D P F+   L +LM   P WA+G
Sbjct: 651 ITQAVSRDVLAACMPAIEAAGYSIVLTVHDEIITEADDHPCFNAAHLAALMATPPPWAEG 710

Query: 661 LPLKAEGYEAKRYRK 675
           LPL AEG++  RYRK
Sbjct: 711 LPLAAEGFDTYRYRK 725


>gi|71276267|ref|ZP_00652545.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71900322|ref|ZP_00682457.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71162875|gb|EAO12599.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71729897|gb|EAO31993.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  405 bits (1041), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 275/728 (37%), Positives = 370/728 (50%), Gaps = 69/728 (9%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET SP P+   GV AYAEQA + L AYA  + PV++WD T  + MP +L   L +
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAELLLFAYAIGNGPVQVWDCTATATMPEELSAALHN 69

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLT 123
             V+   HNS F+R + +   GIDIP +RW  +   A  + LP +L   C  L       
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQA 128

Query: 124 KMEEGKALIARFCKGSIDSPPYDCT-----RANHVQAWQLFGEYCKRDVEATRELFKRLI 178
           K ++GK L+A FCK      P  CT     R  H   W  F EY +RDV A R++ KRL 
Sbjct: 129 KAKDGKRLVALFCKPR----PAHCTLRRATRDTHPTEWAQFVEYARRDVAAMRDVVKRLP 184

Query: 179 P--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
               +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G+++++ 
Sbjct: 185 SHNYTGAELALWFLDQTINDRGVMVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAAT 244

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
           Q  AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L 
Sbjct: 245 QRDALLHHLSTEHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALL 304

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG---ETI 353
              S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+ ++   I A+  G      
Sbjct: 305 NCTSGDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDLVF 364

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN--------- 404
            D + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF +         
Sbjct: 365 DDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFRDFDTCQGVDG 424

Query: 405 -------------------------------GEDIYVTTYAKAFNTPIDKVSKEQRAIGK 433
                                          G+DIY   YA +F      V+KEQR IGK
Sbjct: 425 TWHSGEAITHGALRGAPITLQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKEQRQIGK 484

Query: 434 VMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFA 493
           V ELALGY GG   F   A+   +DL+  ++           E  E+      +Q P F 
Sbjct: 485 VQELALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPPLLLQ-EAVEALQWTKANQRPTFG 543

Query: 494 VKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRR 553
           + D+    AC++ K+AWR  H  +   WK L   FA         +A     +    M+ 
Sbjct: 544 LSDR-AWLACDVFKRAWRNAHPAIAAFWKALQ--FAATDAIRHPETAHTCCGI---TMQY 597

Query: 554 HKRDVHIVLPSSRRLVYS----DVKGDCSYLNT--ATSQLMRERTYGGKLTENIVQAISR 607
            +  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL ENI QA+SR
Sbjct: 598 SRAWLRMHLPSGRVLYYAAPRVDEHGALSYMGTHPMTRKWTRITTYGGKLVENITQAVSR 657

Query: 608 DILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEG 667
           D+L   M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+GLPL AEG
Sbjct: 658 DVLAACMPAIEAAGYQIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEG 717

Query: 668 YEAKRYRK 675
           ++  RYRK
Sbjct: 718 FQTHRYRK 725


>gi|28199026|ref|NP_779340.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|28199602|ref|NP_779916.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182681748|ref|YP_001829908.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|182682343|ref|YP_001830503.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|28057124|gb|AAO28989.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|28057717|gb|AAO29565.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182631858|gb|ACB92634.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|182632453|gb|ACB93229.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|307578624|gb|ADN62593.1| DNA-directed DNA polymerase [Xylella fastidiosa subsp. fastidiosa
           GB514]
 gi|307580177|gb|ADN64146.1| DNA-directed DNA polymerase [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 726

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 275/736 (37%), Positives = 374/736 (50%), Gaps = 85/736 (11%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET SP P+   GV AYAEQA + L AYA  + PV++WD T  + MP +L   L +
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGEGPVQVWDCTATATMPEELSAALHN 69

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLT 123
             V+   HNS F+R + +   GI IP +RW  +   A  + LP +L   C  L       
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GISIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQA 128

Query: 124 KMEEGKALIARFCKGSIDSPPYDCT-----RANHVQAWQLFGEYCKRDVEATRELFKRLI 178
           K ++GK L+A FCK      P  CT     R  H   W  F EY +RDV A R++ KRL 
Sbjct: 129 KAKDGKRLVALFCKPR----PTHCTLRRATRDTHPTEWAQFVEYARRDVTAMRDVVKRLP 184

Query: 179 P--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
               +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G+++++ 
Sbjct: 185 SHNYTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAAT 244

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
           Q  AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L 
Sbjct: 245 QRDALLHHLSTAHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALL 304

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG---ETI 353
              S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+E +T  I A+  G      
Sbjct: 305 NCTSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEAITVGIDAMKAGCVDLVF 364

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA---------- 403
            D + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF           
Sbjct: 365 DDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGEFDTCQGVDG 424

Query: 404 ------------------------------NGEDIYVTTYAKAFNTPIDKVSKEQRAIGK 433
                                          G+DIY   YA +F      V+K+QR IGK
Sbjct: 425 TWHSGEAITHGALRGAPIALQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGK 484

Query: 434 VMELALGYQGGAKVFKTMASHCGLDLQQFSQN-------VKSTSTFEDWEQAESHHLWMQ 486
           V ELALGY GG   F   A+   +DL+  +         ++  +   +W +A        
Sbjct: 485 VQELALGYGGGVGAFAAFAAMYHIDLEAMAAQAALPPLLLQEATELLEWTKA-------- 536

Query: 487 DQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANV 546
           +  P F + D+    AC++ K+AWR  H  +   W+ L     C V +  +I     A+ 
Sbjct: 537 NHRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ----CAVTD--AIGHPETAHT 589

Query: 547 PRLVMRRHKRD-VHIVLPSSRRLVYS----DVKGDCSYLNT--ATSQLMRERTYGGKLTE 599
              +  ++ R  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL E
Sbjct: 590 CCGITVQYSRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVE 649

Query: 600 NIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAK 659
           NI QA+SRD+L   M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+
Sbjct: 650 NITQAVSRDVLAACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQ 709

Query: 660 GLPLKAEGYEAKRYRK 675
           GLPL AEG+E  RYRK
Sbjct: 710 GLPLAAEGFETHRYRK 725


>gi|71898927|ref|ZP_00681094.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71731339|gb|EAO33403.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 275/736 (37%), Positives = 376/736 (51%), Gaps = 85/736 (11%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET SP P+   GV AYAEQA + L AYA  D PV++WD T  + MP +L   L +
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGDGPVQVWDCTATATMPEELSAALHN 69

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLT 123
             V+   HNS F+R + +   GI+IP +RW  +   A  + LP +L   C  L       
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GINIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQA 128

Query: 124 KMEEGKALIARFCKGSIDSPPYDCT-----RANHVQAWQLFGEYCKRDVEATRELFKRLI 178
           K ++GK L+A FCK      P  CT     R  H   W  F +Y +RDV A R++ KRL 
Sbjct: 129 KAKDGKRLVALFCKPR----PTHCTLRRATRDTHPTEWAQFVDYARRDVAAMRDVVKRLP 184

Query: 179 P--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
               +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G+++++ 
Sbjct: 185 SHNYTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAAT 244

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
           Q  AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L 
Sbjct: 245 QRDALLHHLSTEHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALL 304

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG---ETI 353
              S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+E +T  I A+  G      
Sbjct: 305 NCTSGDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEAITVGIDAMKAGCVDLVF 364

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN--------- 404
            D + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF +         
Sbjct: 365 DDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGDFDTCQGVDG 424

Query: 405 -------------------------------GEDIYVTTYAKAFNTPIDKVSKEQRAIGK 433
                                          G+DIY   YA +F      V+K+QR IGK
Sbjct: 425 TWHSGEAITHGALRGAPITLQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGK 484

Query: 434 VMELALGYQGGAKVFKTMASHCGLDLQQFSQN-------VKSTSTFEDWEQAESHHLWMQ 486
           V ELALGY GG   F   A+   +DL+  +         ++  +   +W +A        
Sbjct: 485 VQELALGYGGGVGAFAAFAAMYHIDLEAMAAQAALPPLLLQEATELLEWTKA-------- 536

Query: 487 DQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANV 546
           +  P F + D+    AC++ K+AWR  H  +   W+ L     C V +  +I     A+ 
Sbjct: 537 NHRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ----CAVTD--AIGHPETAHT 589

Query: 547 PRLVMRRHKRD-VHIVLPSSRRLVYS----DVKGDCSYLNTA--TSQLMRERTYGGKLTE 599
              +  ++ R  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL E
Sbjct: 590 CCGITVQYSRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVE 649

Query: 600 NIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAK 659
           NI QA+SRD+L   M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+
Sbjct: 650 NITQAVSRDVLAACMPAIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQ 709

Query: 660 GLPLKAEGYEAKRYRK 675
           GLPL AEG+E  RYRK
Sbjct: 710 GLPLAAEGFETHRYRK 725


>gi|273810426|ref|YP_003344897.1| DNA polymerase A [Xylella phage Xfas53]
 gi|257097801|gb|ACV41107.1| DNA polymerase A [Xylella phage Xfas53]
          Length = 726

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 275/736 (37%), Positives = 373/736 (50%), Gaps = 85/736 (11%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET SP P+   GV AYAEQA + L AYA    PV++WD T  + MP +L   L +
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGGGPVQVWDCTATATMPEELSAALHN 69

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLT 123
             V+   HNS F+R + +   GI IP +RW  +   A  + LP +L   C  L       
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GISIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQA 128

Query: 124 KMEEGKALIARFCKGSIDSPPYDCT-----RANHVQAWQLFGEYCKRDVEATRELFKRLI 178
           K ++GK L+A FCK      P  CT     R  H   W  F EY +RDV A R++ KRL 
Sbjct: 129 KAKDGKRLVALFCKPR----PTHCTLRRATRDTHPTEWAQFVEYARRDVTAMRDVVKRLP 184

Query: 179 P--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
               +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G+++++ 
Sbjct: 185 SHNYTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAAT 244

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
           Q  AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L 
Sbjct: 245 QRDALLHHLSTAHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALL 304

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG---ETI 353
              S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+E +T  I A+  G      
Sbjct: 305 NCTSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEAITVGIDAMKAGCVDLVF 364

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA---------- 403
            D + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF           
Sbjct: 365 DDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGEFDTCQGVDG 424

Query: 404 ------------------------------NGEDIYVTTYAKAFNTPIDKVSKEQRAIGK 433
                                          G+DIY   YA +F      V+K+QR IGK
Sbjct: 425 TWHSGEAITHGALRGAPIALQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGK 484

Query: 434 VMELALGYQGGAKVFKTMASHCGLDLQQFSQN-------VKSTSTFEDWEQAESHHLWMQ 486
           V ELALGY GG   F   A+   +DL+  +         ++  +   +W +A        
Sbjct: 485 VQELALGYGGGVGAFAAFAAMYHIDLEAMAAQAALPPLLLQEATELLEWTKA-------- 536

Query: 487 DQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANV 546
           +  P F + D+    AC++ K+AWR  H  +   W+ L     C V +  +I     A+ 
Sbjct: 537 NHRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ----CAVTD--AIGHPETAHT 589

Query: 547 PRLVMRRHKRD-VHIVLPSSRRLVYS----DVKGDCSYLNT--ATSQLMRERTYGGKLTE 599
              +  ++ R  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL E
Sbjct: 590 CCGITVQYSRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVE 649

Query: 600 NIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAK 659
           NI QA+SRD+L   M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+
Sbjct: 650 NITQAVSRDVLAACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQ 709

Query: 660 GLPLKAEGYEAKRYRK 675
           GLPL AEG+E  RYRK
Sbjct: 710 GLPLAAEGFETHRYRK 725


>gi|71901326|ref|ZP_00683422.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71728910|gb|EAO31045.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 274/729 (37%), Positives = 372/729 (51%), Gaps = 71/729 (9%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET SP P+   GV AYAEQA   L AYA  D PV++WD T  + MP +L   L +
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAQRLLFAYALGDGPVQVWDCTATATMPEELSAALHN 69

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLT 123
             V+   HNS F+R + +   GI+IP +RW  +   A  + LP +L   C  L       
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GINIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQA 128

Query: 124 KMEEGKALIARFCKGSIDSPPYDCT-----RANHVQAWQLFGEYCKRDVEATRELFKRLI 178
           K ++GK L+A FCK      P  CT     R  H   W  F +Y +RDV A R++ KRL 
Sbjct: 129 KAKDGKRLVALFCKPR----PTHCTLRRATRDTHPTEWAQFVDYARRDVAAMRDVVKRLP 184

Query: 179 P--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
               +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G+++++ 
Sbjct: 185 SHNYTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAAT 244

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
           Q  AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L 
Sbjct: 245 QRDALLHHLSTAHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALL 304

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG---ETI 353
              S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+ ++   I A+  G      
Sbjct: 305 NCTSGDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDLVF 364

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN--------- 404
            D + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K++AF +         
Sbjct: 365 DDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLQAFGDFDTCQGVDG 424

Query: 405 -------------------------------GEDIYVTTYAKAFNTPIDKVSKEQRAIGK 433
                                          GEDIY   YA +F      V+K+QR IGK
Sbjct: 425 TWHSGEAITHGALRGAPITLQWNAEHEPIRKGEDIYKRAYAHSFGIAPQAVTKQQRQIGK 484

Query: 434 VMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFA 493
           V ELALGY GG   F   A+   +DL+  ++           E  E+      +  P F 
Sbjct: 485 VQELALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPPLLLQ-EAVEALQWTKANHRPTFG 543

Query: 494 VKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRR 553
           + D+    AC++ K+AWR  H  +   W+ L     C V +  +I     A+    +  +
Sbjct: 544 LSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ----CAVTD--AIGHPETAHTCCGITVQ 596

Query: 554 HKRD-VHIVLPSSRRLVYS----DVKGDCSYLNTA--TSQLMRERTYGGKLTENIVQAIS 606
           + R  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL ENI QA+S
Sbjct: 597 YSRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVS 656

Query: 607 RDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAE 666
           RD+L   M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+GLPL AE
Sbjct: 657 RDVLAACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAE 716

Query: 667 GYEAKRYRK 675
           G+E  RYRK
Sbjct: 717 GFETHRYRK 725


>gi|71899884|ref|ZP_00682032.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71730324|gb|EAO32407.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 274/730 (37%), Positives = 374/730 (51%), Gaps = 73/730 (10%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET SP P+   GV AYAEQA + L AYA  D PV++WD T  + MP +L   L +
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGDGPVQVWDCTATATMPEELSAALHN 69

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLT 123
             V+   HNS F+R + +   GI+IP +RW  +   A  + LP +L   C  L       
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GINIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQA 128

Query: 124 KMEEGKALIARFCKGSIDSPPYDCT-----RANHVQAWQLFGEYCKRDVEATRELFKRLI 178
           K ++GK L+A FCK      P  CT     R  H   W  F +Y +RDV A R++ KRL 
Sbjct: 129 KAKDGKRLVALFCKPR----PTHCTLRRATRDTHPTEWAQFVDYARRDVTAMRDVVKRLP 184

Query: 179 P--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
               +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G+++++ 
Sbjct: 185 SHNYTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAAT 244

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
           Q  AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L 
Sbjct: 245 QRDALLHHLSTEHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALL 304

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG---ETI 353
              S DGRLRGTLQF GASRTGRW+G + QP NLPR   S+ ++   I A+  G      
Sbjct: 305 NCTSGDGRLRGTLQFNGASRTGRWAGRLLQPHNLPRPTLSQPVIAVGIDAMKAGCVDLVF 364

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN--------- 404
            D + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF +         
Sbjct: 365 DDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGDFDTCQGVDG 424

Query: 405 -------------------------------GEDIYVTTYAKAFNTPIDKVSKEQRAIGK 433
                                          G+DIY   YA +F      V+K+QR IGK
Sbjct: 425 TWHSGEAITHGALRGAPITLQWNAEHEPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGK 484

Query: 434 VMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQ-DQYPEF 492
           V ELALGY GG   F   A+   +DL+  ++           +QA     W + +Q P F
Sbjct: 485 VQELALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPPLL--LQQAMEALQWTKANQRPTF 542

Query: 493 AVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMR 552
            + D+    AC++ K+AWR  H  +   W+ L     C V +  +I     A+    +  
Sbjct: 543 GLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ----CAVTD--AIGHPETAHTCCGITV 595

Query: 553 RHKRD-VHIVLPSSRRLVYS----DVKGDCSYLNTA--TSQLMRERTYGGKLTENIVQAI 605
           ++ R  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL ENI QA+
Sbjct: 596 QYSRAWLRMRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAV 655

Query: 606 SRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKA 665
           SRD+L   M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+GLPL A
Sbjct: 656 SRDVLAACMPAIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAA 715

Query: 666 EGYEAKRYRK 675
           EG+E  RYRK
Sbjct: 716 EGFETHRYRK 725


>gi|144453|gb|AAA23103.1| putative DNA polymerase [Citrus greening disease-associated
           bacterium]
          Length = 206

 Score =  399 bits (1024), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/206 (91%), Positives = 194/206 (94%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSP+PLPKVGVWAYAEQA+ITLCAYAWD EPVKLWDRT+QSA+PSDLLQY
Sbjct: 1   MSKLFIDIETRSPKPLPKVGVWAYAEQAIITLCAYAWDGEPVKLWDRTKQSAIPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLAL F E
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALRFPE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTK EEGKALIARFCKGSIDSPPYDCTRANHVQAW LF EYCKRDVEATRELFK L PL
Sbjct: 121 HLTKKEEGKALIARFCKGSIDSPPYDCTRANHVQAWALFREYCKRDVEATRELFKSLTPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLV 206
           +  ER LWLLDQ INDRGYRIDLDLV
Sbjct: 181 NPEERTLWLLDQEINDRGYRIDLDLV 206


>gi|170730324|ref|YP_001775757.1| phage-related DNA polymerase [Xylella fastidiosa M12]
 gi|167965117|gb|ACA12127.1| phage-related DNA polymerase [Xylella fastidiosa M12]
          Length = 726

 Score =  399 bits (1024), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 273/728 (37%), Positives = 368/728 (50%), Gaps = 69/728 (9%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET SP P+   GV AYAEQA + L AYA  + PV++WD T  + MP +L   L +
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAELLLFAYAIGNGPVQVWDCTATATMPEELSAALHN 69

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLT 123
             V+   HNS F+R + +   GIDIP +RW  +   A  + LP +L   C  L       
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQA 128

Query: 124 KMEEGKALIARFCKGSIDSPPYDCT-----RANHVQAWQLFGEYCKRDVEATRELFKRLI 178
           K ++GK L+A FCK      P  CT     R  H   W  F EY +RDV A R++ KRL 
Sbjct: 129 KAKDGKRLVALFCKPR----PTHCTLRRATRDTHPTDWAQFVEYARRDVAAMRDVVKRLP 184

Query: 179 P--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
               S  E  LW LDQTINDRG  +D DL       + + +  L      LT G ++++ 
Sbjct: 185 SHNYSGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKCTLAHRTEALTGGAVQAAT 244

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
           Q  AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L 
Sbjct: 245 QRDALLHHLSTEHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALL 304

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG---ETI 353
              S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+ ++   I A+  G      
Sbjct: 305 NCTSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDVVF 364

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN--------- 404
            D + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF +         
Sbjct: 365 DDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGDFDTCQGVDG 424

Query: 405 -------------------------------GEDIYVTTYAKAFNTPIDKVSKEQRAIGK 433
                                          G+DIY   YA +F      V+KEQR IGK
Sbjct: 425 TWHSGEAITHGALRGAPITLQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKEQRQIGK 484

Query: 434 VMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFA 493
           V ELALGY GG   F   A+   +DL+  ++           E  E+      +Q P F 
Sbjct: 485 VQELALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPPLLLQ-EAVEALQWTKANQRPTFG 543

Query: 494 VKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRR 553
           + D+    AC++ K+AWR  H  +   W+ L   FA     G   +A     +    ++ 
Sbjct: 544 LSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ--FAATDAIGHPETAHTCCGI---TVQY 597

Query: 554 HKRDVHIVLPSSRRLVYS----DVKGDCSYLNTA--TSQLMRERTYGGKLTENIVQAISR 607
            +  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL ENI QA+SR
Sbjct: 598 SRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSR 657

Query: 608 DILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEG 667
           D+L   M      GY IVLTVHDE+++E  D   F+   L +LM   P WA+GLPL AEG
Sbjct: 658 DVLAACMPAIEAAGYAIVLTVHDEMITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEG 717

Query: 668 YEAKRYRK 675
           ++  RYRK
Sbjct: 718 FQTHRYRK 725


>gi|298240|gb|AAB25243.1| DNA polymerase homolog [bacterium-like organism, citrus greening
           disease-associated, Peptide, 207 aa]
          Length = 207

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 194/206 (94%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           +SKLFIDIETRSP+PLPKVGVWAYAEQA+ITLCAYAWD EPVKLWDRT+QSA+PSDLLQY
Sbjct: 2   VSKLFIDIETRSPKPLPKVGVWAYAEQAIITLCAYAWDGEPVKLWDRTKQSAIPSDLLQY 61

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLAL F E
Sbjct: 62  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALRFPE 121

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTK EEGKALIARFCKGSIDSPPYDCTRANHVQAW LF EYCKRDVEATRELFK L PL
Sbjct: 122 HLTKKEEGKALIARFCKGSIDSPPYDCTRANHVQAWALFREYCKRDVEATRELFKSLTPL 181

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLV 206
           +  ER LWLLDQ INDRGYRIDLDLV
Sbjct: 182 NPEERTLWLLDQEINDRGYRIDLDLV 207


>gi|318064432|gb|ADV36447.1| DNA polymerase I [Edwardsiella phage eiAU]
 gi|318064540|gb|ADV36499.1| DNA polymerase I [Edwardsiella phage eiDWF]
 gi|318064644|gb|ADV36551.1| DNA polymerase I [Edwardsiella phage eiMSLS]
          Length = 735

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 270/736 (36%), Positives = 367/736 (49%), Gaps = 69/736 (9%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRT----------EQS 51
           LF+D ET S   L KVG +AYAE     I L +YA+DD P K+WD T          + +
Sbjct: 5   LFLDFETFSEADLKKVGAYAYAEHDSTEILLASYAFDDGPAKVWDATCASGESDIDLDNN 64

Query: 52  AMPSDLLQYLRDET---VMCVAHNSL-FERILFKKTLGIDIPSKRWICTSVLARTNGLPS 107
           + P DLL+ LR      V  V HN L F+R++ ++ LG+DIP +    T V A  + LP 
Sbjct: 65  SAPDDLLRGLRRAKRGRVKLVMHNGLMFDRLIIRECLGLDIPPEHIHDTMVQAFRHALPG 124

Query: 108 SLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPP---YDCTRANHVQAWQLFGEYCK 164
           SL   C  LN    L K + GKALI RFCK +  +     YD  R  H   W+ F  Y +
Sbjct: 125 SLDKLCEVLNVDADLAKDKAGKALIKRFCKPTPKNYKIRRYD--RNTHPDEWKQFKHYAR 182

Query: 165 RDVEATRELFKRLIPLS--DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
            D+ A RE++ ++      D E ++  LDQ INDRG+ +D DL       +A  R +L E
Sbjct: 183 NDITAMREIYYKMPSWGEIDKENEILALDQRINDRGFYVDTDLAKAATAAVAAARAELQE 242

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
                  G +  +     LR    L     + +  + TL  +L  +++   A+ +I  RL
Sbjct: 243 AAQATYGGGLTGADFLPLLRD---LAPAHHIPNAQKSTLGDLLDDADLPDEARQVIEMRL 299

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
            ++ +A  K   L   +S+DGR RG LQ+ GA RT RW+G  FQPQNL R    E+ L +
Sbjct: 300 GAASTASTKYAPLLNGMSADGRRRGCLQYGGAKRTLRWAGKGFQPQNLARGYFKEKPLAR 359

Query: 343 TIQALNRG--ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
            I+AL RG  E   D + LA+  VR CII + GKKLVVAD + +E R LAW+AGED  + 
Sbjct: 360 GIEALKRGTAEYAFDVMKLAASTVRGCIIPAPGKKLVVADYSNVEGRGLAWLAGEDSALD 419

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQ 460
            F  G DIY  T  K F    D V   +R IGK  EL LGY GG   F T + + GLDL+
Sbjct: 420 TFRAGLDIYKVTAGKMFGISPDDVDGYRRQIGKACELGLGYGGGVAAFLTFSKNLGLDLE 479

Query: 461 QFSQNVKSTSTFEDWEQAESHHLWMQDQ----YPEFAVKD--------KLIGTACELVKK 508
           + +  +  T     W  A   + +M+ Q     P    KD        K     C+ +K+
Sbjct: 480 EMAVTMAGTFPDYHWRAALRAYEFMKLQEVKRKPLPGKKDDRTTVVLSKKAWLTCDCIKR 539

Query: 509 AWRAKHQGVLQLWKDLTEGFACVVQEGGSI---------SARRVANVPRLVMRRHKRD-- 557
            WR  H   +Q W DL E     +   G+            +R   + R + R  K    
Sbjct: 540 MWRESHPRTVQFWYDLEEACLMAIDNPGASYWAGAKVRQDGKRAIRIERTLTRSGKPGNW 599

Query: 558 VHIVLPSSRRLVYSDVKGDCSYLNT--------------ATSQLMR----ERTYGGKLTE 599
           + I LPS R L Y  +       N                 +QL R    + TYGGKL E
Sbjct: 600 LKIELPSGRILSYPGIGVSMEKTNEDDPGEKARPRIKYRGENQLTRQWGWQHTYGGKLAE 659

Query: 600 NIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAK 659
           N+ QA+ RDIL   M      GY+I+L+VHDE+++ETPDT  ++V  L  LM   P+WAK
Sbjct: 660 NVTQALCRDILAWCMLPVDNAGYEIILSVHDELITETPDTAEYNVAELERLMCDLPAWAK 719

Query: 660 GLPLKAEGYEAKRYRK 675
           G PLKAEG+E  RY+K
Sbjct: 720 GFPLKAEGWEGYRYKK 735


>gi|71901491|ref|ZP_00683578.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71728747|gb|EAO30891.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 712

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 264/719 (36%), Positives = 363/719 (50%), Gaps = 73/719 (10%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           S L+ D+ET SP P+   GV AYAEQA + L AYA  D PV++WD T  + MP +L   L
Sbjct: 9   SILWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGDGPVQVWDCTATATMPEELSAAL 67

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEH 121
            +  V+   HNS F+R + +   GI+IP +RW  +   A  + LP +L   C  L     
Sbjct: 68  HNPAVLLYFHNSHFDRTVLRHC-GINIPLERWRDSMAQALAHALPGALGTLCELLRVPVE 126

Query: 122 LTKMEEGKALIARFCKGSIDSPPYDCT-----RANHVQAWQLFGEYCKRDVEATRELFKR 176
             K ++GK L+A FCK      P  CT     R  H   W  F +Y +RDV A R++ KR
Sbjct: 127 QAKAKDGKRLVALFCKPR----PTHCTLRRATRDTHPTEWAQFVDYARRDVTAMRDVVKR 182

Query: 177 LIP--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRS 234
           L     +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G++++
Sbjct: 183 LPSHNYTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQA 242

Query: 235 SRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNT 294
           + Q  AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   
Sbjct: 243 ATQRDALLHHLSTEHGVVLPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQA 302

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG---E 351
           L    S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+ ++   I A+  G    
Sbjct: 303 LLNCTSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDV 362

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN------- 404
              D + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K++AF +       
Sbjct: 363 VFDDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLQAFGDFDTCQGV 422

Query: 405 ---------------------------------GEDIYVTTYAKAFNTPIDKVSKEQRAI 431
                                            G+DIY   YA +F      V+KEQR I
Sbjct: 423 DGTWHSGEAITHGALRGAPIALQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKEQRQI 482

Query: 432 GKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQY-P 490
           GKV ELALGY GG   F   A+   +DL+  ++           +QA     W +  + P
Sbjct: 483 GKVQELALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPPLL--LQQAVEALQWTKANHRP 540

Query: 491 EFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLV 550
            F + D+    AC++ K+AWR  H  +   W+ L     C V +  +I     A+    +
Sbjct: 541 TFGLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ----CAVTD--AIGHPETAHTCCGI 593

Query: 551 MRRHKRD-VHIVLPSSRRLVYS----DVKGDCSYLNTA--TSQLMRERTYGGKLTENIVQ 603
             ++ R  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL ENI Q
Sbjct: 594 TVQYSRAWLRMRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQ 653

Query: 604 AISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLP 662
           A+SRD+L   M      GY IVLTVHDEI++E  D   F+   L +LM   P   +G P
Sbjct: 654 AVSRDVLAACMPAIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPGHRGCP 712


>gi|309702940|emb|CBJ02271.1| putative phage DNA polymerase [Escherichia coli ETEC H10407]
          Length = 598

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 225/589 (38%), Positives = 324/589 (55%), Gaps = 22/589 (3%)

Query: 103 NGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGE 161
            G   +L   C  L   +   K +EGKALI  FCK    +S     T   H + W+ F  
Sbjct: 15  GGSGGALGELCEVLGVPQDKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVA 74

Query: 162 YCKRDVEATRELFKRLIP--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKK 219
           Y   D+EA RE++KRL        E  LW  DQ INDRG  +D++L     + + QE+K+
Sbjct: 75  YAGLDIEAMREVYKRLPKWNYQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKR 134

Query: 220 LDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLIL 279
           L +   ++TDG ++++ Q  AL  ++    G++L DM   TL+  ++  ++    K+L+ 
Sbjct: 135 LAKRTQEMTDGEVQAATQRDALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLA 194

Query: 280 NRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEI 339
            RL +S ++  K   L + VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E 
Sbjct: 195 IRLQASTTSTSKYKALMKGVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQ 254

Query: 340 LTQTIQALNRGET---IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           + + I+AL  G       + + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+
Sbjct: 255 IDEGIEALKAGCADLLFDNIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEE 314

Query: 397 WKIKAF-----ANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           WK+ AF       G D+Y   YAKAF+   D V K  R IGKVMEL LGY GG   F T 
Sbjct: 315 WKLNAFREYDAGTGPDLYKLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITF 374

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
           A   GLDL   +         +   +A+S +     +   + + +++   AC+ +K+ WR
Sbjct: 375 ALVYGLDLDGLANAALPNIPRDVIREAKSWYDESVKRKSTYGLSERVF-IACDSLKRLWR 433

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
             H      W +L     C V+   + + ++      L +RR    + I LPS R + Y 
Sbjct: 434 RAHPATCDFWYELE----CTVRTAIA-TPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYP 488

Query: 572 DV---KGDCSYL--NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVL 626
                +G+ +Y+  N+ + +  R +TYGGKL EN+ QA +RD+L   M      GY IVL
Sbjct: 489 SPVIEQGNITYMGVNSYSRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVL 548

Query: 627 TVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           TVHDE+++E+PDT  F+   L +L++ NP WA  +PL A G+EA  YRK
Sbjct: 549 TVHDEVITESPDTEDFNDKALSALLSTNPEWAPDIPLNAGGFEAYHYRK 597


>gi|282534222|gb|ADA82330.1| putative DNA polymerase [Escherichia phage K1H]
          Length = 726

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 257/732 (35%), Positives = 356/732 (48%), Gaps = 63/732 (8%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           MS LF+D ET S   L KVG +AYAE     + +C YA+DDEPV++WD T  S MP DL 
Sbjct: 1   MSYLFLDFETFSEADLKKVGSYAYAEHPTTEVLICTYAFDDEPVQVWDCTNGSDMPGDLH 60

Query: 59  QYLR-----DETVMCVAHN-SLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNA 112
           + LR     +  +  V HN S+F+R++ K   G DIP    I T + A  + LP SL   
Sbjct: 61  RALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFDIPVSNTIDTMIWAFRHALPGSLDAL 120

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTR---ANHVQAWQLFGEYCKRDVEA 169
           C  L  S    K + GKALI RF K +  +  Y   R     H   W LF +Y   D+ A
Sbjct: 121 CEVLGVSADNAKDKRGKALIQRFSKPTPKN--YKIRRYTAETHPDEWALFIKYAVSDITA 178

Query: 170 TRELFKRLIPLSDGERD--LWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
            RE+F +L    + E +  +  LDQ INDRG+++D+ L     E + + + +L E+  + 
Sbjct: 179 MREVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVALAEAAIEAVEKHKAQLQEEAQRK 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
             G +        LR    L     + +  + TL  +L+  ++   A+ +I  RL ++ +
Sbjct: 239 YGGSLTGKDFLPILRE---LAPAHRIHNAQKSTLNDLLADDDLPDDARTIIEMRLGAAST 295

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           A  K N L    SSD R RG +Q+ GA RT R++G  FQPQNL R    ++ L + I AL
Sbjct: 296 ASTKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKGFQPQNLARGYYHDDELDKGISAL 355

Query: 348 NRGETIA--DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
            +G      D   L +  VRSCII   G K VVAD + +E R LAW+AGE+  +  F  G
Sbjct: 356 LKGRAHRRFDVAKLTASTVRSCIIPEAGHKFVVADYSNVEGRGLAWLAGEETALDTFRAG 415

Query: 406 EDIYVTTYAKAFNTPIDKVSKEQ---RAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
            DIY  T  K F    D + KE+   R IGK  EL LGY GG   F   A + GLDL   
Sbjct: 416 LDIYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGLGYAGGVGAFVQFAKNLGLDLVDM 475

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQ-------------DQYPEFAVKDKLIGTACELVKKA 509
           ++ +  T     W      + W +             D  P + + DK +   C+ +K+ 
Sbjct: 476 TKTMDGTFPDHIWAATARGYEWARIQEAKRPPRPGENDDRPSY-ILDKKVWRTCDAIKRM 534

Query: 510 WRAKHQGVLQLWKDLTEGFACVVQEGGS--ISARRVANVPRLVMRRHKRD------VHIV 561
           WR  H   +  W+D+ +     ++  G    +  R     R V   +  +      + + 
Sbjct: 535 WRESHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVKFSRNVETDNNGNKVAGWWLRMT 594

Query: 562 LPSSRRLVY----------SDVKGDCSY--------LNTATSQLMRERTYGGKLTENIVQ 603
           LPS R + Y          +D  G  S          N  T Q   + TY GKL EN  Q
Sbjct: 595 LPSGRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGENQLTRQWGFQYTYSGKLVENCTQ 654

Query: 604 AISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPL 663
           A+ RD+L   + N   NGY IVL VHDEI+ ETPD P ++V  L  LM + P WA+G PL
Sbjct: 655 ALCRDLLANALLNVEANGYPIVLHVHDEIICETPDLPEYNVAELERLMCELPEWAEGFPL 714

Query: 664 KAEGYEAKRYRK 675
            AEG E KRY K
Sbjct: 715 VAEGAEMKRYAK 726


>gi|282533171|gb|ADA82280.1| putative DNA polymerase [Escherichia phage K1G]
          Length = 726

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 257/732 (35%), Positives = 356/732 (48%), Gaps = 63/732 (8%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           MS LF+D ET S   L KVG +AYAE     + +C YA+DDEPV++WD T  S MP DL 
Sbjct: 1   MSYLFLDFETFSEADLKKVGSYAYAEHPTTEVLICTYAFDDEPVQVWDCTNGSDMPGDLH 60

Query: 59  QYLR-----DETVMCVAHN-SLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNA 112
           + LR     +  +  V HN S+F+R++ K   G DIP    I T + A  + LP SL   
Sbjct: 61  RALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFDIPVSNTIDTMIWAFRHALPGSLDAL 120

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTR---ANHVQAWQLFGEYCKRDVEA 169
           C  L  S    K + GKALI RF K +  +  Y   R     H   W LF +Y   D+ A
Sbjct: 121 CEVLGVSADNAKDKRGKALIQRFSKPTPKN--YKIRRYTAETHPDEWALFIKYAVSDITA 178

Query: 170 TRELFKRLIPLSDGERD--LWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
            RE+F +L    + E +  +  LDQ INDRG+++D+ L     E + + + +L E+  + 
Sbjct: 179 MREVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVALAEAAIEAVEKHKAQLQEEAQRK 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
             G +        LR    L     + +  + TL  +L+  ++   A+ +I  RL ++ +
Sbjct: 239 YGGSLTGKDFLPILRE---LAPAHRIHNAQKSTLNDLLADDDLPDDARTIIEMRLGAAST 295

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           A  K N L    SSD R RG +Q+ GA RT R++G  FQPQNL R    ++ L + I AL
Sbjct: 296 ASTKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKGFQPQNLARGYYHDDELDKGISAL 355

Query: 348 NRGETIA--DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
            +G      D   L +  VRSCII   G K VVAD + +E R LAW+AGE+  +  F  G
Sbjct: 356 LKGRAHRRFDVAKLTASTVRSCIIPEAGHKFVVADYSNVEGRGLAWLAGEETALDTFRAG 415

Query: 406 EDIYVTTYAKAFNTPIDKVSKEQ---RAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
            DIY  T  K F    D + KE+   R IGK  EL LGY GG   F   A + GLDL   
Sbjct: 416 LDIYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGLGYAGGVGAFVQFAKNLGLDLVDM 475

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQ-------------DQYPEFAVKDKLIGTACELVKKA 509
           ++ +  T     W      + W +             D  P + + DK +   C+ +K+ 
Sbjct: 476 AKTMDGTFPDYIWAATARGYEWARIQEAKRPPRPGENDDRPSY-ILDKKVWRTCDAIKRM 534

Query: 510 WRAKHQGVLQLWKDLTEGFACVVQEGGS--ISARRVANVPRLVMRRHKRD------VHIV 561
           WR  H   +  W+D+ +     ++  G    +  R     R V   +  +      + + 
Sbjct: 535 WRESHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVKFSRNVETDNNGNKVAGWWLRMT 594

Query: 562 LPSSRRLVY----------SDVKGDCSY--------LNTATSQLMRERTYGGKLTENIVQ 603
           LPS R + Y          +D  G  S          N  T Q   + TY GKL EN  Q
Sbjct: 595 LPSGRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGENQLTRQWGFQYTYSGKLVENCTQ 654

Query: 604 AISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPL 663
           A+ RD+L   + N   NGY IVL VHDEI+ ETPD P ++V  L  LM + P WA+G PL
Sbjct: 655 ALCRDLLANALLNVEANGYPIVLHVHDEIICETPDLPEYNVAELERLMCELPEWAEGFPL 714

Query: 664 KAEGYEAKRYRK 675
            AEG E KRY K
Sbjct: 715 VAEGAEMKRYAK 726


>gi|9633592|ref|NP_051006.1| P45 [Acyrthosiphon pisum bacteriophage APSE-1]
 gi|9910664|sp|Q9T1Q3|DPOL_BPAPS RecName: Full=Probable DNA polymerase; AltName: Full=P45
 gi|6118040|gb|AAF03988.1|AF157835_45 P45 [Endosymbiont phage APSE-1]
          Length = 993

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 232/610 (38%), Positives = 331/610 (54%), Gaps = 24/610 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           LF D+ET S  P+   G   YAE A I L AYA++  PVK+WD T+   MP+DL  YL D
Sbjct: 5   LFCDLETYSDIPI-NCGTHRYAENAEILLFAYAYNHAPVKVWDVTQDKTMPADLKAYLDD 63

Query: 64  ETVMCVAHNS-LFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
             ++ V HN  +F+ ++ K+ L ID+P  R   T V A  +GLP +L   C   N +   
Sbjct: 64  SEILTVWHNGGMFDTVILKRVLNIDLPLSRVHDTLVQALAHGLPGALGLLCDIFNVNSDK 123

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP-- 179
            K +EGKALI+  CK    +S     T   H + WQ F +Y   D+ A RE+++ L    
Sbjct: 124 AKDKEGKALISLLCKPRPKNSKIQRATALTHAEEWQRFKDYAGSDILAMREIYQHLPNWN 183

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
           ++  E +LW LDQ IN RG  +D++L       +  E+K+L     +LTD  ++++ Q  
Sbjct: 184 MNVHETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    GI L DM   TL+  ++  +I    ++L+  RL S  ++  K   L ++V
Sbjct: 244 ALLQHIASAFGITLPDMQASTLQRRINDPDIPPALRELLSVRLQSCTTSTSKYKALLKSV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP- 356
           S+DGRLRGT QF GASRTGRW+G VFQP NLPR       +   I+AL  G  E I D  
Sbjct: 304 SADGRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICDDI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVT 411
           + L S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+ AF+      G+D+Y  
Sbjct: 364 MQLTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YA+AFN   + V+KEQR IGKVMEL LGY GG   F T A   GLDL + ++       
Sbjct: 424 AYARAFNLLPEDVTKEQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPNIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
                +A   +    +    + + +K+  T C+ +K+ WR  H   +  W D+ +     
Sbjct: 484 PGVKREAMRWYQKSVETDKTYGLSEKIFVT-CDSLKRMWRNAHPQTVSFWYDIEDAVKQA 542

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK---GDCSYL--NTATSQ 586
           +Q  G     R     +L +RR K  + I LPS R L Y   +   G  +Y+  N  + +
Sbjct: 543 IQSPGIAFKCR-----KLSVRRDKSWLRICLPSGRSLCYPSARIENGQITYMGTNPYSRK 597

Query: 587 LMRERTYGGK 596
             R +TYGGK
Sbjct: 598 WERLKTYGGK 607



 Score = 91.3 bits (225), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 51/77 (66%)

Query: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658
           ENI QA +RD+L   M    K GY+IVLTVHDEI+SE PDTP FS   L  L++ N  WA
Sbjct: 916 ENICQAAARDVLAYNMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKLLSFNSDWA 975

Query: 659 KGLPLKAEGYEAKRYRK 675
             LPL A G+E  RYRK
Sbjct: 976 WDLPLSANGFETYRYRK 992


>gi|212499741|ref|YP_002308549.1| DNA polymerase [Bacteriophage APSE-2]
 gi|238898732|ref|YP_002924413.1| APSE-2 prophage; DNA polymerase [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|211731710|gb|ACJ10198.1| DNA polymerase [Bacteriophage APSE-2]
 gi|229466491|gb|ACQ68265.1| APSE-2 prophage; DNA polymerase [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 993

 Score =  369 bits (946), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 231/610 (37%), Positives = 331/610 (54%), Gaps = 24/610 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           LF D+ET S  P+   G   YAE A I L AYA++  PVK+WD T+   MP+DL  Y  D
Sbjct: 5   LFCDLETYSDIPI-NCGTHRYAENAEILLFAYAYNHAPVKVWDVTQDKTMPADLKAYFDD 63

Query: 64  ETVMCVAHNS-LFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
             ++ V HN  +F+ ++ K+ L ID+P  R   T V A  +GLP +L   C   N +   
Sbjct: 64  SEILTVWHNGGMFDTVILKRVLNIDLPLSRVHDTLVQALAHGLPGALGLLCDIFNVNSDK 123

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP-- 179
            K +EGKALI+  CK    +S     T   H + WQ F +Y   D+ A RE+++ L    
Sbjct: 124 AKDKEGKALISLLCKPRPKNSKIQRATALTHAEEWQRFKDYAGSDILAMREIYQHLPNWN 183

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
           ++  E +LW LDQ IN RG  +D++L       +  E+K+L     +LTD  ++++ Q  
Sbjct: 184 MNVDETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    GI L DM   TL+  ++  +I    ++L+  RL S  ++  K   L ++V
Sbjct: 244 ALLQHIASAFGITLPDMQASTLQRRINDPDIPPDLRELLSVRLQSCTTSTSKYKALLKSV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP- 356
           S+DGRLRGT QF GASRTGRW+G VFQP NLPR       +   I+AL  G  E I D  
Sbjct: 304 SADGRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICDDI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVT 411
           + L S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+KAF+      G+D+Y  
Sbjct: 364 MQLTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YA+AFN   + V+K+QR IGKVMEL LGY GG   F T A   GLDL + ++       
Sbjct: 424 AYARAFNLLPEDVTKDQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPHIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
                +A S +    +    + + +K+    C+ +K+ WR  H   +  W D+ +     
Sbjct: 484 PGVKREATSWYQKSVETDKTYGLSEKIF-VNCDSLKRMWRNAHPQTVSFWYDIEDAVKQA 542

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK---GDCSYL--NTATSQ 586
           +Q  G     R     +L +RR K  + I LPS R L Y   +   G  +Y+  N  + +
Sbjct: 543 IQSPGIAFKCR-----KLSVRRDKGWLRICLPSGRSLCYPSARIENGQITYMGTNPYSRK 597

Query: 587 LMRERTYGGK 596
             R +TYGGK
Sbjct: 598 WERLKTYGGK 607



 Score = 91.3 bits (225), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 51/77 (66%)

Query: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658
           ENI QA +RD+L   M    K GY+IVLTVHDEI+SE PDTP FS   L  L++ N  WA
Sbjct: 916 ENICQAAARDVLAYNMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKLLSFNSDWA 975

Query: 659 KGLPLKAEGYEAKRYRK 675
             LPL A G+E  RYRK
Sbjct: 976 WDLPLSANGFETYRYRK 992


>gi|282535272|gb|ADA82478.1| putative DNA polymerase [Escherichia phage K1ind3]
 gi|282547373|gb|ADA82429.1| putative DNA polymerase [Escherichia phage K1ind2]
          Length = 726

 Score =  368 bits (944), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 256/732 (34%), Positives = 356/732 (48%), Gaps = 63/732 (8%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           MS LF+D ET S   L KVG +AYAE     + +C YA+DDE V++WD T+ S MP DL 
Sbjct: 1   MSYLFLDFETFSEADLKKVGSYAYAEHPTTEVLICTYAFDDEHVQVWDCTDGSDMPGDLH 60

Query: 59  QYLR-----DETVMCVAHN-SLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNA 112
           + LR     +  +  V HN S+F+R++ K   G DIP    I T + A  + LP SL   
Sbjct: 61  RALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFDIPVSNTIDTMIWAFRHALPGSLDAL 120

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTR---ANHVQAWQLFGEYCKRDVEA 169
           C  L  S    K + GKALI RF K +  +  Y   R     H   W LF +Y   D+ A
Sbjct: 121 CEVLGVSADNAKDKRGKALIQRFSKPTPKN--YKIRRYTAETHPDEWALFIKYAVSDITA 178

Query: 170 TRELFKRLIPLSDGERD--LWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
            RE+F +L    + E +  +  LDQ INDRG+++D+ L     E + + + +L E+  + 
Sbjct: 179 MREVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVALAEAAIEAVEKHKAQLQEEAQRK 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
             G +        LR    L     + +  + TL  +L+  ++   A+ +I  RL ++ +
Sbjct: 239 YGGSLTGKDFLPILRE---LAPAHRIHNAQKSTLNDLLADDDLPDDARTIIEMRLGAAST 295

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           A  K N L    SSD R RG +Q+ GA RT R++G  FQPQNL R    ++ L + I AL
Sbjct: 296 ASTKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKGFQPQNLARGYYHDDELDKGISAL 355

Query: 348 NRGETIA--DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
            +G      D   L +  VRSCII   G K VVAD + +E R LAW+AGE+  +  F  G
Sbjct: 356 LKGRAHRRFDVAKLTASTVRSCIIPEAGHKFVVADYSNVEGRGLAWLAGEETALDTFRAG 415

Query: 406 EDIYVTTYAKAFNTPIDKVSKEQ---RAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
            DIY  T  K F    D + KE+   R IGK  EL LGY GG   F   A + GLDL   
Sbjct: 416 LDIYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGLGYAGGVGAFVQFAKNLGLDLVDM 475

Query: 463 SQNVKSTSTFEDWEQAESHHLWM-------------QDQYPEFAVKDKLIGTACELVKKA 509
           ++ +  T     W      + W              +D  P + + DK +   C+ +K+ 
Sbjct: 476 AKTMDGTFPDHIWAATARGYEWARIQEAKRPPRPGEKDDRPSY-ILDKKVWRTCDAIKRM 534

Query: 510 WRAKHQGVLQLWKDLTEGFACVVQEGGS--ISARRVANVPRLVMRRHKRD------VHIV 561
           WR  H   +  W+D+ +     ++  G    +  R     R V   +  +      + + 
Sbjct: 535 WRESHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVKFSRNVETDNNGNKVAGWWLRMT 594

Query: 562 LPSSRRLVY----------SDVKGDCSY--------LNTATSQLMRERTYGGKLTENIVQ 603
           LPS R + Y          +D  G  S          N  T Q   + TY GKL EN  Q
Sbjct: 595 LPSGRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGENQLTRQWGFQYTYSGKLVENCTQ 654

Query: 604 AISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPL 663
           A+ RD+L   + N   NGY IVL VHDEI+ ETPD P ++V  L  LM + P WA+G PL
Sbjct: 655 ALCRDLLANALLNVEANGYPIVLHVHDEIICETPDLPEYNVAELERLMCELPEWAEGFPL 714

Query: 664 KAEGYEAKRYRK 675
            AEG E KRY K
Sbjct: 715 VAEGAEMKRYAK 726


>gi|225220079|ref|YP_002720046.1| DNA polymerase I [Enterobacteria phage SSL-2009a]
 gi|224986020|gb|ACN74584.1| DNA polymerase I [Enterobacteria phage SSL-2009a]
          Length = 763

 Score =  367 bits (943), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 258/766 (33%), Positives = 367/766 (47%), Gaps = 97/766 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
             +LF+D ET S   L KVG +AYAE     I +C YA D+  V+ WD TE   MP +L 
Sbjct: 4   FERLFLDTETFSGVDLKKVGAYAYAEHPTTEIMICTYAIDEGRVQTWDCTESPTMPRELR 63

Query: 59  QYLR----DETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACL 114
           + LR     +  + +A+  LF+R++ ++  GID+P  +   T ++A  + LP SL   C 
Sbjct: 64  KALRRVSRKKAKIVMANGLLFDRLVIREKWGIDLPVCQIEDTMIMAFRHALPGSLDMQCQ 123

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDC---TRANHVQAWQLFGEYCKRDVEATR 171
            L       K + GKALI RFCK +  +  Y     TR  H + W  F  Y   D+ A R
Sbjct: 124 VLGVDAEHAKDKAGKALIKRFCKPTPKT--YKIRRYTRETHPEEWAKFLRYAALDIIAMR 181

Query: 172 ELFKRLIPLSD--GERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
           E++ R+    +   E ++ L+DQ INDRG+ +D+DL     + +   +++L E+  +   
Sbjct: 182 EVYWRIPDWGNTPKEDEILLIDQLINDRGFYVDVDLARAAIKAVQAHKEELKEEAWERFG 241

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAI 289
           G +  +    ALR    L     + +  + TL  +L   +     K LI  RL +S +A 
Sbjct: 242 GKLTGNDFLPALRD---LAPAFTIHNAQKSTLNDLLEDPDFPDEGKVLIEMRLGASSTAS 298

Query: 290 LKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEE----------- 338
            K N L   +S+DGR RG LQ+ GA RT RW+G  FQPQNL R E S++           
Sbjct: 299 TKYNPLVNGLSADGRRRGCLQYGGAKRTLRWAGKGFQPQNLARGEYSDDHEGKIKRREGE 358

Query: 339 ----------ILTQTIQALNRGET--IADPLGLASDCVRSCIIASNGKKLVVADLAGIEA 386
                     +LT  I +L RG      D   L +  VR CII + GKK VVAD + +E 
Sbjct: 359 SDVAFWVRSHMLTNGINSLLRGTAHWAYDISKLTASTVRGCIIPAKGKKFVVADYSNVEG 418

Query: 387 RVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVS---KEQRAIGKVMELALGYQG 443
           R LAWIAGE   +  F  G DIY  T  K F    + +    K+ R IGK  EL LGY G
Sbjct: 419 RGLAWIAGEKTALMVFKAGRDIYCETAGKMFGLDPEYIKANRKDLRQIGKACELGLGYGG 478

Query: 444 GAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWM-------------QDQYP 490
           G   F   A + GLDL   ++ +K T     W  A+  + +              +D+ P
Sbjct: 479 GVAAFLQFAKNLGLDLYAMAEVMKGTFPDHIWAAAKRGYEYARINEAKRPPKPGKKDERP 538

Query: 491 EFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVP--- 547
            + +  K +   C+ +K+ WR  H   +  W +L +   C ++  G          P   
Sbjct: 539 TY-ILPKNVWLTCDAIKRMWRESHPKTVAFWAELEDAVLCAIRNPGKAYWAGANVRPDGK 597

Query: 548 ---RLVMRRHKRD----------------VHIVLPSSRRLVY--------SDVKGDCSYL 580
              ++V  + K D                + I LPS R + Y        +++  D    
Sbjct: 598 KALKIVRTKAKHDPTFDEERDDPNAAGWWLKIELPSGRIMSYPGIALSVTTEIDEDTGKK 657

Query: 581 NTAT-------SQLMR----ERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
            T+T       +Q  R    + TYGGKLTENIVQA+ RDIL   M      GY+IVL+VH
Sbjct: 658 RTSTRIKYQGENQTTRQWGFQYTYGGKLTENIVQALCRDILAWSMPGVEAAGYEIVLSVH 717

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE+++E PDT  ++   LC+LM   P WAKG PL AEG    RYRK
Sbjct: 718 DELITEVPDTDDYTTEELCALMCDLPVWAKGFPLAAEGDIMYRYRK 763


>gi|160898852|ref|YP_001564434.1| DNA-directed DNA polymerase [Delftia acidovorans SPH-1]
 gi|160364436|gb|ABX36049.1| DNA-directed DNA polymerase [Delftia acidovorans SPH-1]
          Length = 704

 Score =  367 bits (942), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 241/707 (34%), Positives = 350/707 (49%), Gaps = 39/707 (5%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           + L++D ET S + L +VG   YAE A   L AYA  D P ++WD T +  M  +L   +
Sbjct: 3   APLWLDRETWSERDLKEVGTARYAEVAEDLLFAYAIGDGPARVWDCTAEE-MHDELYHAM 61

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIP---SKRWICTSVLARTNGLPSSLKNACLALNF 118
            D      AHN+ F+R +        +P    +RW C+  +A ++ LP  L + C  L  
Sbjct: 62  DDADSEAWAHNAFFDRTIHNGPAQAHLPRIADERWRCSMAMALSHALPGGLADLCRVLKV 121

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYD-CTRANHVQAWQLFGEYCKRDVEATRELFKRL 177
              + K+ +GK L+  F +   D+      TR  H   W+ F +Y   D+ A RE  +R+
Sbjct: 122 PADMAKLADGKKLVRLFTQPQPDNRKVRRATRLTHPAEWERFKQYAANDITAMRECVRRM 181

Query: 178 IPLSDGERDL--WLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSS 235
              +     +  W LDQ IN RG+++D  L         +E+ ++     +L+ G   + 
Sbjct: 182 PAWNWDASAIAEWHLDQRINQRGFQVDQALTRAGARAAVEEKARIATRFAQLSGGQF-TP 240

Query: 236 RQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTL 295
            Q    R+YL    G +L +   GT + +L    +    +++I   +AS+ ++  K   L
Sbjct: 241 GQREKFRVYLGQRLGYELDNTQAGTFQVMLRDPGLPADVREMIELAIASNKTSTAKYAAL 300

Query: 296 SEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILTQTIQALNRGET-- 352
             AVS DGR RG LQF GASRT RW+G +FQPQNLP R   S E++   I+ L  G    
Sbjct: 301 DPAVSPDGRFRGGLQFAGASRTRRWAGRLFQPQNLPSRGLPSAEVIEDYIEHLKMGTHAL 360

Query: 353 -IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGE 406
              + + L +  +R C++A+ GKKLVVADL+ IE RVLAWIA E+WK+KAF       G 
Sbjct: 361 FFDNLMLLGAAALRGCVVAAPGKKLVVADLSNIEGRVLAWIAREEWKLKAFREYDAGTGP 420

Query: 407 DIY-VTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF--- 462
           D+Y +T  +     P +   K + A GKV +LA GYQGG   ++T A   GL +  F   
Sbjct: 421 DLYNITAVSIIGGDPWNVEKKNRNAFGKVPDLASGYQGGVAGYQTFARSYGLKMADFWDT 480

Query: 463 -SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLW 521
             Q V +    + WE   S   W   Q     + D++   A E  K AWRA+H    + W
Sbjct: 481 IQQMVPAQHVAKAWENLAS---WGHPQLESLEI-DEIEWVASETCKLAWRARHPATSKFW 536

Query: 522 KDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK------- 574
             L       ++  GS+         R V  R ++ + + LPS R L Y +         
Sbjct: 537 YALGGAAKDAIRNPGSVFTAGPFIKLRTVSHRGQKWLVVRLPSGRFLTYFEPHIVGQGRD 596

Query: 575 ------GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTV 628
                 G+ S     T Q +R  T+GGK+T N  Q I+RDIL   M  A   GY  VL+V
Sbjct: 597 ETIAYWGEASEEGKTTRQWVRVFTHGGKMTGNCCQTIARDILAPSMAVAENRGYLPVLSV 656

Query: 629 HDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           HDE ++E PDT  F+   L  ++  NP+WA  LPL A G+EA RY+K
Sbjct: 657 HDEALTEVPDTDDFTAAGLVEILATNPAWAPDLPLAAAGFEAYRYKK 703


>gi|75906029|gb|ABA29378.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 579

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 223/579 (38%), Positives = 318/579 (54%), Gaps = 19/579 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           LF D+ET S  P+   G   YAE A I L AYA++  PVK+WD T+   MP+DL  Y  D
Sbjct: 5   LFCDLETYSDIPI-NCGTHRYAENAEILLFAYAYNHAPVKVWDVTQDKTMPADLKAYFDD 63

Query: 64  ETVMCVAHNS-LFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
             ++ V HN  +F+ ++ K+ L ID+P  R   T V A  +GLP +L   C   N +   
Sbjct: 64  SEILTVWHNGGMFDTVILKRVLNIDLPLSRVHDTLVQALAHGLPGALGLLCDIFNVNSDK 123

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP-- 179
            K +EGKALI+  CK    +S     T   H + WQ F +Y   D+ A RE+++ L    
Sbjct: 124 AKDKEGKALISLLCKPRPKNSKIQRATALTHAEEWQRFKDYAGSDILAMREIYQHLPNWN 183

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
           ++  E +LW LDQ IN RG  +D++L       +  E+K+L     +LTD  ++++ Q  
Sbjct: 184 MNVDETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    GI L DM   TL+  ++  +I    ++L+  RL S  ++  K   L ++V
Sbjct: 244 ALLQHIASAFGITLPDMQASTLQRRINDPDIPPDLRELLSVRLQSCTTSTSKYKALLKSV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP- 356
           S+DGRLRGT QF GASRTGRW+G VFQP NLPR       +   I+AL  G  E I D  
Sbjct: 304 SADGRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICDDI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVT 411
           + L S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+KAF+      G+D+Y  
Sbjct: 364 MQLTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YA+AFN   + V+K+QR IGKVMEL LGY GG   F T A   GLDL + ++       
Sbjct: 424 AYARAFNLLPEDVTKDQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPHIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
                +A S +    ++   + + +K+  T C+ +K+ WR  H   +  W D+ +     
Sbjct: 484 PGVKREATSWYQKSVEKDKTYGLSEKIFVT-CDSLKRMWRNAHPQTVSFWYDIEDAVKQA 542

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
           +Q  G     R     +L +RR K  + I LPS R L Y
Sbjct: 543 IQSPGIAFKCR-----KLSVRRDKGWLRICLPSGRSLCY 576


>gi|48697222|ref|YP_024952.1| putative DNA polymerase protein [Burkholderia phage BcepC6B]
 gi|47779028|gb|AAT38391.1| putative DNA polymerase protein [Burkholderia phage BcepC6B]
          Length = 681

 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 233/689 (33%), Positives = 347/689 (50%), Gaps = 61/689 (8%)

Query: 35  YAWDDEPVKLWDRTEQSAMPSDLLQYLRDETVMCVAHNSLFERILFKKT---LGIDIPSK 91
           +A DD PV  WD T  + MP +L + +         +  +F+R++ K     +   +P  
Sbjct: 5   WAIDDGPVGTWDVTTGAPMPVELDEAIDAADEYWWQNGGMFDRVVLKHAAPEIYARMPEH 64

Query: 92  RWICTSVLARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKG-SIDSPPYDCTRA 150
           +W  T V A  +GLP  L   C   N      K +EG  LI  FCK    +S     TR 
Sbjct: 65  KWRDTMVQAYAHGLPGKLALLCEIFNIPTDQAKDKEGAQLIQLFCKPRPANSGLRRATRE 124

Query: 151 NHVQAWQLFGEYCKRDVEATRELFKRL----IPLSDGERDLWLLDQTINDRGYRIDLDLV 206
            H + W  F  Y   D+ A R + K +     P +  E  LW  DQ IN RG ++D++L 
Sbjct: 125 THPEQWAKFLTYAGADITAERAVHKAMPRWNYPNNVTELALWHQDQRINMRGMQMDVELA 184

Query: 207 LKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILS 266
                 I + +K+L    V+LTDG +  + Q   L  +L     +DL DM + TL+  ++
Sbjct: 185 EAAVRAIDRAQKELAARTVELTDGEVAKATQRDKLLAHLLAEYEVDLPDMKKSTLERRIN 244

Query: 267 HSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQ 326
             ++    ++L+  RL ++ ++  K  TL   VS+DGRLRG +QF GA RTGR +  +FQ
Sbjct: 245 DPDLPDALRELLAIRLEATMTSSSKYKTLLRGVSADGRLRGLMQFCGAQRTGRVAHRLFQ 304

Query: 327 PQNLPRQE----------------RSEEILTQTIQALNRG---ETIADPLGLASDCVRSC 367
           P N+PR +                 +E      I AL  G       + +GL ++ VR  
Sbjct: 305 PGNMPRPDVGLMVGELGVAKFSDGDAERYTELGIGALKTGCADLVFENVIGLTANVVRGT 364

Query: 368 IIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN-----GEDIYVTTYAKAFNTPID 422
           I+A +GK+L V+DL+ IE R  AW+AGE WK++AF +     G D+Y   YA+AF   ++
Sbjct: 365 IVAPDGKRLYVSDLSNIEGRDAAWLAGEKWKLQAFRDFDAGIGADLYKLAYARAFGVAVE 424

Query: 423 KVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA-ESH 481
            V K  R +GKVMELAL Y+GG   F T      +DL      V +     D E   E+ 
Sbjct: 425 AVDKYMRQLGKVMELALAYEGGVGAFVTFTMTYKMDLDSIRAAVFAALDTVDPEIVREAR 484

Query: 482 HLWMQDQYPEFAVKDKL-------IGTACELVKKAWRAKHQGVLQLWKDLTE-GFACVVQ 533
            +W      E+AVK +        +  AC+++K+ WR  H      W +L +     +  
Sbjct: 485 GMW------EWAVKKRRTLGLPQDVFIACDILKRLWRRAHPQTSSYWPELRDAAILAISS 538

Query: 534 EGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY-----SDVKGDCSYL--NTATSQ 586
            G ++ ARRV      ++RR    + + LPS R+L Y     SD  G+ SY+  N  T +
Sbjct: 539 PGKTVHARRV------ILRRDGEWLRVQLPSKRQLCYLAPRVSD-DGEISYMGVNQYTRK 591

Query: 587 LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGT 646
             R +TYGGK+ EN+ QA++RD+L          GYDIVL++HDE+++E PD   +S   
Sbjct: 592 WQRTKTYGGKIFENLCQAVARDVLFYNAPAVEAAGYDIVLSIHDELITEAPDADDYSADE 651

Query: 647 LCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           L SL+   P+WA+G+PL A G+ A RY+K
Sbjct: 652 LSSLIATAPAWAEGMPLAAAGFSAYRYKK 680


>gi|211731861|gb|ACJ10159.1| DNA polymerase [Bacteriophage APSE-3]
          Length = 502

 Score =  345 bits (885), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 204/505 (40%), Positives = 283/505 (56%), Gaps = 19/505 (3%)

Query: 184 ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRM 243
           E +LW LDQ IN RG  +D++L       +  E+ +L     +LTD  ++++ Q  AL  
Sbjct: 3   ETELWQLDQKINRRGMCMDVELAKSALTAVENEQNRLSTVTQQLTDNAVQNATQRDALLQ 62

Query: 244 YLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDG 303
           ++    GI L DM   TL+  ++  +I    ++L+  RL S  ++  K   L ++VS+DG
Sbjct: 63  HIASAFGITLPDMQASTLQRRINDPDIPPDLRELLSVRLQSCTTSTSKYKALLKSVSADG 122

Query: 304 RLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP-LGLA 360
           RLRGT QF GASRTGRW+G VFQP NLPR       +   I+AL  G  E I D  + L 
Sbjct: 123 RLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICDDIMQLT 182

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVTTYAK 415
           S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+ AF+      G+D+Y   YA+
Sbjct: 183 SSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKLAYAR 242

Query: 416 AFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDW 475
           AFN   + V+KEQR IGKVMEL LGY GG   F T A   GLDL + ++           
Sbjct: 243 AFNLLPEDVTKEQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPNILPGVK 302

Query: 476 EQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEG 535
            +A   +    +    + + +K+  T C+ +K+ WR  H   +  W D+ +     +Q  
Sbjct: 303 REAMRWYQKSVETDKTYGLSEKIFVT-CDALKRMWRNAHPQTVSFWYDIEDAVKQAIQSP 361

Query: 536 GSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK---GDCSYL--NTATSQLMRE 590
           G     R     +L +RR K  + I LPS R L Y   +   G  +Y+  N  + +  R 
Sbjct: 362 GIAFKCR-----KLSVRRDKGWLRICLPSGRSLCYPSARTENGQITYMGTNPYSRKWERL 416

Query: 591 RTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSL 650
           +TYGGK+ ENI Q+ +RD+L   M    K GY+IVLTVHDEI+SE PDTP FS   L  L
Sbjct: 417 KTYGGKIIENICQSTARDVLAYNMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKL 476

Query: 651 MTKNPSWAKGLPLKAEGYEAKRYRK 675
           ++ N  WA  LPL A G+E  RYRK
Sbjct: 477 LSFNSDWAWDLPLSANGFETYRYRK 501


>gi|282547321|gb|ADA82378.1| putative DNA polymerase [Escherichia phage K1ind1]
          Length = 698

 Score =  344 bits (883), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 241/697 (34%), Positives = 335/697 (48%), Gaps = 61/697 (8%)

Query: 34  AYAWDDEPVKLWDRTEQSAMPSDLLQYLR-----DETVMCVAHN-SLFERILFKKTLGID 87
           AYA+DDEPV++WD T  S MP DL + LR     +  +  V HN S+F+R++ K   G D
Sbjct: 8   AYAFDDEPVQVWDCTNGSDMPGDLHRALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFD 67

Query: 88  IPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDC 147
           IP    I T + A  + LP SL   C  L  S    K + GKALI RF K +  +  Y  
Sbjct: 68  IPVSNTIDTMIWAFRHALPGSLDALCEVLGVSADNAKDKRGKALIQRFSKPTPKN--YKI 125

Query: 148 TR---ANHVQAWQLFGEYCKRDVEATRELFKRLIPLSDGERD--LWLLDQTINDRGYRID 202
            R     H   W LF +Y   D+ A RE+F +L    + E +  +  LDQ INDRG+++D
Sbjct: 126 RRYTAETHPDEWALFIKYAVSDITAMREVFHKLPRWGNSEFEDRVLELDQLINDRGFKVD 185

Query: 203 LDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLK 262
           + L     E + + + +L E+  +   G +        LR    L     + +  + TL 
Sbjct: 186 VALAEAAIEAVEKHKAQLQEEAQRKYGGSLTGKDFLPILRE---LAPAHRIHNAQKSTLN 242

Query: 263 SILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSG 322
            +L+  ++   A  +I  RL ++ +A  K N L    SSD R RG +Q+ GA RT R++G
Sbjct: 243 DLLADDDLPDDASAIIEMRLGAASTASTKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAG 302

Query: 323 CVFQPQNLPRQERSEEILTQTIQALNRGETIA--DPLGLASDCVRSCIIASNGKKLVVAD 380
             FQPQNL R    ++ L + I AL +G      D   L +  VRSCII   G K VVAD
Sbjct: 303 KGFQPQNLARGYYHDDELDKGISALLKGRAHRRFDVAKLTASTVRSCIIPETGHKFVVAD 362

Query: 381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ---RAIGKVMEL 437
            + +E R LAW+AGE+  +  F  G DIY  T  K F    D + KE+   R IGK  EL
Sbjct: 363 YSNVEGRGLAWLAGEETALDTFRAGLDIYCVTAGKMFGMEPDYIKKERKDLRQIGKACEL 422

Query: 438 ALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWM------------ 485
            LGY GG   F   A + GLDL   ++ +  T     W      + W             
Sbjct: 423 GLGYAGGVGAFVQFAKNLGLDLVDMAKTMDGTFPDHIWAATARGYEWARIQEAKRPPRPG 482

Query: 486 -QDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGS--ISARR 542
            +D  P + + DK +   C+ +K+ WR  H   +  W+D+ +     ++  G    +  R
Sbjct: 483 EKDDRPSY-ILDKKVWRTCDAIKRMWRESHPETVAFWRDIEDAAMAAIRNPGKEFTAGPR 541

Query: 543 VANVPRLVMRRHKRD------VHIVLPSSRRLVY----------SDVKGDCSY------- 579
                R V   +  +      + + LPS R + Y          +D  G  S        
Sbjct: 542 GVKFSRNVETDNNGNKVAGWWLRMTLPSGRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQ 601

Query: 580 -LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPD 638
             N  T Q   + TY GKL EN  QA+ RD+L   + N   NGY IVL VHDEI+ ETPD
Sbjct: 602 GENQLTRQWGFQYTYSGKLVENCTQALCRDLLANALLNVEANGYPIVLHVHDEIICETPD 661

Query: 639 TPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            P ++V  L  LM + P WA+G PL AEG E KRY K
Sbjct: 662 LPEYNVAELERLMCELPEWAEGFPLVAEGAEMKRYAK 698


>gi|320530602|ref|ZP_08031654.1| DNA-directed DNA polymerase [Selenomonas artemidis F0399]
 gi|320137129|gb|EFW29059.1| DNA-directed DNA polymerase [Selenomonas artemidis F0399]
          Length = 653

 Score =  341 bits (874), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 235/708 (33%), Positives = 339/708 (47%), Gaps = 94/708 (13%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L ID+ET S   +  VG + YAE A I L AYAWDD PV++ D T +  +P+D+L  L D
Sbjct: 3   LSIDLETYSALDIKTVGGYRYAENAEILLFAYAWDDTPVQIVDLTAEETIPADVLSALTD 62

Query: 64  ETVMCVAHNSLFERILFKKTLGID------IPSKRWICTSVLARTNGLPSSLKNACLALN 117
             +M  A N+ FER +    L  +      +    W CT V A T GLP SL      L 
Sbjct: 63  NDIMKCAFNAQFERTVLSHYLHKEGEPFAFLDPAGWSCTMVHALTLGLPGSLAEVSKTLK 122

Query: 118 FSEHLTKMEEGKALIARFCK---------GSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
             E   KM  G  LI  FCK         G   + P D       + W  F  YC RDVE
Sbjct: 123 LGEEKEKMSVGTQLITYFCKPCKPTKSNGGRTRNLPNDAP-----EKWATFKAYCVRDVE 177

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
           A RE+ +RL   P+ + ER LW LDQ INDRG RID  L        +  R ++  +   
Sbjct: 178 AEREVRRRLSGYPVPETERALWALDQRINDRGVRIDEILAQNAIAFDSAFRAEVTAEASA 237

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           L+   + +      L+ +++   G   + +++ T+  ++  +  ++  K ++  ++  S 
Sbjct: 238 LSG--LENPNSGEQLKHWIYEQEGARPLSLTKETIPELIETAK-SETVKTMLQLKMLLSK 294

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           +++ K   + +A  SDGR  G LQFYGA+RTGRW+G + Q QNLPR   +E  L      
Sbjct: 295 TSVKKYEAMVQAQCSDGRAHGLLQFYGANRTGRWAGRLVQVQNLPRNTMAE--LDDARAL 352

Query: 347 LNRGETIA------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
           L  G+T A      +P  + S  +R+  I + G +  VAD + IEARV+AW+AGE W++ 
Sbjct: 353 LRCGDTDALEMLFDNPPDVLSQLIRTAFIPAVGMRFTVADFSAIEARVIAWLAGEKWRMD 412

Query: 401 AFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            FA+G DIY  + +K F+ P++K  V+   R  GKV ELALGY GG    K M +     
Sbjct: 413 VFADGGDIYCASASKMFHVPVEKHGVNGHLRQKGKVAELALGYGGGVSALKRMGA----- 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACEL--VKKAWRAKHQG 516
                                                DKL  T  EL  +K++WR     
Sbjct: 468 -------------------------------------DKLGLTDAELEEIKQSWRKASPR 490

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY------ 570
           +++LW D        V+E  ++S +       + +      + I LPS R L Y      
Sbjct: 491 IVRLWSDFESAALEAVRERSTVSLQH-----GIKLECRSGILFIRLPSGRSLAYVKPRIE 545

Query: 571 ---SDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLT 627
              S  +   +Y         ++RTYGG+L EN +QAI+RD L   M      GY IV+ 
Sbjct: 546 YEESFDREGLTYYGRDVGGWGKQRTYGGRLVENAIQAIARDCLAVAMTRLEAAGYPIVMH 605

Query: 628 VHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +HDE+V ETP +    +  +C +M+K   WA GL L A+GY    Y+K
Sbjct: 606 IHDEVVVETPRS-VDCLADVCEIMSKPVDWAPGLVLTADGYTTNYYKK 652


>gi|254975142|ref|ZP_05271614.1| DNA polymerase [Clostridium difficile QCD-66c26]
 gi|255314269|ref|ZP_05355852.1| DNA polymerase [Clostridium difficile QCD-76w55]
 gi|255516949|ref|ZP_05384625.1| DNA polymerase [Clostridium difficile QCD-97b34]
 gi|255650051|ref|ZP_05396953.1| DNA polymerase [Clostridium difficile QCD-37x79]
 gi|260686788|ref|YP_003217921.1| dna-directed dna polymerase i [Clostridium difficile R20291]
 gi|306519586|ref|ZP_07405933.1| dna-directed dna polymerase i [Clostridium difficile QCD-32g58]
 gi|260212804|emb|CBE03971.1| dna-directed dna polymerase i [Clostridium difficile R20291]
          Length = 652

 Score =  339 bits (870), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 244/709 (34%), Positives = 351/709 (49%), Gaps = 92/709 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + KVGV+ Y + A   I L AYA+D+E VK+ D      +P +++
Sbjct: 1   MRTLSIDIETYSDLDIKKVGVYRYVDSANFEILLFAYAFDNEEVKVIDLVNDEELPKEVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D  V+  A N+ FER    K L I++    W CT + A T GLP SL +   AL F
Sbjct: 61  EALNDNKVIKSAFNANFERTAISKFLNINLKPNEWSCTMIKALTLGLPGSLDSVSKALKF 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANH----------VQAWQLFGEYCKRDVE 168
           +E   KM+EGKALI  FCK      P   T+ N           ++ W  F EYCK+DV 
Sbjct: 121 NEDKQKMKEGKALIQYFCK------PCKATKVNKGRTRNLPIHDMEKWNKFKEYCKQDVV 174

Query: 169 ATRELFKRLIPLSDGERD--LWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             RE+  +L      ER+  LW LDQ IND G ++D +L+    E   +  +KL ++ +K
Sbjct: 175 VEREIRNKLSKYKTTEREIKLWYLDQRINDTGIKVDTELIENAIECDKRYTEKLTKEAIK 234

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           +T   + +      L+ +L    G ++  +++ ++  IL   +   + + L L +L S  
Sbjct: 235 ITG--LNNPNSPAQLKKWLSDKVGFEITSLTKESIPEILKQVDDENVVRILELRKLMSK- 291

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           ++I K   +  A  +D R+RG LQFYGA+RTGRW+G + Q QNLP+    +  L + +  
Sbjct: 292 TSIKKYEAMKLAKGNDNRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHIEDLDLARNL-- 349

Query: 347 LNRG-----ETIADPL-GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
           L  G     E + D +  + S  +R+  I S G + +V+D + IEARV+AW AGE W++ 
Sbjct: 350 LKEGDFDLIELLYDSVPDVLSQLIRTAFIPSEGHRFIVSDFSAIEARVIAWFAGEKWRLD 409

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTM-ASHCGL 457
            F +   IY  + +  F  PI+ + K    R  GK+ ELALGY G      +M A   GL
Sbjct: 410 VFNSHGKIYEASASHMFKVPIESIKKGDPLRQKGKISELALGYGGSIGALTSMGAIKMGL 469

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
           D ++    V   +T+ +     +   W  D+  + A+KD+ I      VK          
Sbjct: 470 DEEELQPLV---TTWRNANPNITKFWWDVDKAAKKAIKDRTI------VK---------- 510

Query: 518 LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY------- 570
                 L  G   +   G                      + I LPS RRL Y       
Sbjct: 511 ------LQHGIKFIYNPGV---------------------LFIELPSGRRLSYLRPKIEP 543

Query: 571 -SDVKGD-CSY--LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVL 626
            +   GD  +Y  +   + Q  R  TYG KL ENIVQA +RD L E M N T  GY IV+
Sbjct: 544 HTTFSGDKITYEGMEQTSKQWKRIDTYGPKLVENIVQATARDCLREAMFNVTDAGYSIVM 603

Query: 627 TVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            VHDE+V +  D    S+  + S+M K  SWAKGLPLKA+GYE   Y+K
Sbjct: 604 HVHDELVIDV-DKKGGSLEEVNSIMGKEISWAKGLPLKADGYECDYYKK 651


>gi|255092532|ref|ZP_05322010.1| DNA polymerase [Clostridium difficile CIP 107932]
 gi|260683192|ref|YP_003214477.1| dna-directed dna polymerase i [Clostridium difficile CD196]
 gi|260209355|emb|CBA62784.1| dna-directed dna polymerase i [Clostridium difficile CD196]
          Length = 652

 Score =  338 bits (867), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 237/709 (33%), Positives = 350/709 (49%), Gaps = 92/709 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + KVGV+ Y + A   I L AYA+D+E VK+ D      +P +++
Sbjct: 1   MRTLSIDIETYSDLDIKKVGVYRYVDSANFEILLFAYAFDNEEVKVIDLVNDEELPKEVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D  V+  A N+ FER    K L I++    W CT + A T GLP SL +   AL F
Sbjct: 61  EALNDNKVIKSAFNANFERTAISKFLNINLKPNEWSCTMIKALTLGLPGSLDSVSKALKF 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANH----------VQAWQLFGEYCKRDVE 168
           +E   KM+EGKALI  FCK      P   T+ N           ++ W  F EYCK+DV 
Sbjct: 121 NEDKQKMKEGKALIQYFCK------PCKATKVNKGRTRNLPIHDMEKWNKFKEYCKQDVV 174

Query: 169 ATRELFKRLIPLSDGERD--LWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             RE+  +L      ER+  LW LDQ IND G ++D +L+    E   +  +KL ++ +K
Sbjct: 175 VEREIRNKLSKYKTTEREIKLWYLDQRINDTGIKVDTELIENAIECDKRYTEKLTKEAIK 234

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           +T   + +      L+ +L    G ++  +++ ++  IL   +   + + L L +L S  
Sbjct: 235 ITG--LNNPNSPAQLKKWLSDKVGFEITSLTKESIPEILKQVDDENVVRILELRKLMSK- 291

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           ++I K   +  A  +D R+RG LQFYGA+RTGRW+G + Q QNLP+    +  L + +  
Sbjct: 292 TSIKKYEAMKLAKGNDNRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHIEDLDLARNL-- 349

Query: 347 LNRG-----ETIADPL-GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
           L  G     E + D +  + S  +R+  I S G + +V+D + IEARV+AW+AGE W++ 
Sbjct: 350 LKEGDFDLIELLYDSVPDVLSQLIRTAFIPSEGHRFIVSDFSAIEARVIAWLAGEKWRLD 409

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F +   IY  + ++ F  PI+ + K  E R  GK+ EL+ GY G      +M       
Sbjct: 410 VFNSHGKIYEASASQMFKIPIENIKKGSELRQKGKLAELSNGYGGSVGALISMG------ 463

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                             A+K  L     + +  AWR  +  + 
Sbjct: 464 ----------------------------------AIKMGLKEEELQPIVTAWRNANPNIT 489

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDV-HIVLPSSRRLVY------- 570
           + W D+ +     +++      R +  +   +   +   V  I LPSSRRL Y       
Sbjct: 490 KFWWDVDKAAKKAIKD------RTIVEIQHGIKFIYNPGVLFIELPSSRRLSYLRPKIEP 543

Query: 571 -SDVKGD-CSY--LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVL 626
            +   GD  +Y  +   + Q  R  TYG KL ENIVQA +RD L E M N T  GY IV+
Sbjct: 544 HTTFSGDKITYEGMEQTSKQWKRIDTYGPKLVENIVQATARDCLREAMFNVTDAGYSIVM 603

Query: 627 TVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            VHDE+V +  D    S+  + S+M K  SWAKGLPLKA+GYE   Y+K
Sbjct: 604 HVHDELVIDV-DKKGGSLEEVNSIMGKEISWAKGLPLKADGYECDYYKK 651


>gi|255306559|ref|ZP_05350730.1| DNA polymerase [Clostridium difficile ATCC 43255]
          Length = 652

 Score =  336 bits (861), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 236/709 (33%), Positives = 349/709 (49%), Gaps = 92/709 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + KVGV+ Y + A   I L AYA+D+E VK+ D      +P +++
Sbjct: 1   MRTLSIDIETYSDLDIKKVGVYRYVDSANFEILLFAYAFDNEEVKVIDLVNDEELPKEVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D  V+  A N+ FER    K L I++    W CT + A T GLP SL +   AL F
Sbjct: 61  EALNDNKVIKSAFNANFERTAISKFLNINLKPNEWSCTMIKALTLGLPGSLDSVSKALKF 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANH----------VQAWQLFGEYCKRDVE 168
           +E   KM+EGKALI  FCK      P   T+ N           ++ W  F EYCK+DV 
Sbjct: 121 NEDKQKMKEGKALIQYFCK------PCKATKVNKGRTRNLPIHDMEKWNKFKEYCKQDVV 174

Query: 169 ATRELFKRLIPLSDGERD--LWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             RE+  +L      ER+  LW LDQ IND G ++D +L+    E   +  +KL ++ +K
Sbjct: 175 VEREIRNKLSKYKTTEREIKLWYLDQRINDTGIKVDTELIENAIECDKRYTEKLTKEAIK 234

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           +T   + +      L+ +L      ++  +++ ++  IL   +   + + L L +L S  
Sbjct: 235 ITG--LNNPNSPAQLKKWLSDKVSFEITSLTKESIPEILKQVDDENVVRTLELRKLMSK- 291

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           ++I K   +  A  +D R+RG LQFYGA+RTGRW+G + Q QNLP+    +  L + +  
Sbjct: 292 TSIKKYEAMKLAKGNDNRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHIEDLDLARNL-- 349

Query: 347 LNRG-----ETIADPL-GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
           L  G     E + D +  + S  +R+  I S G + +V+D + IEARV+AW+AGE W++ 
Sbjct: 350 LKEGDFDLIELLYDSVPDVLSQLIRTAFIPSEGHRFIVSDFSAIEARVIAWLAGEKWRLD 409

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F +   IY  + ++ F  PI+ + K  E R  GK+ EL+ GY G      +M       
Sbjct: 410 VFNSHGKIYEASASQMFKVPIESIKKGSELRQKGKLAELSNGYGGSVGALISMG------ 463

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                             A+K  L     + +  AWR  +  + 
Sbjct: 464 ----------------------------------AIKMGLKEEELQPIVTAWRNANPNIT 489

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDV-HIVLPSSRRLVY------- 570
           + W D+ +     +++      R +  +   +   +   V  I LPSSRRL Y       
Sbjct: 490 KFWWDVDKAAKKAIKD------RTIVEIQHGIKFIYNPGVLFIELPSSRRLSYLRPKIEP 543

Query: 571 -SDVKGD-CSY--LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVL 626
            +   GD  +Y  +   + Q  R  TYG KL ENIVQA +RD L E M N T  GY IV+
Sbjct: 544 HTTFSGDKITYEGMEQTSKQWKRIDTYGPKLVENIVQATARDCLREAMFNVTDAGYSIVM 603

Query: 627 TVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            VHDE+V +  D    S+  + S+M K  SWAKGLPLKA+GYE   Y+K
Sbjct: 604 HVHDELVIDV-DKKGGSLEEVNSIMGKEISWAKGLPLKADGYECDYYKK 651


>gi|295096879|emb|CBK85969.1| DNA polymerase I-3'-5' exonuclease and polymerase domains
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 591

 Score =  327 bits (837), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 206/564 (36%), Positives = 297/564 (52%), Gaps = 15/564 (2%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A  DEPV +WD T    +P  L + + D
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAIGDEPVSVWDLTAGEPIPGRLQKAIAD 63

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPS-KRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +    P   RW  T V A  +GLP +L   C  L   +  
Sbjct: 64  PDTLLYFHNSHFDRTVLRHAIPRLAPDVTRWRDTMVQALAHGLPGALGALCEVLGVPQDK 123

Query: 123 TKMEEGKALIARFCKGSI-DSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS 181
            K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE+ KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVHKRLPKWN 183

Query: 182 --DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG  +D+ L     E + QE+K+L +    +TDG ++++ Q  
Sbjct: 184 YKGTELALWHRDQQINDRGVCMDVQLAQAAIEAVDQEQKRLAKRTQVMTDGEVQAATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K  +L + V
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRMADPDLPSAVKELLAIRLQASTTSTSKYKSLMKGV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           SSDGRLRGTLQF GASRTGRW+G +FQPQNLPR    ++ + + I+AL  G       + 
Sbjct: 304 SSDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLEQDQIDEGIEALKAGCADLLFDNI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGEDIYVT 411
           + L S  +R CI+A  GKKLVV+DL+ IE R LAW+AGE WK+ AF       G D+Y  
Sbjct: 364 MELTSSALRGCIMAPEGKKLVVSDLSNIEGRKLAWLAGEQWKLHAFREYDEGTGPDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YA+AFN   D V K QR IGKVMEL LG+ GG   F T A   GLDL + +        
Sbjct: 424 AYARAFNISPDDVDKYQRQIGKVMELGLGFGGGVAAFLTFALVYGLDLDELANAALPNIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
            +   +A++ +     +   + + +++   AC+ +K+ WR  H      W +L       
Sbjct: 484 RDVIREAKNWYDESVKRKATYGLSERVF-IACDSLKRLWRRAHPATCDFWYELERTVRAA 542

Query: 532 VQEGGSISARRVA-NVPRLVMRRH 554
           +      +  R++ + PR  M  H
Sbjct: 543 IATPTKDAVLRLSESPPRWCMAAH 566


>gi|302873662|ref|YP_003842295.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|307686614|ref|ZP_07629060.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|302576519|gb|ADL50531.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
          Length = 645

 Score =  322 bits (825), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 231/711 (32%), Positives = 348/711 (48%), Gaps = 103/711 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+AY  +    I L AYA+D + VK+ D      +P++++
Sbjct: 1   MQTLSIDIETFSDVDLIKSGVYAYTASPNFEILLFAYAFDSDEVKIIDFASGEELPAEII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L +E ++  A N+ FERI   + L   + +  W CT+V A T G P SL      L  
Sbjct: 61  EALLNENIIKSAFNAQFERICLSRHLNKKLTANAWQCTAVQAATLGFPLSLDGVAQVLGL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANH----------VQAWQLFGEYCKRDVE 168
           +E   KM+EGK LI  F      S P   TR N            + W  F +YC RDVE
Sbjct: 121 TEQ--KMKEGKELIRYF------SIPCKPTRVNEGRTRNLPQHSSEKWNDFKKYCIRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             R + K+L   P+S+ E+  ++LD  INDRG  +DLDLV +  E     ++    +  +
Sbjct: 173 VERAIRKKLSRYPISENEQRNYILDHEINDRGVFVDLDLVARAMECDRLHKEDTFTEAQR 232

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDL------ILN 280
           LT   + +      L+ +L          +  G     LS   ++ LAK+       +LN
Sbjct: 233 LTG--LDNPNSVAQLKQWL----------IENGVEVDSLSKKAVSDLAKEADGEVERLLN 280

Query: 281 -RLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEI 339
            RL  + ++I K   +  AV  D R+RG LQFYGA+RTGRW+G + Q QNLP+    +  
Sbjct: 281 LRLQLAKTSIKKYEAIERAVCPDKRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLKDLT 340

Query: 340 LTQTIQALNRGETIA----DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGE 395
           L + +      +T+A        + S+ +R+  I  +  + +VAD + IEARV+AW+AGE
Sbjct: 341 LARNLVKSGDFDTLALLFESVPHVLSELIRTAFIPKSNHRFIVADFSAIEARVIAWLAGE 400

Query: 396 DWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS 453
            W++  FA    IY  + ++ F  PI++++K    R  GK+ ELALGY G       M +
Sbjct: 401 KWRMDVFATHGKIYEASASQMFKVPIEEITKTSALRQKGKISELALGYGGSVGALTAMGA 460

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
              LD+                                   +D+L G        AWR  
Sbjct: 461 ---LDMG--------------------------------VAEDELQGLVT-----AWRQA 480

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           +  + +LW D+ +     V++  ++       V ++ ++     + I LPS RRL Y   
Sbjct: 481 NPNITKLWWDIDKAAIKAVKKKTTVM------VGKIKLQYESGIMFITLPSGRRLSYIKP 534

Query: 574 KGDCSYLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + + +             AT +  R  TYG KL ENIVQAI+RD+L E M    +NGY+I
Sbjct: 535 RIEPNKFERDAVTYEGIGATKKWERIETYGPKLVENIVQAIARDLLAEAMLRVAENGYEI 594

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V+ +HDEIV E P   + S+  +C +M   P+WA+ LPL+A+G+E + YRK
Sbjct: 595 VMHIHDEIVIEAP-LNFGSLKDVCEVMAIAPTWAESLPLRADGFECEYYRK 644


>gi|205375254|ref|ZP_03228044.1| DNA-directed DNA polymerase [Bacillus coahuilensis m4-4]
          Length = 649

 Score =  322 bits (825), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 241/710 (33%), Positives = 348/710 (49%), Gaps = 97/710 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+AY+E A   I L AYA DDE V++ D      +P+++L
Sbjct: 1   MKTLIIDIETYSKVDLVKCGVYAYSESADFEILLFAYAVDDEEVEIVDLASGEKIPANIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + + D TV+  A+N+ FER    K   I +P ++W CTSV A   GLP  L      L  
Sbjct: 61  KAMIDPTVIKTAYNANFERTCLAKHFQIPMPPEQWRCTSVHALMLGLPGYLDGVAKCLKL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSI-------DSPPYDCTRANHVQAWQLFGEYCKRDVE 168
                KM+EGKALI  F   CK +        + P +D  R      W  F +YCK+DVE
Sbjct: 121 QGQ--KMKEGKALIRYFSIPCKPTKVNGGRTRNLPKHDPAR------WDTFKDYCKQDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             RE+ K+L   PL   E++LW LDQ IND G  ID +LV    +     + +L E+ V+
Sbjct: 173 VEREIRKKLEVFPLPTMEQELWELDQKINDEGVVIDTNLVNHAIKADKAFQDELIEEAVR 232

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           LT   + +      L+ +L L  G+++  +++  +++++S     ++ + L L R A S 
Sbjct: 233 LTG--LENPNSPAQLKGWL-LKQGLEVDSLAKKNVEALMSEVENPEVKRLLELRR-AMSK 288

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR------QERSEEIL 340
           +++ K   +  +V SD R+RG LQFYGASRTGRW+G + Q  NLPR      Q   E + 
Sbjct: 289 TSVKKYEAMERSVGSDQRVRGLLQFYGASRTGRWAGRLVQIHNLPRNSLKDLQVARELLE 348

Query: 341 TQTIQALN-RGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
           +   +AL    E+++D L   S  +R+  I S G + VVAD + IEARV+AW+AGE W++
Sbjct: 349 SGKYEALEVLFESVSDVL---SQLIRTAFIPSKGHRFVVADFSAIEARVIAWLAGERWRM 405

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F +   IY  + A+ F  PI+ + K    R  GK+ ELALGY G       M +   G
Sbjct: 406 DVFQSHGKIYEASAAQMFKVPIETIDKGSPLRQKGKIAELALGYGGSKGALMQMGALEMG 465

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           L                            +D+ PE                 AWR  +  
Sbjct: 466 L---------------------------TEDELPELV--------------SAWREANPK 484

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV--- 573
           +++LW  +       V+E   +  +       L     K  + I LPS R L Y      
Sbjct: 485 IVKLWWGIEAAAIKAVKEKAVVKMQH-----GLTFHYTKGILFITLPSGRSLAYVRPKIG 539

Query: 574 ------KGDCSYLNT--ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIV 625
                 K   +Y  T   + Q  R  TYGGKLTENI+QAI+RD L   M    + GY I 
Sbjct: 540 IDERFGKEQLTYEGTEQGSKQWGRIPTYGGKLTENIIQAIARDCLAVSMLRLDEAGYRIN 599

Query: 626 LTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             VHDE++ + P     S+  + ++M ++  WA GLPL A+ +E   Y+K
Sbjct: 600 FHVHDEVILDVP-IATGSMEEVENIMGQSIDWAPGLPLGADSFETFYYKK 648


>gi|227496457|ref|ZP_03926741.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
 gi|226834039|gb|EEH66422.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
          Length = 651

 Score =  319 bits (817), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 239/705 (33%), Positives = 333/705 (47%), Gaps = 93/705 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   LP VGV+ YA  E   I L AYA D   V++ D      +P D+L
Sbjct: 9   MRTLSIDIETFSKASLPSVGVYRYAADESFEILLFAYAVDGGEVQIVDLARGEQIPGDVL 68

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V+  A N+ FER+     LG  +  + W C+ V A   G+P  L     AL+ 
Sbjct: 69  DALEDPGVVKSAFNAAFERVCLSAHLGHRLDPEGWRCSMVWASFAGVPLDLAGVAKALHL 128

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
                KM EGK LI  F      S P   T+AN  +           W+ F  YCKRDVE
Sbjct: 129 ETE--KMGEGKNLIRYF------SLPAKPTKANGGRERNLPEHAPDDWETFKAYCKRDVE 180

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
               + KRL  +P+   E D +  DQ INDRG RID DL     +     R    E + +
Sbjct: 181 VELAITKRLHAMPMPAREWDNYWDDQRINDRGVRIDADLATAAVDADNTGRASALERMRE 240

Query: 227 LTDGIIRSSRQTYALRMYLFLIT-GIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASS 285
           LT    R        ++  +L + G+ +  +++  + + L  +    +A+ L L R   +
Sbjct: 241 LT----RVDNPASVTQLLAWLRSQGLQIDSLAKADVAAALEGALEGDVAEVLAL-RQEMA 295

Query: 286 GSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQ 345
            S++ K   +      DGR  G LQF GA RTGRW+G + Q QNLPRQ  S+      + 
Sbjct: 296 KSSVKKYERMLACRCPDGRAHGLLQFMGAGRTGRWAGRLVQVQNLPRQSISDLEAAADLV 355

Query: 346 ALNRGETIADPLGLA----SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKA 401
                + +    G A    S+ +R+  +A  G + +VAD + IEAR +AW+AGE W +  
Sbjct: 356 RTGHADMLETLWGSAPQVLSELIRAAFVAEPGSRFLVADYSAIEARTIAWLAGEQWVLDL 415

Query: 402 FANGEDIYVTTYAKAFNTPIDKVSK-EQRAIGKVMELALGYQGGAKVFKTMASH-CGLDL 459
           F  G DIY  T  + F   ++K S   QRA  KV  LA GYQGG    KTM     GL  
Sbjct: 416 FEAGGDIYCETGTRMFRQVVEKHSPLRQRA--KVAVLACGYQGGVGALKTMGGEKLGLSE 473

Query: 460 QQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQ 519
            + +  V                                          AWRA +  + Q
Sbjct: 474 DEMADIV-----------------------------------------AAWRAANPKIAQ 492

Query: 520 LWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-GDCS 578
           LW D+      V+++GG+ +      V R+ +   K  + I LPS R LVY   + G+  
Sbjct: 493 LWWDINAAAIAVIKDGGARA------VGRIRLAHDKGALIITLPSGRPLVYPSPRIGENR 546

Query: 579 YLNTATSQL--------MRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHD 630
           +   + + +         R  TYGGKLTENIVQA +RDIL   +    ++GY +V+ +HD
Sbjct: 547 FGGESITHMGVGVNRKWGRIETYGGKLTENIVQATARDILAHAIARLERSGYPVVMHIHD 606

Query: 631 EIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E+V+E P+    SV  LC+LM++ P WA GLPL AEG+E+  YRK
Sbjct: 607 EVVTEVPEG-RGSVEELCALMSQAPPWADGLPLAAEGFESTYYRK 650


>gi|293400006|ref|ZP_06644152.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306406|gb|EFE47649.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 651

 Score =  317 bits (811), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 222/697 (31%), Positives = 348/697 (49%), Gaps = 76/697 (10%)

Query: 8   IETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRDET 65
           +ET S   L   GV+ Y  +E   I L AYA DDEPVK+ D      +PS++L  + +  
Sbjct: 1   METYSSVDLISCGVYKYVESEDFEILLFAYAVDDEPVKVVDLACGEKIPSEVLDLIDEPA 60

Query: 66  VMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLTKM 125
           ++  AHN++FER+   + LG  + + +W C+ + A   GLP+SLK+    L  SE   KM
Sbjct: 61  IIKYAHNAVFERLCLSRYLGTQLDTDQWHCSMIHAMMLGLPASLKDVGAVLGLSEDKQKM 120

Query: 126 EEGKALIARFCK----GSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
             GK LI+ FCK      ++      T A+  + WQLF +YC RDVE  RE+  +L   P
Sbjct: 121 RIGKTLISYFCKPCKPTRVNGQRSRNTPADAPEKWQLFKDYCHRDVETEREISNKLDKFP 180

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
           +   E +LW  DQ +ND G RID+++V  +     +  ++L  +  ++T+GI    ++  
Sbjct: 181 IPASEHELWCWDQKMNDHGARIDMEMVHTVLVFGHRYDEELINECERITNGI--GPKKIA 238

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
            L+ ++       +  + +  +  +L  S+I+   + ++  R  S  ++I K   +  +V
Sbjct: 239 QLKEWICRKEDRSIESLDKDAVIELLKDSSISPETRRVLQIRQESGKTSITKYAAIQRSV 298

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLG- 358
            +D RL G LQFYGA+RTGRW+G +FQPQNLPR   ++  L + +      E++    G 
Sbjct: 299 CNDQRLHGFLQFYGANRTGRWAGRIFQPQNLPRNAFNDIELARKLVKEKDFESLDMLYGS 358

Query: 359 ---LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAK 415
              + S  +R+ +I  NG    +AD + IEAR+ AW   E+W+ + FA    IY  + A+
Sbjct: 359 YNQVFSTLIRTAVIPPNGHMFAIADYSAIEARLTAWFCNEEWRQEVFATTGKIYEASAAQ 418

Query: 416 AFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFE 473
            F+ PI+ V+K  + R  GKV ELALGY GG    + M    G D+   S++        
Sbjct: 419 MFHVPIESVTKGSDLRKKGKVAELALGYGGGVSALERMG---GADM-GLSEDE------- 467

Query: 474 DWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQ 533
                      MQD                 +V K WR     + ++W  + +     V+
Sbjct: 468 -----------MQD-----------------IVNK-WRLASPNIKKMWYRVQDAAYTAVR 498

Query: 534 EGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK------GD-CSYLNTATSQ 586
           E      +RV+ V  +        +   LPS RRL Y   K      GD  +Y    + Q
Sbjct: 499 E-----RKRVSVVHGVRYFYSSGILFAELPSGRRLAYVRPKLKKGRYGDELTYEGYGSDQ 553

Query: 587 -------LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP-D 638
                    R++T+GGKL EN++QAI+RD L + M      GY I++ +HDE+V E P +
Sbjct: 554 DGKQTKKWCRQKTWGGKLFENLIQAIARDCLAKAMLKLDDVGYKIIMHIHDEVVVEVPSE 613

Query: 639 TPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           T    +  +  +M +   WA GL L A+G+ ++ YRK
Sbjct: 614 TAESCLIDIERIMGEPIPWAPGLILTADGFISEYYRK 650


>gi|226949733|ref|YP_002804824.1| DNA polymerase [Clostridium botulinum A2 str. Kyoto]
 gi|226841086|gb|ACO83752.1| DNA polymerase [Clostridium botulinum A2 str. Kyoto]
          Length = 655

 Score =  316 bits (810), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 231/712 (32%), Positives = 342/712 (48%), Gaps = 95/712 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M+ L ID+ET S   +   G + Y E     I L AYA++DEPV++ D T+  A+P  ++
Sbjct: 1   MTTLAIDVETYSSIDIKTSGAYKYCEAPDFEILLFAYAFNDEPVQIVDFTQHEALPQRVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALN 117
             L D  V+  A N+ FER   K  +  +  P  +W CT + A T GLPSSL     AL 
Sbjct: 61  DALYDPDVIKTAFNANFERSAIKFGVSSLPCPPGQWECTMIKALTLGLPSSLDMVGKALK 120

Query: 118 FSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----HVQAWQLFGEYCKRDVEATREL 173
             E   KM+EGKALI  FCK    +   D    N     ++ W+ F EYCKRDVE  RE+
Sbjct: 121 LEEDKQKMKEGKALIQYFCKPCKPTKTNDKRTRNLPKHDMEKWETFKEYCKRDVEVEREI 180

Query: 174 FKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGI 231
              L        E+ LW LDQ INDRG   DL L+ +  E      ++L +  +KLT   
Sbjct: 181 RNLLNRYETKAEEQKLWQLDQHINDRGIDTDLILIKQAIECDTNYTERLTKAAIKLTG-- 238

Query: 232 IRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS---NITQLAKDLILNRLASSGSA 288
           + +      ++ ++    G ++  +++ ++  ++  +   N +++ K L L +L +  ++
Sbjct: 239 LENPNSPTQIKKWIGERLGREVKSLTKTSIPGLIEEAKDLNKSEVIKMLELRQLMAK-TS 297

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           I K +T+  A   DGR+RG LQFYGA+RTGRW+G + Q QNLP+    +  L      + 
Sbjct: 298 IKKYDTMQNARCKDGRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPD--LDNARNFVR 355

Query: 349 RG---------ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            G         +++ D L   S  +R+  I   G + +V+D + IEARV+AW AGE W++
Sbjct: 356 EGKFEEVEFLFDSVPDTL---SQLIRTAFIPREGNRFIVSDFSAIEARVIAWFAGEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
             F+    IY  + ++ F  PI+ + K  E R  GK+ ELALGY G      +M     +
Sbjct: 413 DVFSTHGKIYEASASQMFKVPIESIKKGSELRQKGKIAELALGYGGSVGALSSMDRKKSI 472

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
             ++    VKS                                         WR  +  +
Sbjct: 473 PEEELPGLVKS-----------------------------------------WRNANPNI 491

Query: 518 LQLWKDLTEGFACVVQEGGSISAR---RVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
            + W D+ +     ++E  +++ +   +    P ++         I LPS R+L Y   K
Sbjct: 492 TKFWWDVDKAAKKAIRERTTVNLQYGLKFIYDPGVLF--------IQLPSGRKLSYIRPK 543

Query: 575 --------GD-CSY--LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYD 623
                   GD  +Y  +   + Q  R  TYG KL ENIVQA SRD L E M    K GYD
Sbjct: 544 IEPHETFSGDKITYEGMEQTSKQWKRIDTYGPKLVENIVQATSRDCLREAMFRVNKEGYD 603

Query: 624 IVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           IV+ VHDE+V + P     +V  +  LM +   WA GLPLKA+GYE   Y K
Sbjct: 604 IVMHVHDEVVLDIPKD-RATVKEINELMGQPIKWAPGLPLKADGYECNYYMK 654


>gi|153938384|ref|YP_001391676.1| DNA-directed DNA polymerase I [Clostridium botulinum F str.
           Langeland]
 gi|152934280|gb|ABS39778.1| DNA-directed DNA polymerase I [Clostridium botulinum F str.
           Langeland]
          Length = 658

 Score =  313 bits (802), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 231/714 (32%), Positives = 342/714 (47%), Gaps = 106/714 (14%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L ID+ET S   +   G + Y E     I L AYA++DEPV++ D      +PS++   L
Sbjct: 8   LSIDVETYSSMDIKTSGAYKYCESPDFEILLFAYAFNDEPVQIVDLANGEKLPSNVFYAL 67

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEH 121
            D  ++  A N+ FER   K       P ++W CT V A T GLPSSL     AL F E 
Sbjct: 68  TDPNIIKTAFNANFERNSIKNQYPALCPPEQWECTMVKALTLGLPSSLDMVGKALKFEED 127

Query: 122 LTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVEATR 171
             KM+EGKALI  FCK      P   T+ N           ++ W+ F EYCKRDVE  R
Sbjct: 128 KQKMKEGKALIQYFCK------PCKPTKTNGKRTRNLPEHDMEKWETFKEYCKRDVEVER 181

Query: 172 ELFKRLIPLSDG--ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
           E+   L        E+ LW LDQ INDRG   DL L+ +  E      ++L +  ++LT 
Sbjct: 182 EIRNLLNRYETKVEEQKLWQLDQHINDRGIGTDLILIKQAIECDTNYTERLTKAAIELTG 241

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS---NITQLAKDLILNRLASSG 286
             + +      ++ ++    G ++  +++ ++  ++  +   N +++ K L L +L +  
Sbjct: 242 --LENPNSPTQIKKWIGERLGREVKSLTKTSIPGLIEEATSLNKSEVIKMLELRQLMAK- 298

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSE--------- 337
           ++I K +T+  A   DGR+RG LQFYGA+RTGRW+G + Q QNLP+    +         
Sbjct: 299 TSIKKYDTMQNARCKDGRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPDLDNARNFVR 358

Query: 338 EILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
           E   Q ++ L   +++ D L   S  +R+  I   G + +V+D + IEARV+AW AGE W
Sbjct: 359 EGKFQEVEFL--FDSVPDTL---SQLIRTAFIPREGNRFIVSDFSAIEARVIAWFAGEQW 413

Query: 398 KIKAFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHC 455
           ++  F+    IY  + ++ F   I+ + K  E R  GK+ ELALGY G      +M    
Sbjct: 414 RLDVFSTHGKIYEASASQMFKVAIESIKKGSELRQKGKIAELALGYGGSVGALSSMDRKK 473

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
            +  ++    VKS                                         WR  + 
Sbjct: 474 SIPEEELPGLVKS-----------------------------------------WRNANP 492

Query: 516 GVLQLWKDLTEGFACVVQEGGSISAR---RVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
            + + W D+ +    V++E  +++ +   +    P ++         I LPS R+L Y  
Sbjct: 493 NITKFWWDVDKAAKKVIRERTTVNLQYGLKFIYDPGVLF--------IQLPSGRKLSYIR 544

Query: 573 VK--------GD-CSY--LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNG 621
            K        GD  +Y  +   + Q  R  TYG KL ENIVQA SRD L E M    K G
Sbjct: 545 PKIEPHETFSGDKITYEGMEQTSKQWKRIDTYGPKLVENIVQATSRDCLREAMFRVDKAG 604

Query: 622 YDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           YDIV+ VHDE+V + P     +V  +  LM +   WA GLPLKA+GYE   Y+K
Sbjct: 605 YDIVMHVHDEVVLDIPKD-RATVKEINELMGQPIEWAPGLPLKADGYECNYYQK 657


>gi|303239094|ref|ZP_07325624.1| DNA-directed DNA polymerase [Acetivibrio cellulolyticus CD2]
 gi|302593432|gb|EFL63150.1| DNA-directed DNA polymerase [Acetivibrio cellulolyticus CD2]
          Length = 649

 Score =  312 bits (799), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 228/703 (32%), Positives = 339/703 (48%), Gaps = 83/703 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L   GV+ Y  A    I L  YAWDD+PV+L D      +P  ++
Sbjct: 1   MRTLAIDIETFSSVDLTSCGVYTYTAAPDFQILLFGYAWDDDPVELIDLACGERLPDAIV 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             +    V+  A N+ FERI   K L   + +  W CT++ A   GLP  L     AL  
Sbjct: 61  NAIESPEVIKTAFNAGFERICLSKHLNKHLKADSWRCTAIQAAMLGLPLHLDGVGTALKL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEATRELF 174
              + K   GK LI  F   CK +  +        +H  + WQ F +YC RDVE  RE+ 
Sbjct: 121 K--VQKDRAGKDLIRYFSIPCKSTKSNGGRTRNLPHHAPEKWQKFKDYCVRDVEVEREVR 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           +++   P+ + E  LWLLDQ IND G  +D+ LV +  +   Q   +L+ +   LT   +
Sbjct: 179 RKIERYPIPEKELKLWLLDQKINDTGVLVDMALVNQAVKCDTQYSSRLEVEAKTLTK--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G+++  +S+  ++++L+ ++  ++ + L L R   + S+I K 
Sbjct: 237 DNPNSVAQLKEWL-KEQGLEVESLSKQAVQNLLTDAD-GEIERLLTL-RQEMAKSSIAKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +  +V  D R+RG  QFYGA+RTGRW+G +FQ QNLP+    +  + + +    R + 
Sbjct: 294 AAVQRSVCPDSRVRGLFQFYGANRTGRWAGRIFQIQNLPQNHMKDLEIARMLVKQGRFKE 353

Query: 353 I-----ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGED 407
           +     + P+ L S+ +R+ +I   G + +VAD + IEARVLAW+A E W +  F     
Sbjct: 354 LELLYESVPIVL-SELIRTVLIPEQGCRFIVADFSAIEARVLAWLANEAWVLDTFKGHGK 412

Query: 408 IYVTTYAKAFNTPIDKVSK-----EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           IY  T ++ F  P++K++K     E RA GKV  LA GYQGG    K M           
Sbjct: 413 IYEQTASRMFGVPVEKIAKGNPEYELRAKGKVAVLACGYQGGVNALKAMG---------- 462

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                         A K  L  T  + + +AWR+ +Q +++ W 
Sbjct: 463 ------------------------------ADKMGLSDTELDDIVRAWRSANQRIVRFWY 492

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY------SDVKGD 576
           D+ +     V+E      R    V  L  +     + I LPS RRL Y       D++ D
Sbjct: 493 DVEKAAVLAVRE------REPQRVGILRFKVENGILFITLPSGRRLAYIRPKIEKDLRFD 546

Query: 577 CSYLNTA----TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEI 632
              L         Q  R++TYGG+L ENIVQ  +RD L E M      GY IV  VHDEI
Sbjct: 547 KDGLTYEGLGINKQWWRQKTYGGRLVENIVQGAARDCLAEAMLRVDAKGYKIVGHVHDEI 606

Query: 633 VSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           ++E       S+  LC +M +   WA GLPL+A+G+E   Y+K
Sbjct: 607 ITEMRKGQ-GSLEELCGIMGQEIPWALGLPLRADGFETMFYKK 648


>gi|325687766|gb|EGD29787.1| prophage LambdaSa04 DNA-directed DNA polymerase [Streptococcus
           sanguinis SK72]
          Length = 643

 Score =  311 bits (798), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 227/705 (32%), Positives = 340/705 (48%), Gaps = 93/705 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y +     I L AY  D+   ++ D  +   +P ++L
Sbjct: 1   MKTLSIDIETYSDVDLTKCGVYRYVDSLAFEILLFAYKEDENETQVVDLVQGEQIPEEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D+ ++  A N+ FER+   K LG  + +K W CT+VLA + GLP SL+     LN 
Sbjct: 61  LALLDDAIIKTAFNANFERVCLSKFLGEHLSAKSWSCTAVLAASLGLPLSLEGVGRVLNI 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
            E   KM+EG  LI  FC       P   T+AN ++           W+LF  YCKRDVE
Sbjct: 121 EEQ--KMKEGSRLIRYFCL------PCKATKANGMRERNFPHHAPEDWELFKSYCKRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             + +  RL   PL + E+  + LDQ INDRG  +D  LV +        ++++ +   +
Sbjct: 173 VEQAIRVRLRNYPLLESEQFFYQLDQEINDRGIEVDQQLVEQAILCDLSYKEQVTKRAYE 232

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           L+   + +      L+ +L    G+ +  + +  +   L  ++   L  +++  RL  S 
Sbjct: 233 LSG--LENPNSVSQLKGWLEE-QGVFMDSLGKKEVAKHLKEADGEVL--EMLKLRLLMSK 287

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           +++ K   +   V SDGR+ G LQFYGA+RTGRW+G + Q QNLP+ +  +  L +T+  
Sbjct: 288 TSVKKYQAIERCVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNKLKDLSLARTLVK 347

Query: 347 LNRGETIADPL-----GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKA 401
             + ET+ D L     G+ S+ +R+  +   G + +VAD A IEARVLAW++GE W+++ 
Sbjct: 348 EGQFETL-DTLYENVPGVLSELIRTAFVPKAGHQFIVADFAAIEARVLAWLSGESWRLEV 406

Query: 402 FANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDL 459
           F  G DIY  + +  F  P++K   +   R  GK+ ELALGY G       M +   LD+
Sbjct: 407 FEQGGDIYCASASSMFGVPVEKHGANSHLRQKGKIAELALGYGGSVGALTAMGA---LDM 463

Query: 460 QQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQ 519
                           E+ E   L  Q                       WR+ +  ++ 
Sbjct: 464 --------------GLEEEELQPLVNQ-----------------------WRSANPHIVA 486

Query: 520 LWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV------ 573
            W ++ +    V +       R    +  LV+      + I LPS R+L Y         
Sbjct: 487 FWWEIDKVAKQVYE------TREPKKIKNLVISYQSGMLFITLPSGRKLAYVKPRMGMNA 540

Query: 574 --KGDCSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHD 630
             K   +Y     S +  R  TYG KL ENIVQ I+RD+L  GM    + G  IVL VHD
Sbjct: 541 FGKPGLTYEGIGESKKWTRLETYGPKLVENIVQGIARDLLAYGMIQLKQKGLAIVLHVHD 600

Query: 631 EIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E V E  +    SV  +C L+   P WA+GLPL+A+GY  + Y+K
Sbjct: 601 EAVVEVREE---SVAKVCQLLATKPDWAEGLPLRADGYACEFYKK 642


>gi|327461124|gb|EGF07457.1| prophage LambdaSa04 DNA-directed DNA polymerase [Streptococcus
           sanguinis SK1057]
          Length = 643

 Score =  311 bits (798), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 227/705 (32%), Positives = 340/705 (48%), Gaps = 93/705 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y +     I L AY  D+   ++ D  +   +P ++L
Sbjct: 1   MKTLSIDIETYSDVDLTKCGVYRYVDSLAFEILLFAYKEDENETQVVDLVQGEQIPEEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D+ ++  A N+ FER+   K LG  + +K W CT+VLA + GLP SL+     LN 
Sbjct: 61  LALLDDAIIKTAFNANFERVCLSKFLGEHLSAKSWSCTAVLAASLGLPLSLEGVGRVLNI 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
            E   KM+EG  LI  FC       P   T+AN ++           W+LF  YCKRDVE
Sbjct: 121 EEQ--KMKEGSRLIRYFCL------PCKATKANGMRERNFPHHAPEDWELFKSYCKRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             + +  RL   PL + E+  + LDQ INDRG  +D  LV +        ++++ +   +
Sbjct: 173 VEQAIRVRLRNYPLLESEQFFYQLDQEINDRGIEVDQQLVEQAILCDLSYKEQVTKRAYE 232

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           L+   + +      L+ +L    G+ +  + +  +   L  ++   L  +++  RL  S 
Sbjct: 233 LSG--LENPNSVSQLKGWLEE-QGVFMDSLGKKEVAKHLKEADGEVL--EMLKLRLLMSK 287

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           +++ K   +   V SDGR+ G LQFYGA+RTGRW+G + Q QNLP+ +  +  L +T+  
Sbjct: 288 TSVKKYQAIERCVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNKLKDLSLARTLVK 347

Query: 347 LNRGETIADPL-----GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKA 401
             + ET+ D L     G+ S+ +R+  +   G + +VAD A IEARVLAW++GE W+++ 
Sbjct: 348 EGQVETL-DTLYENVPGVLSELIRTAFVPKAGHQFIVADFAAIEARVLAWLSGESWRLEV 406

Query: 402 FANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDL 459
           F  G DIY  + +  F  P++K   +   R  GK+ ELALGY G       M +   LD+
Sbjct: 407 FEQGGDIYCASASSMFGVPVEKHGANSHLRQKGKIAELALGYGGSVGALTAMGA---LDM 463

Query: 460 QQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQ 519
                           E+ E   L  Q                       WR+ +  ++ 
Sbjct: 464 --------------GLEEEELQPLVNQ-----------------------WRSANPHIVA 486

Query: 520 LWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV------ 573
            W ++ +    V +       R    +  LV+      + I LPS R+L Y         
Sbjct: 487 FWWEIDKVAKQVYE------TREPKKIKNLVISYQSGMLFITLPSGRKLAYVKPRMGMNA 540

Query: 574 --KGDCSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHD 630
             K   +Y     S +  R  TYG KL ENIVQ I+RD+L  GM    + G  IVL VHD
Sbjct: 541 FGKPGLTYEGIGESKKWTRLETYGPKLVENIVQGIARDLLAYGMIQLKQKGLAIVLHVHD 600

Query: 631 EIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E V E  +    SV  +C L+   P WA+GLPL+A+GY  + Y+K
Sbjct: 601 EAVVEVREE---SVAKVCQLLATKPDWAEGLPLRADGYACEFYKK 642


>gi|170730595|ref|YP_001776028.1| phage-related DNA polymerase [Xylella fastidiosa M12]
 gi|167965388|gb|ACA12398.1| phage-related DNA polymerase [Xylella fastidiosa M12]
          Length = 567

 Score =  309 bits (792), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 213/571 (37%), Positives = 287/571 (50%), Gaps = 58/571 (10%)

Query: 156 WQLFGEYCKRDVEATRELFKRLIP--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELI 213
           W  F EY +RDV A R++ KRL     S  E  LW LDQTINDRG  +D DL       +
Sbjct: 3   WAQFVEYARRDVAAMRDVVKRLPSHNYSGAELALWFLDQTINDRGVLVDTDLAQAAIGAV 62

Query: 214 AQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQL 273
            + +  L      LT G ++++ Q  AL  +L    G+ L DM + T++  L    + + 
Sbjct: 63  ERAKCTLAHRTEALTGGAVQAATQRDALLHHLSTEHGVALPDMQQHTVERCLDDPLLPET 122

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
            ++L+  R  +S ++  K   L    S DGRLRGTLQF GASRTGRW+G +FQP NLPR 
Sbjct: 123 VRELLSIRRQASTTSTAKYQALLNCTSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRP 182

Query: 334 ERSEEILTQTIQALNRG---ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
             S+ ++   I A+  G       D + L S  +RSC+IA   KKLVVADL+ IE RVLA
Sbjct: 183 TLSQPVIAVGIDAMKAGCVDVVFDDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLA 242

Query: 391 WIAGEDWKIKAFAN----------------------------------------GEDIYV 410
           W+AGE  K+ AF +                                        G+DIY 
Sbjct: 243 WLAGETPKLHAFGDFDTCQGVDGTWHSGEAITHGALRGAPITLQRNAEHEPIRQGDDIYK 302

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTS 470
             YA +F      V+KEQR IGKV ELALGY GG   F   A+   +DL+  ++      
Sbjct: 303 RAYAHSFGIAPQAVTKEQRQIGKVQELALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPP 362

Query: 471 TFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFAC 530
                E  E+      +Q P F + D+    AC++ K+AWR  H  +   W+ L   FA 
Sbjct: 363 LLLQ-EAVEALQWTKANQRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ--FAA 418

Query: 531 VVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS----DVKGDCSYLNTA--T 584
               G   +A     +    ++  +  + + LPS R L Y+    D  G  SY+ T   T
Sbjct: 419 TDAIGHPETAHTCCGI---TVQYSRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPIT 475

Query: 585 SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R  TYGGKL ENI QA+SRD+L   M      GY IVLTVHDE+++E  D   F+ 
Sbjct: 476 RKWTRITTYGGKLVENITQAVSRDVLAACMPAIEAAGYAIVLTVHDEMITEADDNAAFNA 535

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L +LM   P WA+GLPL AEG++  RYRK
Sbjct: 536 AHLAALMATPPPWAQGLPLAAEGFQTHRYRK 566


>gi|323484113|ref|ZP_08089483.1| hypothetical protein HMPREF9474_01234 [Clostridium symbiosum
           WAL-14163]
 gi|323402555|gb|EGA94883.1| hypothetical protein HMPREF9474_01234 [Clostridium symbiosum
           WAL-14163]
          Length = 646

 Score =  309 bits (792), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 216/702 (30%), Positives = 346/702 (49%), Gaps = 91/702 (12%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L IDIET S   L K GV+AYA+     + L AY++D    ++ D  +   +P ++   +
Sbjct: 5   LEIDIETYSDVDLIKCGVYAYADSPAFEVLLFAYSFDGGETQVIDLAQGEELPGEVSAAI 64

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEH 121
            D+ VM  A N+ FER    K  G  +  + W C++V A    LP SL+     L   + 
Sbjct: 65  FDDDVMKTAFNANFERTCLSKHFGKQLSPESWHCSAVQAAMLALPRSLEEVGAVLGLEQQ 124

Query: 122 LTKMEEGKALIARFCKGSIDSPPYDCTRAN---------HV-QAWQLFGEYCKRDVEATR 171
             KM+EGK LI  FC       P   T+AN         H  + W+LF  YC RDV+  +
Sbjct: 125 --KMKEGKDLIRYFCM------PCKPTKANGGRTRNLPCHAPEKWELFKSYCIRDVDVEK 176

Query: 172 ELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
           E+ ++L   P+ + E +L+ LDQ INDRG  +D +LV +        +  + +   +LT 
Sbjct: 177 EIRRKLQHFPIPESEMELYRLDQKINDRGVLVDRELVRQAVSCDLLYKDVVTKRAYELTG 236

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAI 289
             + +      ++ +L    G+++  +S+ T+  ++  S+     ++L+  RL  + +++
Sbjct: 237 --LENPNSVAQIKSWLGE-NGVEMESLSKKTVAGLIEESDGE--VQELLRLRLLMAKTSV 291

Query: 290 LKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNR 349
            K   +  +V SDGR+ G LQFYGA+RTGRW+G + Q QNLP+    +  + + +    R
Sbjct: 292 KKYEAMERSVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNHILDLEMARNLVKQGR 351

Query: 350 GETI-----ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
            E +     + P  + S+ +R+  I   G + VVAD + IEARVLAW++GE W+++ FA+
Sbjct: 352 FEDVELLYDSTP-NVLSELIRTAFIPKPGYRFVVADFSAIEARVLAWLSGERWRLEVFAS 410

Query: 405 GEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
              IY  + +  F+ PI++V+K    R  GK+ ELALGY G      +M +   LD+   
Sbjct: 411 HGKIYEASASAMFHVPIEEVTKGSPFRQKGKISELALGYGGAVGALTSMGA---LDMGLV 467

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
            + +    +                                     AWR+ +  + Q W 
Sbjct: 468 EEELAPLVS-------------------------------------AWRSANPHITQFWW 490

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV--------K 574
           D+    A  V+   +++ ++     R+V       + + LPS R+L Y           +
Sbjct: 491 DVD---AAAVK---AVTEKKKTRAGRIVFEYKSGILFVELPSGRKLSYVKPRMALNKFGR 544

Query: 575 GDCSYLNTATSQLM-RERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
              +Y   A ++   R  TYG KL ENIVQ  +RD+L E M    + GY IV+  HDEI+
Sbjct: 545 NGLTYEGIAENKKWDRIETYGPKLVENIVQGTARDLLAEAMLRVEEMGYPIVMHCHDEII 604

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +E P+    SV  +C++M   P WA GLPL+A+GYE   Y+K
Sbjct: 605 AEVPEGT-GSVEEMCAVMAVQPEWADGLPLRADGYECAFYKK 645


>gi|134299054|ref|YP_001112550.1| DNA-directed DNA polymerase [Desulfotomaculum reducens MI-1]
 gi|134051754|gb|ABO49725.1| DNA-directed DNA polymerase [Desulfotomaculum reducens MI-1]
          Length = 650

 Score =  309 bits (792), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 231/714 (32%), Positives = 330/714 (46%), Gaps = 104/714 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M+ L IDIET S   L K GV+AYAE     I L  YA+DDEPV+L D      +P ++L
Sbjct: 1   MTILGIDIETYSRVDLTKSGVYAYAEAEDFEILLFGYAFDDEPVQLIDLASGEQLPDNVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  ++  A N+ FER    K     +P ++W CT V A T GLP  L +    L  
Sbjct: 61  NALTDPEIIKTAFNANFERTCIAKHFNRPMPPEQWRCTHVHALTLGLPGHLGDVAKVLGL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSI-------DSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +   K   GKALI  F   CK +        + P +D  R      W  F  YCK+DV 
Sbjct: 121 KQQ--KDTAGKALIRYFSMPCKPTKVNGQRTRNLPEHDPDR------WAKFKSYCKQDVA 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             R++ K L   P+ + E  LW LDQ IND G  +D  LV        Q + KL     K
Sbjct: 173 VERDIRKTLERFPVIEAEHKLWCLDQRINDGGVLVDSQLVTNAIACDTQYQDKLMAKAAK 232

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           LT   + + +    L+ +L    G+++  +++ ++  +L  +  +   K ++  R   + 
Sbjct: 233 LTG--LDNPKSVSQLKQWLLKTDGLEVESLNKESVPELLKQTE-SSTVKQMLELRQEMAK 289

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           +++ K   +  A   DGR+RG LQFYGA+RTGRW+G + Q QNLPR   S + L Q  Q 
Sbjct: 290 TSVKKYLAMERAKGKDGRVRGLLQFYGANRTGRWAGRLVQVQNLPRN--SIKDLDQARQL 347

Query: 347 LNRG---------ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
           L  G         E++   L   S  +R+  +   G + +VAD + IEARV+AW+A E W
Sbjct: 348 LKAGDYEMLELLFESVPTVL---SQLIRTAFVPKEGHRFIVADFSAIEARVIAWLADEKW 404

Query: 398 KIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMASHC 455
           ++  F     IY  + +  F+ PI++++K    R  GKV ELALGYQGG      M    
Sbjct: 405 RMDVFRTHGKIYEASASAMFHVPIEEITKGNPLRQKGKVSELALGYQGGPGALIAMG--- 461

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
                                                A+K+ L       + K WR    
Sbjct: 462 -------------------------------------ALKEGLTEEELPGLVKLWRQSSP 484

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY----- 570
            +++ W D        V+E  ++      +            + I LPS RRL Y     
Sbjct: 485 NIVKFWYDTEAAAIKAVKEKTTVELHHGIH-----FIYESGILFIRLPSGRRLAYIKPRI 539

Query: 571 -SDVKGDCSYLN-----TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
            ++ + D   L        T Q  R  TYGGKL ENIVQA++RD L E +      GY  
Sbjct: 540 QNNPRLDKPALTYEGQEQGTKQWGRLYTYGGKLVENIVQAVARDCLAEALLRLDVAGYKT 599

Query: 625 VLTVHDEIVSETPDTPYFSVGTL---CSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V+ VHDE V E P      VG+L   C +M +   WA GLP++A+G+E+  Y+K
Sbjct: 600 VMHVHDESVMEMP----HGVGSLEDACRIMEQPIPWAPGLPMRADGFESNYYKK 649


>gi|308174986|ref|YP_003921691.1| DNA-dependent DNA polymerase, family A [Bacillus amyloliquefaciens
           DSM 7]
 gi|307607850|emb|CBI44221.1| DNA-dependent DNA polymerase, family A [Bacillus amyloliquefaciens
           DSM 7]
          Length = 648

 Score =  309 bits (791), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 234/707 (33%), Positives = 340/707 (48%), Gaps = 92/707 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+AY E +   I L AYA+D+EP+K+ D  +  A+P ++L
Sbjct: 1   MKTLSIDIETFSSVDLLKCGVYAYTEASDFEILLFAYAFDEEPIKVIDLAQGEALPHEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L    V+  A+N+ FER    K     +P  +W CT+V A T GLP +L     AL  
Sbjct: 61  VALTSSKVIKTAYNANFERTCIAKHFNTMLPPTQWRCTAVHATTLGLPGNLDGVAKALKL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
           SE   K +EGKALI  F      S P   T+AN  +           W+ F  YC +DVE
Sbjct: 121 SEQ--KDKEGKALIRYF------SVPCKPTKANGQRVRNLPEHAPDKWEKFKTYCGQDVE 172

Query: 169 ATRELFKRLI---PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIV 225
             R +  R+    PL   E++LW LDQ INDRG RID DLV        Q +  L  +  
Sbjct: 173 VERSIKNRISKFEPLK-AEQELWALDQDINDRGVRIDADLVKHAIACDEQYQAGLMVEAK 231

Query: 226 KLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASS 285
           +LT   + +   T  L+ +L    G+ +  +++  ++ ++  ++   + + L L R   +
Sbjct: 232 ELTG--LPNPNSTAQLKKWL-EDKGLSVSSLAKDKIEELIEKTDDASVHRVLRL-RQEMA 287

Query: 286 GSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQ 345
            +++ K   + +A+  D R+RG LQFYGASRTGRW+G + Q QNLP+ + ++    +T+ 
Sbjct: 288 KTSVKKYLAMEKALCPDSRVRGLLQFYGASRTGRWAGRLVQVQNLPQNKIADLDTARTLL 347

Query: 346 ALNRGETIADPLG----LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKA 401
                E I    G    + S  VR+  I S G +  V+D + IEARV+AW+AGE W++  
Sbjct: 348 KGGHYEAIELLYGQVPFVLSQLVRTAFIPSEGNEFYVSDFSAIEARVIAWLAGEGWRLDV 407

Query: 402 FANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCGLD 458
           F     IY  + A+ F  P++ ++K    R  GKV ELALGYQGG      M +   GLD
Sbjct: 408 FNTHGKIYEASAAQMFKVPVESITKGSPLRQKGKVAELALGYQGGKGALIQMGALTMGLD 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                      +D+ P                 KAWR  ++ ++
Sbjct: 468 ---------------------------EDELPGLV--------------KAWRTANKKIV 486

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC- 577
           Q W D+       V+E   +  +       L        + + LPS RRL Y+  K +  
Sbjct: 487 QFWYDVEAAAVKAVKERKPVKIQH-----GLTFLCESGILFVQLPSGRRLAYAKPKLEID 541

Query: 578 --------SYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTV 628
                   +Y     S +  R  TYGGKL ENIVQA++RD L   +      GY  V+ V
Sbjct: 542 DRFGKEALTYEGKLESGKWGRLNTYGGKLVENIVQAVARDCLAVTLIRLDDAGYKTVMHV 601

Query: 629 HDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           HDE V + P      +  + S+M +   WAKGLPL A+G+    Y+K
Sbjct: 602 HDETVLDVPRGKN-ELDKVESIMGEPIPWAKGLPLTADGFITDYYKK 647


>gi|71274493|ref|ZP_00650781.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71164225|gb|EAO13939.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
          Length = 567

 Score =  308 bits (790), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 214/571 (37%), Positives = 286/571 (50%), Gaps = 58/571 (10%)

Query: 156 WQLFGEYCKRDVEATRELFKRLIP--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELI 213
           W  F EY +RDV A R++ KRL     S  E  LW LDQTINDRG  +D DL       +
Sbjct: 3   WAQFVEYARRDVAAMRDVVKRLPSHNYSGAELALWFLDQTINDRGVLVDTDLAQAAIGAV 62

Query: 214 AQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQL 273
            + +  L      LT G ++++ Q  AL  +L    G+ L DM + T++  L    + + 
Sbjct: 63  ERAKCTLAHRTEALTGGAVQAATQRDALLHHLSTEHGVALPDMQQHTVERCLDDPLLPET 122

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
            ++L+  R  +S ++  K   L    S DGRLRGTLQF GASRTGRW+G +FQP NLPR 
Sbjct: 123 VRELLSIRRQASTTSTAKYQALLNCTSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRP 182

Query: 334 ERSEEILTQTIQALNRG---ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
             S+ ++   I A+  G       D + L S  +RSC+IA   KKLVVADL+ IE RVLA
Sbjct: 183 TLSQPVIAVGIDAMKAGCVDLVFDDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLA 242

Query: 391 WIAGEDWKIKAFAN----------------------------------------GEDIYV 410
           W+AGE  K+ AF +                                        G+DIY 
Sbjct: 243 WLAGETPKLHAFRDFDTCQGVDGTWHSGEAITHGALRGAPITLQRNAEHEPIRQGDDIYK 302

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTS 470
             YA +F      V+K+QR IGKV ELALGY GG   F   A+   +DL+  ++      
Sbjct: 303 RAYAHSFGIAPQAVTKQQRQIGKVQELALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPP 362

Query: 471 TFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFAC 530
                E  E+      +Q P F + D+    AC++ K+AWR  H  +   WK L   FA 
Sbjct: 363 LLLQ-EAVEALQWTKANQRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWKALQ--FAA 418

Query: 531 VVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS----DVKGDCSYLNT--AT 584
                   +A     +    M+  +  + + LPS R L Y+    D  G  SY+ T   T
Sbjct: 419 TDAIRHPETAHTCCGI---TMQYSRAWLRMHLPSGRVLYYAAPRVDEHGALSYMGTHPMT 475

Query: 585 SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R  TYGGKL ENI QA+SRD+L   M      GY IVLTVHDEI++E  D   F+ 
Sbjct: 476 RKWTRITTYGGKLVENITQAVSRDVLAACMPAIEAAGYQIVLTVHDEIITEADDNAAFNA 535

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L +LM   P WA+GLPL AEG++  RYRK
Sbjct: 536 AHLAALMATPPPWAQGLPLAAEGFQTHRYRK 566


>gi|328913309|gb|AEB64905.1| DNA-dependent DNA polymerase, family A [Bacillus amyloliquefaciens
           LL3]
          Length = 648

 Score =  308 bits (789), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 231/706 (32%), Positives = 338/706 (47%), Gaps = 90/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+AY E     I L AYA+D+EP+K+ D  +  A+P +++
Sbjct: 1   MKTLSIDIETFSSVDLLKCGVYAYTEAPDFEILLFAYAFDEEPIKVIDLAQGEALPHEVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L    V+  A+N+ FER    K     +P  +W CT+V A T GLP +L     AL  
Sbjct: 61  VALTSSKVIKTAYNANFERTCIAKHFNTMLPPTQWRCTAVHATTLGLPGNLDGVAKALKL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
           SE   K +EGKALI  F      S P   T+AN  +           W+ F  YC +DVE
Sbjct: 121 SEQ--KDKEGKALIRYF------SVPCKPTKANGQRVRNLPEHAPDKWEKFKAYCGQDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             R +  R+    L   E++LW LDQ INDRG RID DLV        Q +  L  +  +
Sbjct: 173 VERSIKNRISKFELLKAEQELWALDQDINDRGVRIDADLVKHAIACDEQYQAGLMVEAKE 232

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           LT   + +   T  L+ +L    G+ +  +++  ++ ++  ++   + + L L R   + 
Sbjct: 233 LTG--LPNPNSTAQLKTWL-EDKGLSVSSLAKDKIEELIEKTDDASVHRVLRL-RQEMAK 288

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           +++ K   + +A+  D R+RG LQFYGASRTGRW+G + Q QNLP+ + ++    +T+  
Sbjct: 289 TSVKKYLAMEKALCPDSRVRGLLQFYGASRTGRWAGRLVQVQNLPQNKIADLDTARTLLK 348

Query: 347 LNRGETIADPLG----LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF 402
               E I    G    + S  VR+  I S G +  V+D + IEARV+AW+AGE W++  F
Sbjct: 349 GGHYEAIELLYGQVPFVLSQLVRTAFIPSEGNEFYVSDFSAIEARVIAWLAGEGWRLDVF 408

Query: 403 ANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCGLDL 459
                IY  + A+ F  P++ ++K    R  GKV ELALGYQGG      M +   GLD 
Sbjct: 409 NTHGKIYEASAAQMFKVPVESITKGSPLRQKGKVAELALGYQGGKGALIQMGALTMGLD- 467

Query: 460 QQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQ 519
                                     +D+ P                 KAWR  ++ ++Q
Sbjct: 468 --------------------------EDELPGLV--------------KAWRTANKKIVQ 487

Query: 520 LWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC-- 577
            W D+       V+E   +  +       L        + + LPS RRL Y+  K +   
Sbjct: 488 FWYDVEAAAVKAVKERKPVKIQH-----GLTFLCESGILFVQLPSGRRLAYAKPKLEIDD 542

Query: 578 -------SYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                  +Y     S +  R  TYGGKL ENIVQA++RD L   +      GY  V+ VH
Sbjct: 543 RFGKEALTYEGKLESGKWGRLNTYGGKLVENIVQAVARDCLAVTLIRLDDAGYKTVMHVH 602

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE V + P      +  + ++M +   WAKGLPL A+G+    Y+K
Sbjct: 603 DEAVLDVPRGKN-ELDKVEAIMGEPIPWAKGLPLTADGFITDYYKK 647


>gi|325690425|gb|EGD32428.1| prophage LambdaSa04 DNA-directed DNA polymerase [Streptococcus
           sanguinis SK115]
          Length = 645

 Score =  308 bits (789), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 232/717 (32%), Positives = 339/717 (47%), Gaps = 115/717 (16%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y +  Q  I L AY  D+E  ++ D  +   +P  +L
Sbjct: 1   MRTLSIDIETYSDVDLTKCGVYRYVDSPQFEILLFAYKIDEENTQIVDLAQGEELPKGIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             LRD+ V+  A N+ FER+   K L   + ++ W CT+V A + GLP SL+     LN 
Sbjct: 61  SALRDDAVVKTAFNANFERVCLSKYLKQKLSARSWSCTAVQAASLGLPLSLEGVGRVLNI 120

Query: 119 SEHLTKMEEGKALIARFC---KGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
            E   KM+EG+ LI  FC   + +I +   +    +H ++ W+LF  YCKRDVE  + + 
Sbjct: 121 EEQ--KMKEGQRLIRYFCLPCRPTIANGMRERNWPHHALEDWELFKRYCKRDVEVEQAIR 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           KRL   PL + E+ L+ LDQ INDRG  +D       QEL++Q           L D   
Sbjct: 179 KRLSNYPLLESEQLLYQLDQAINDRGIAVD-------QELVSQ---------AILGD--- 219

Query: 233 RSSRQTYALRMYLFLITGIDLVDM---------SEGTLKSILSHSNITQLAKDL---ILN 280
            S ++    R Y   ++G+D  +          ++G     L   ++ +  K++   IL 
Sbjct: 220 LSYKEQVTQRAYE--LSGLDNPNSVSQLKGWLENQGVFMDSLGKKDVAKQLKEVDGEILE 277

Query: 281 ----RLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERS 336
               RL  S +++ K   +   V SD R+ G LQFYGA+RTGRW+G + Q QNLP+ +  
Sbjct: 278 MLKLRLLMSKTSVKKYQAMERCVCSDDRVHGLLQFYGANRTGRWAGRLVQVQNLPQNKLK 337

Query: 337 EEILTQTIQALNRGETIADPL------GLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
           +  L +T+  +  G+  A  L       + S+ +R+  +  +G + +VAD A IEARVLA
Sbjct: 338 DLDLARTL--VKDGQLKALDLLYDNVPNVLSELIRTAFVPKSGHQFIVADFAAIEARVLA 395

Query: 391 WIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVF 448
           W++GE W+++ F  G DIY  + A  F  P++K  V+   R  GK+ ELALGY G     
Sbjct: 396 WLSGETWRLEVFEQGGDIYCASAASMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGAL 455

Query: 449 KTMAS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVK 507
           K M +   GLD ++    V                                         
Sbjct: 456 KAMGALDMGLDEEELQPLVNQ--------------------------------------- 476

Query: 508 KAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRR 567
             WR  +  ++  W  + +    V +       R    V  L++        I LPS R+
Sbjct: 477 --WRMANPHIVAFWWVIDKASKEVYE------TREPQKVGNLLLYYQAGMFFIALPSGRK 528

Query: 568 LVYSDVKGDCSYLNTA---------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
           L Y   + + +                +  R  TYG KL ENIVQ I+RD+L  GM    
Sbjct: 529 LAYVKPRMELNAFGKPGLTYEGIGENKKWSRIDTYGPKLVENIVQGIARDLLAHGMMQLQ 588

Query: 619 KNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           K   DIVL VHDE V E  +    SV  +C L    P WA+GLPL+A+GY  + Y+K
Sbjct: 589 KQELDIVLHVHDEAVVEVKEGEA-SVEEVCQLFATLPDWAEGLPLRADGYACQFYQK 644


>gi|300933386|ref|ZP_07148642.1| DNA-directed DNA polymerase [Corynebacterium resistens DSM 45100]
          Length = 653

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 231/716 (32%), Positives = 338/716 (47%), Gaps = 105/716 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +LF+D+ET SP  L K GV+ YAE     + L  Y+ D  PVK+ D      +P++++
Sbjct: 1   MHELFVDLETFSPVNLTKSGVYPYAEHPDFDVLLFGYSIDGNPVKVVDVASSEQLPAEVV 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPS----------KRWICTSVLARTNGLPSS 108
           + L D  V   A N+ FER+     L    P            +W CT V +   GLP S
Sbjct: 61  EALVDPGVTKWAFNAAFERVCLSAWLARHHPDLIAGRNFLDPAQWRCTMVWSAYLGLPMS 120

Query: 109 LKNACLALNFSEHLTKMEEGKALIARFC---------KGSIDSPPYDCTRANHVQAWQLF 159
           L+     L+    + K   GK LI RFC         +G + + P     A+    W+ F
Sbjct: 121 LEQVATVLDLP--VRKDSAGKKLITRFCTPARPSVLNQGEMRNLP-----ASDPDGWEQF 173

Query: 160 GEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
             Y +RDVE    +  RL   P+ + E   + LDQ IND G R+D  LV    +   Q R
Sbjct: 174 ISYNRRDVEVELAIHDRLAGFPMPEAEWATYALDQNINDTGIRLDRVLVDHAVQCDRQHR 233

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDL 277
                   +LT   + +      L+ +L    G  L  +++  + + L  +  T   +++
Sbjct: 234 ATTLARAQELTG--LENPNSPIQLKDWL-TAHGTPLQSLTKDEVAAALDTA--TGEVREV 288

Query: 278 ILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ---- 333
           +  R   + S++ K  T+      DGR RG LQFYGA RTGR++G + Q QNLPR     
Sbjct: 289 LQLRGELAKSSVKKYETMQHVAGRDGRGRGFLQFYGAGRTGRFAGRLVQVQNLPRNYLPD 348

Query: 334 --ERSEEILTQTIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
             E  + + T   +A+    +++ D L   S  +R+  + ++G + VVAD + IEARV+A
Sbjct: 349 LCEARDLVRTGEFEAVELLYDSVPDTL---SQLIRTAFVPADGHRFVVADFSAIEARVIA 405

Query: 391 WIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVF 448
           W+AGE   ++AF +G+D+Y  T ++ F  P+DK   + E R  GK+  LA GYQGG    
Sbjct: 406 WLAGEATTLQAFRDGKDLYCETASRMFGVPVDKHGANAELRQKGKIAVLACGYQGGVGAL 465

Query: 449 KTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKK 508
           K M                                         A++  L  +  + +  
Sbjct: 466 KAMG----------------------------------------ALRMGLAESELQPLVD 485

Query: 509 AWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRL 568
           AWRA +  V+QLW D+    A  ++   +IS R+   V  L        + + LPS RRL
Sbjct: 486 AWRAANPNVVQLWADIN---AAAIE---AISTRQPTGVGALTFTVESGIMFVRLPSGRRL 539

Query: 569 VYSDVK-GDCSYLNTATS--------QLMRERTYGGKLTENIVQAISRDILCEGMKNATK 619
            Y   K G+  +  TA +        +  +  TYGGKLTENIVQA++RD+L  GM    +
Sbjct: 540 AYVKPKLGENRFGGTAITHEGIATGRKWGQLETYGGKLTENIVQAVARDLLTFGMHQVDR 599

Query: 620 NGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            GY IV+ VHDEIV ET      +V  +C LM   P WA GLPL A+GY    Y K
Sbjct: 600 AGYRIVMHVHDEIVVETATA---TVDEICELMATAPDWAAGLPLAADGYACDFYMK 652


>gi|71898326|ref|ZP_00680499.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71731849|gb|EAO33907.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 567

 Score =  307 bits (787), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 213/571 (37%), Positives = 286/571 (50%), Gaps = 58/571 (10%)

Query: 156 WQLFGEYCKRDVEATRELFKRLIP--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELI 213
           W  F EY +RDV A R++ KRL     S  E  LW LDQTINDRG  +D DL       +
Sbjct: 3   WAQFVEYARRDVAAMRDVVKRLPSHNYSGAELALWFLDQTINDRGVLVDTDLAQAAIGAV 62

Query: 214 AQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQL 273
            + +  L      LT G ++++ Q  AL  +L    G+ L DM + T++  L    + + 
Sbjct: 63  ERAKCTLAHRTEALTGGAVQAATQRDALLHHLSTEHGVALPDMQQHTVERCLDDPLLPET 122

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
            ++L+  R  +S ++  K   L    S DGRLRGTLQF GASRTGRW+G +FQP NLPR 
Sbjct: 123 VRELLSIRRQASTTSTAKYQALLNCTSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRP 182

Query: 334 ERSEEILTQTIQALNRG---ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
             S+ ++   I A+  G       D + L S  +RSC+IA   KKLVVADL+ IE RVLA
Sbjct: 183 TLSQPVIAVGIDAMKAGCVDLVFDDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLA 242

Query: 391 WIAGEDWKIKAFAN----------------------------------------GEDIYV 410
           W+AGE  K+ AF +                                        G+DIY 
Sbjct: 243 WLAGETPKLHAFRDFDTCQGVDGTWHSGEAITHGALRGAPITLQRNAEHEPIRQGDDIYK 302

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTS 470
             YA +F      V+K+QR IGKV ELALGY GG   F   A+   +DL+  ++      
Sbjct: 303 RAYAHSFGIAPQAVTKQQRQIGKVQELALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPP 362

Query: 471 TFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFAC 530
                E  E+      +Q P F + D+    AC++ K+AWR  H  +   WK L   FA 
Sbjct: 363 LLLQ-EAVEALQWTKANQRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWKALQ--FAA 418

Query: 531 VVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS----DVKGDCSYLNT--AT 584
                   +A     +    M+  +  + + LPS R L Y+    D  G  SY+ T   T
Sbjct: 419 TDAIRHPETAHTCCGI---TMQYSRAWLRMHLPSGRVLYYAAPRVDEHGALSYMGTHPMT 475

Query: 585 SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R  TYGGKL ENI QA+SRD+L   M      GY IVLTVHDE+++E  D   F+ 
Sbjct: 476 RKWTRITTYGGKLVENITQAVSRDVLAACMPAIEAAGYAIVLTVHDEMITEADDNAAFNA 535

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L +LM   P WA+GLPL AEG++  RYRK
Sbjct: 536 AHLAALMATPPPWAQGLPLAAEGFQTHRYRK 566


>gi|160937655|ref|ZP_02085015.1| hypothetical protein CLOBOL_02545 [Clostridium bolteae ATCC
           BAA-613]
 gi|158439300|gb|EDP17052.1| hypothetical protein CLOBOL_02545 [Clostridium bolteae ATCC
           BAA-613]
          Length = 661

 Score =  307 bits (786), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 222/711 (31%), Positives = 343/711 (48%), Gaps = 96/711 (13%)

Query: 6   IDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPS----DLLQ 59
           +DIET S   + + GV+AYA      I L  Y +D + VK+ D T+  A P     D  +
Sbjct: 5   VDIETYSSIDIREAGVYAYASAPDFEILLIGYRYDGQDVKVIDLTDPLADPERDFPDFWE 64

Query: 60  YLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFS 119
            L    V+  A+N+ FER      LG  +P ++W CT+V A T GLP +L     AL   
Sbjct: 65  GLYSPDVIKTAYNANFERTCLASWLGRPMPPEQWRCTAVHAATLGLPGTLGGVGEALGLP 124

Query: 120 EHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDV-- 167
           E   K + GK+LI  FCK      P   T+ N +++          WQLF EY ++DV  
Sbjct: 125 EDKQKDKIGKSLIQYFCK------PCKPTKTNGMRSRNLPEHAPDKWQLFIEYNRQDVVA 178

Query: 168 EATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
           EAT     ++ P++  E++LW LDQ IND G R+D+DL  K+ +     +++L ++  KL
Sbjct: 179 EATIREKLQIYPVARQEQELWNLDQHINDHGVRLDMDLADKIIQYDGIYQERLKQEARKL 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILN------R 281
           T   + +      L+M+ F+  G+D+  +++ ++  I +     +   D++        R
Sbjct: 239 TG--LNNPNSLPQLKMWFFMTYGLDVPSITKDSIPVIEAQLKELKTTHDVLPGLRMLQIR 296

Query: 282 LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILT 341
                +++ K   +  AV  DG LRG LQFYGA+RTGRW+G + Q  NLP+ +  +  L 
Sbjct: 297 KELGKTSVKKYQAMRHAVCPDGYLRGILQFYGANRTGRWAGRIVQVHNLPQNKIPDLDLA 356

Query: 342 QTIQALNRGETI-----ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           + +      +T+       P  + S  +R+  I S G + VV+D + IEARV+AW+A E 
Sbjct: 357 RDLVKQEDFDTLELLFEGIPF-VFSQLIRTAFIPSEGYRFVVSDFSAIEARVIAWLADEK 415

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMASH 454
           W++  F     IY  + A+ F+ PI+ + K    R  GKV ELALGY GG    K M   
Sbjct: 416 WRLNVFRTHGKIYEASAAQMFHVPIENIKKGSRLRQQGKVAELALGYGGGFGAMKAM--- 472

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
                           T  D            D+ P              ++   WR   
Sbjct: 473 ------------DKAGTIPD------------DEIP--------------MIIANWRKAS 494

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV- 573
             + +LW++        ++E  +I  +       L      R + I LPS R+L Y D  
Sbjct: 495 PNICKLWRNAEAAARAAIEERRTIKLKH-----GLSFSYINRILFIGLPSGRKLAYYDTR 549

Query: 574 -------KGDCSY--LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
                  K   +Y  ++  T +  R +T+GGKL ENIVQA +RD L   M+  +  GY I
Sbjct: 550 IEDDEKGKSVITYAGVDQETKKWGRLKTWGGKLVENIVQATARDCLAVTMERVSGAGYQI 609

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V+ VHDEI+ + P+T   ++  + ++M +   WA+ LPL+ +GYE   Y+K
Sbjct: 610 VMHVHDEIIVDVPETDIDALEKITAIMAQPVPWAQELPLRGDGYETPFYKK 660


>gi|297585291|ref|YP_003701071.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
 gi|297143748|gb|ADI00506.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
          Length = 655

 Score =  306 bits (785), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 230/704 (32%), Positives = 342/704 (48%), Gaps = 87/704 (12%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLLQ 59
           S L IDIET S   L + GV+AYAE     I L AYA+DDE V + D  +   +P+ +L+
Sbjct: 8   SVLSIDIETFSNVDLKESGVYAYAEGEGFTILLLAYAFDDEEVIVVDLVQDEPIPTTVLK 67

Query: 60  YLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFS 119
            L D ++M  A+N+ FER      L   +P+++W C+SV A T GLP  L      LN  
Sbjct: 68  ALIDPSIMKTAYNANFERTCLAAYLNQPMPTEQWHCSSVHALTLGLPGHLDGVANVLNLG 127

Query: 120 EHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELFK 175
           +   K   GKALI  F   CK +  +         H ++ W  +  YC++DVE  R L K
Sbjct: 128 DQ--KDNAGKALIRYFSVPCKPTASNGHRTRNLPEHDLEKWHAYKAYCRQDVEVERALRK 185

Query: 176 RLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIR 233
           RL   P+ + E+ LW LDQ +ND G RID DLV +  +L A+E+  L E+  ++T   + 
Sbjct: 186 RLASNPIPEKEQRLWELDQRMNDEGVRIDTDLVRQAIQLDAKEQALLLEEAKQITG--LE 243

Query: 234 SSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLN 293
           +      LR +L    GI+   +++  +  +L       + + LIL ++ S  +++ K  
Sbjct: 244 NPNSVAQLRDWL-TSRGIETSGLAKKQVSDLLQTDLPGDVRRVLILRQMMSK-TSVKKYE 301

Query: 294 TLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--E 351
            +  ++  DG +RG LQFYGA+RTGRW+G + Q  NLP+    +  L +  Q +  G  E
Sbjct: 302 AMDRSICKDGHIRGLLQFYGANRTGRWAGRIVQAHNLPKHRIGD--LDEARQLVKTGNYE 359

Query: 352 TIADPLG----LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGED 407
            I    G    L S   R+  I   G + VV+D + IEARV+AW+AGE W++K F     
Sbjct: 360 LITTLYGSLADLLSQLTRTAFIPKKGYRFVVSDFSAIEARVIAWLAGERWRMKVFEGHGK 419

Query: 408 IYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQN 465
           IY  + ++ F  PI++++K    R  GK+ ELALGY GGAK   T      + L      
Sbjct: 420 IYEASASQMFGVPIEEITKASPLRQKGKIAELALGY-GGAKGALTQMGALEMGLS----- 473

Query: 466 VKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLT 525
                               +D+ P                 KAWR  +  ++ LW DL 
Sbjct: 474 --------------------EDELPALV--------------KAWRKANPNIVNLWYDLE 499

Query: 526 EGFACVVQEGGSISAR---RVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV--------- 573
           +     V+    ++A+   +      L+  R        LPS R L Y            
Sbjct: 500 KSAFEAVKWQKVVTAKSGIQFYGGSGLLRAR--------LPSGRSLSYVRPQIGIDERFG 551

Query: 574 KGDCSY--LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDE 631
           + + +Y  +   + Q  R  TYGGK+ EN+VQAI+RD L E M      GY I   VHDE
Sbjct: 552 REEITYEGVMQGSKQWGRISTYGGKIAENMVQAIARDCLAEAMLRLDAAGYQIRFHVHDE 611

Query: 632 IVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +V E P+    +   +  +M++   WA GLP+ A+ +E   Y+K
Sbjct: 612 VVIEVPNE-QDAKADIERIMSEPIDWAPGLPMNADSFETGYYKK 654


>gi|300856814|ref|YP_003781798.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
 gi|300436929|gb|ADK16696.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
          Length = 650

 Score =  306 bits (784), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 230/713 (32%), Positives = 337/713 (47%), Gaps = 102/713 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L ID+ET     + KVG + Y E     I L AYA++DEPV++ D  +   +P  + 
Sbjct: 1   MDTLAIDVETYCELDIKKVGAYKYCEHPSFQILLFAYAFNDEPVEVIDFAQGEELPQKVK 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L +  ++  A N+ FE    KK L   I ++ W CT V +   GLP SL      L F
Sbjct: 61  TALLNPGILKTAFNANFEINALKKYLINGIDAEDWQCTMVQSLILGLPGSLDMVGKVLRF 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN---------HV-QAWQLFGEYCKRDVE 168
            E   KM+EGKALI  FCK      P   T++N         H  + W++F +Y K+DVE
Sbjct: 121 EEDKQKMKEGKALIQYFCK------PCKPTKSNGGRTRNLPEHAPEKWEIFKKYNKQDVE 174

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             R +  +L   P ++ E+ LW LDQ INDRG   D++L+ K  E      K+L ++  +
Sbjct: 175 VERAIRNKLNRYPTTENEQRLWELDQCINDRGVGADIELIEKAIECNNSYNKRLTKEATE 234

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           LT G+   +  T  L+ ++    G ++  +++ ++ +++  S   ++ K L L +L +  
Sbjct: 235 LT-GLSNPNSPT-QLKRWIGERVGHEVKSLTKDSIPTLIKESKDEKVKKILELRQLMAK- 291

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           ++I K  T+  A   DGR+RG LQFYGA+RTGRW+G + Q QNLP+    +  L      
Sbjct: 292 TSIKKYETMQRARCEDGRMRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPD--LDDARNF 349

Query: 347 LNRGE---------TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
           +  G+         +I D L   S  +R+  I   G + +VAD + IEARV+AW AGE W
Sbjct: 350 IRTGQFDKVEFLYDSIPDTL---SQLIRTAFIPKEGNRFIVADFSAIEARVIAWYAGEQW 406

Query: 398 KIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHC 455
           ++  F N  DIY  + +K F  P++K  ++   R  GK+ ELALGY G      +M    
Sbjct: 407 RLDVFNNNGDIYCASASKMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALMSMDKKK 466

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESH---HLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
            +   +    VK      DW  A  H     W  D+                  KKA R 
Sbjct: 467 NIPEDELPGLVK------DWRDASPHITKFWWDVDK----------------AAKKAIRE 504

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           +   VLQ       G   +   G                      + I LPS R+L Y  
Sbjct: 505 RTTVVLQF------GLKFIYDPGV---------------------LFIQLPSGRKLAYIR 537

Query: 573 VKGD--------CSY--LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGY 622
            K +         +Y  L   + Q     TYG K+ ENIVQA +RD L   M+     G+
Sbjct: 538 PKIEPGPYDKPIITYEGLQQTSKQWTTLETYGPKIVENIVQATARDCLGITMQRVEDKGF 597

Query: 623 DIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            IV+ VHDE++ + P     +V  +C +  +   WA GLPLKA+GYE   Y K
Sbjct: 598 HIVMHVHDELICDVPKGK-GTVEEICDIFGEPIEWAPGLPLKADGYECNYYMK 649


>gi|297587100|ref|ZP_06945745.1| DNA-directed DNA polymerase [Finegoldia magna ATCC 53516]
 gi|297575081|gb|EFH93800.1| DNA-directed DNA polymerase [Finegoldia magna ATCC 53516]
          Length = 643

 Score =  305 bits (781), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 223/701 (31%), Positives = 341/701 (48%), Gaps = 85/701 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M KL ID+ET S   L K GV+ YAE     I L AY+ +D  VK+ D      +P ++L
Sbjct: 1   MKKLSIDLETYSSVDLGKSGVYKYAESEDFEILLFAYSINDGEVKVIDLANGEIIPEEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L DE V   A N+ FER+   + LG  +  + W CT + +   GLP SL+     L  
Sbjct: 61  SALSDENVEKWAFNANFERVCLSRFLGKRLKPQGWYCTMIWSAYLGLPLSLEKVGEVLKL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
            +   KM EGKALI  F   CK +  +       ++H ++ W  F EY +RDVE    + 
Sbjct: 121 DKQ--KMNEGKALIRYFSTPCKPTKTNGMRIRNLSHHDLEKWSTFKEYNQRDVETEMAIK 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRID---LDLVLKLQELIAQERKKLDEDIVKLTD 229
           K+L   P+S  E + + +DQ INDRG  ID   +D  +K   ++ +E     +  ++LT 
Sbjct: 179 KKLSAFPMSHSEWENYWIDQNINDRGILIDEVLVDSAIKFDGILREENM---DRAIELTG 235

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAI 289
             + +      L+ +L    G+++  +++  ++S L   N     K+++  R   S S++
Sbjct: 236 --LENPNSPLQLKEWLNK-KGLEIDSLAKKDVESALK--NTEGDIKEVLELRQELSKSSV 290

Query: 290 LKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNR 349
            K + +      D R RG +QFYGA+RTGR+SG + Q QNL R    +  L +++     
Sbjct: 291 RKYDAMKNVKGKDNRARGLIQFYGANRTGRYSGRLIQVQNLRRNNLKDLDLARSLVKNRD 350

Query: 350 GETIA----DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
            ET+      P  + S  +R+  IA  G + +++D + IEARVLAW+AGE W + AF NG
Sbjct: 351 YETMEILYESPSDILSQLIRTAFIAKEGTRFIISDFSAIEARVLAWLAGEQWVLDAFENG 410

Query: 406 EDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
           EDIY  T ++ F  P++K  V+   R  GK+  LA GYQG     K M    G+++    
Sbjct: 411 EDIYCRTASRMFGVPVEKHGVNGHLRQKGKIATLACGYQGALGALKAMG---GIEMGLSE 467

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
             ++S                                     +  +WR  +  ++ LW D
Sbjct: 468 DELQS-------------------------------------IVDSWREANPNIVSLWWD 490

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTA 583
           +      VV+       R       LV+   K  + I LPS RRL Y   K   +     
Sbjct: 491 IDSVVKRVVK------TRTKEKYKSLVISYEKGILFIELPSKRRLAYPKAKIGTNRFGGE 544

Query: 584 T---------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
           +         ++  +  +YGGK  ENIVQAI+RDIL E M    K G++IV+ +HDE+V 
Sbjct: 545 SIVYEGIVVGNKWDKIESYGGKFVENIVQAIARDILAEAMMRLEKKGFNIVMHIHDEVVI 604

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E+  +    +  + SL+   PSWA GL L A+G+E++ Y+K
Sbjct: 605 ESDSSSIEEINQIMSLV---PSWAPGLILDADGFESEFYKK 642


>gi|167039879|ref|YP_001662864.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X514]
 gi|300915307|ref|ZP_07132621.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X561]
 gi|307724797|ref|YP_003904548.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X513]
 gi|166854119|gb|ABY92528.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X514]
 gi|300888583|gb|EFK83731.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X561]
 gi|307581858|gb|ADN55257.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X513]
          Length = 644

 Score =  305 bits (780), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 226/700 (32%), Positives = 345/700 (49%), Gaps = 82/700 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ YAE     I L  Y+ D  PV++ D      +P ++ 
Sbjct: 1   MRTLSIDIETFSSVDLAKSGVYRYAEAPDFEILLFGYSVDAGPVQVVDFACGEKIPKEIQ 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           Q + D  V   A N+ FERI   K  GI +    W CT V +   GLP SL+ A +    
Sbjct: 61  QAILDNNVTKWAFNAQFERICLSKYFGIHLAPDSWRCTMVWSAYLGLPLSLEGAAIVTGA 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEATRELF 174
            +   K+ +GK LI  F   CK ++ +         H  + W  F  Y  RDVE    + 
Sbjct: 121 DKK--KLTKGKELIRYFSVPCKPTVTNGGRTRNLPEHAPEKWNSFKAYNLRDVEVELSIQ 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           ++L   P+ + E + ++LDQ INDRG ++DL+LV K  +   + R++L   + +LTD  +
Sbjct: 179 EKLQKFPMPEEEWNNYILDQQINDRGIQLDLELVKKAIQCDEKVREELTSRLKELTD--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      ++ +L    G++   + + ++K++L  +    L++ L L +L +  S++ K 
Sbjct: 237 DNPNSVVQMKSWLSE-KGLETDSLDKASVKALLKEAP-EHLSEVLELRQLLAK-SSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG-- 350
             +  AV +DGR RG LQFYGA+RTGR++G + Q QNLP+   S+  L Q  + +  G  
Sbjct: 294 TAMENAVCTDGRARGLLQFYGANRTGRFAGRLIQVQNLPQNHLSD--LEQARRLVRGGHF 351

Query: 351 ---ETIADPL-GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
              E + D + G+ S+ +R+  +   G K +VAD + IEARV+AW+AGE W+ + FA   
Sbjct: 352 DALEILYDSIPGVLSELIRTAFVPKKGYKFIVADFSAIEARVIAWLAGETWRNEVFATHG 411

Query: 407 DIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
            IY  + ++ F  P+++V+K    R  GK+ ELALGY G     K M +   LD+    +
Sbjct: 412 KIYEASASQMFKVPLEEVTKGSPLRQKGKIAELALGYGGSVGALKAMGA---LDMGLTEE 468

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDL 524
            +K                                      +  AWR  +  +++LW D+
Sbjct: 469 ELKP-------------------------------------LVYAWRNANPNIVRLWWDV 491

Query: 525 TEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT-- 582
                  V E       R+    R  M      + I LPS R+L Y   +   +   +  
Sbjct: 492 DRAVKEAVTERCRTETHRIRFEYRSGM------LLIWLPSGRQLTYVKPRMGINSFGSEA 545

Query: 583 -------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
                  AT +  R  +YG K  ENIVQAISRD+LC  M+N  ++G +IV+ VHDE+V E
Sbjct: 546 VTYEGVGATKKWERIESYGPKFVENIVQAISRDLLCHSMRNLDESGLNIVMHVHDEVVLE 605

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            P      V  +C LM + P WA GL L+A+G+E   Y+K
Sbjct: 606 VPLE--ICVQDVCVLMGQVPPWAHGLLLRADGFECDFYKK 643


>gi|304389855|ref|ZP_07371814.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|304327031|gb|EFL94270.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
          Length = 655

 Score =  303 bits (775), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 231/711 (32%), Positives = 336/711 (47%), Gaps = 93/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  LF DIE+ SP  L K GV+ YAE     + L  Y+ D  PVK+ D     +MP ++L
Sbjct: 1   MRTLFCDIESFSPAQLAKTGVYLYAEHPDFDLLLFGYSIDGGPVKVVDLAGGQSMPDEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID---------IPSKRWICTSVLARTNGLPSSL 109
             L D +V+  AHN+ FER+     L            +  ++W CT + +   GLP SL
Sbjct: 61  AALVDSSVVKWAHNAAFERVCLSAWLRAHHSELLGEGFLDPRQWRCTMIWSAYLGLPMSL 120

Query: 110 KNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----WQLFGEYCKR 165
                 L     + K   GK LI +FC  +  S      R N   A    W  F +Y +R
Sbjct: 121 DAVAAVLKLD--VQKDTVGKKLIKQFCTPATPSVLNGGKRRNPPSADPTGWARFIDYNRR 178

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE    +  RL   P+ + E D + LDQ IND G  +D  LV     +    R      
Sbjct: 179 DVEVELAIHDRLAFFPMPEAEWDTYALDQCINDAGILLDHTLVDNAVAVDEHHRNASLAR 238

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
             KLT   + +      L+ +L +  G +L  +++  + + L  +  T + K+++  R  
Sbjct: 239 AQKLTG--LDNLNSPIQLKQWL-VTRGCELESLAKAEVDAALDTA--TGVVKEVLELRGD 293

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR-------QERS 336
            + S++ K   +     +DGR RG +QFYGA RTGR++G + Q QNLPR       Q RS
Sbjct: 294 LAKSSVKKYQAMHNVAGADGRARGLIQFYGAGRTGRFAGRLVQVQNLPRNYLPDLDQARS 353

Query: 337 EEILTQTIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGE 395
             + T  + AL    E++ D L   S  +R+  I S G + +VAD + IEARV+AW+AGE
Sbjct: 354 L-VQTGNLDALELLYESVPDTL---SQLIRTAFIPSPGHRFIVADFSAIEARVIAWLAGE 409

Query: 396 DWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
              + AF  G+D+Y  T ++ F+ P++K  ++ E R  GK+  LA GY G     K M +
Sbjct: 410 TTTLAAFREGKDLYCETASRMFDVPVEKHGINGELRQKGKIAVLACGYGGSVGALKAMGA 469

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
                   F+  +              H L                    + +  AWR  
Sbjct: 470 --------FTMGLA------------EHEL--------------------KPIVDAWRQA 489

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           +  ++QLW D+ +          +IS+R+   +  L        + I LPS RRL Y   
Sbjct: 490 NPHIVQLWADVEQAAIA------AISSRQPIRLRNLRFSVESGILFIELPSGRRLAYVQP 543

Query: 574 K-GDCSYLNTATSQLMRE--------RTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + G+  +  T+ +              TYGGKL ENIVQAI+RD+L  GM    K G+ I
Sbjct: 544 RLGENRWGGTSITYTGTTTARRWGQLETYGGKLVENIVQAIARDLLVVGMHAVAKAGHRI 603

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V+ VHDEIV + P    F+V   C LM+  P+WA+GLPL A+GYE   YRK
Sbjct: 604 VMHVHDEIVIDEPTNLDFAVADACKLMSTLPAWAEGLPLDADGYECNYYRK 654


>gi|260579057|ref|ZP_05846956.1| prophage LambdaSa04, DNA polymerase [Corynebacterium jeikeium ATCC
           43734]
 gi|258602808|gb|EEW16086.1| prophage LambdaSa04, DNA polymerase [Corynebacterium jeikeium ATCC
           43734]
          Length = 653

 Score =  302 bits (774), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 232/716 (32%), Positives = 334/716 (46%), Gaps = 105/716 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +LFIDIET SP  L   GV+ YA+     + L  Y+ D  PV++ D      +P  +L
Sbjct: 1   MRELFIDIETFSPVNLANSGVYPYADHDGFELLLFGYSIDGGPVEVVDLANGHQLPEKVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPS----------KRWICTSVLARTNGLPSS 108
             L D  V+  A N+ FERI     L    P            +W CT V +   GLP S
Sbjct: 61  SALVDPLVVKWAFNATFERICLSSWLARQYPELMAGRRFLNPAQWRCTMVWSAYLGLPMS 120

Query: 109 LKNACLALNFSEHLTKMEEGKALIARFCK---------GSIDSPPYDCTRANHVQAWQLF 159
           L      L+    + K   GK LI +FC          G + +PP     A+    W+ F
Sbjct: 121 LDQVATVLHLP--VRKDSAGKKLIRQFCTPGTPSVFNLGGMRNPP-----ASDPDGWEQF 173

Query: 160 GEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
             Y +RDVE    +  RL   PL   E D + LDQ +ND G R+D  LV        Q R
Sbjct: 174 ISYNRRDVEVELAIHDRLADFPLPASEWDTYALDQNVNDTGIRLDRVLVDHAVACDRQHR 233

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDL 277
                   +LT   + +      L+ +L    G  L  +++  + + L  +  T   +++
Sbjct: 234 ATTLARAQELTG--LENPNSPIQLKDWL-AAHGAPLQSLTKDEVAAALDTA--TGQVREV 288

Query: 278 ILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ---- 333
           +L R   + S++ K   +      DGR RG LQFYGA RTGR++G + Q QNLPR     
Sbjct: 289 LLLRGELAKSSVKKYEAMQHVTGRDGRGRGFLQFYGAGRTGRFAGRLVQVQNLPRNYLPD 348

Query: 334 --ERSEEILTQTIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
             E    + T   +A+    +++ D L   S  +R+  I ++G + VVAD + IEARV+A
Sbjct: 349 LAEARSLVRTGDFEAVELLYDSVPDTL---SQLIRTAFIPADGHRFVVADFSAIEARVIA 405

Query: 391 WIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVF 448
           W+AGE   ++AF +G+D+Y  T ++ F  P+DK   + E R  GK+  LA GYQGG    
Sbjct: 406 WLAGETTTLEAFRDGKDLYCETASRMFGVPVDKHGANAELRQKGKIAVLACGYQGGVGAL 465

Query: 449 KTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKK 508
           K M                                         A++  L  +  + +  
Sbjct: 466 KAMG----------------------------------------ALRMGLAESELQPLVD 485

Query: 509 AWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRL 568
           AWRA +  V+QLW D+    A  ++   +IS R+  +V  L        + I LPS RRL
Sbjct: 486 AWRAANPSVVQLWADIN---AAAIE---TISTRQPTSVGALTFTVESGIMFIRLPSGRRL 539

Query: 569 VYSDVK-GDCSYLNTATS--------QLMRERTYGGKLTENIVQAISRDILCEGMKNATK 619
            Y   K G+  +  T+ +        +  +  TYGGKLTENIVQA++RD+L   M    +
Sbjct: 540 AYVKPKLGENRFGGTSITHEGITTGRKWGQLETYGGKLTENIVQAVARDLLTYAMHQVAE 599

Query: 620 NGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            G+ IV+ VHDEIV ET      +V  +C LM+  P WA GLPL+A+GY    Y K
Sbjct: 600 AGHRIVMHVHDEIVVETATA---TVDEICKLMSTAPDWAAGLPLEADGYACDFYMK 652


>gi|300933484|ref|ZP_07148740.1| DNA-directed DNA polymerase [Corynebacterium resistens DSM 45100]
          Length = 653

 Score =  302 bits (773), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 234/716 (32%), Positives = 331/716 (46%), Gaps = 105/716 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +LFIDIET SP  L   GV+ YA+     + L  Y+ D  PV++ D      +P  +L
Sbjct: 1   MRELFIDIETFSPVNLANSGVYPYADHDGFELLLFGYSIDGGPVEVVDLANGHQLPEKVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPS----------KRWICTSVLARTNGLPSS 108
             L D  V+  A N+ FERI     L    P            +W CT V +   GLP S
Sbjct: 61  SALVDPLVVKWAFNATFERICLSSWLARQYPELMAGRRFLNPAQWRCTMVWSAYLGLPMS 120

Query: 109 LKNACLALNFSEHLTKMEEGKALIARFCK---------GSIDSPPYDCTRANHVQAWQLF 159
           L      L+    + K   GK LI +FC          G + +PP     A+    W+ F
Sbjct: 121 LDQVATVLHLP--VRKDSAGKKLIRQFCTPGTPSVFNLGGMRNPP-----ASDPDGWEQF 173

Query: 160 GEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
             Y +RDVE    +  RL   PL   E D + LDQ +ND G R+D  LV        Q R
Sbjct: 174 ISYNRRDVEVELAIHDRLADFPLPASEWDTYALDQNVNDTGIRLDRVLVDHAVACDRQHR 233

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDL 277
                   +LT   + +      L+ +L    G  L  +++  + + L  +  T   +++
Sbjct: 234 ATTLARAQELTG--LENPNSPIQLKDWL-AAHGAPLQSLTKDEVAAALDTA--TGQVREV 288

Query: 278 ILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ---- 333
           +L R   + S++ K   +      DGR RG LQFYGA RTGR++G + Q QNLPR     
Sbjct: 289 LLLRGELAKSSVKKYEAMQHVTGRDGRGRGFLQFYGAGRTGRFAGRLVQVQNLPRNYLPD 348

Query: 334 --ERSEEILTQTIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
             E    + T    A+    +++ D L   S  +R+  I ++G + VVAD + IEARV+A
Sbjct: 349 LAEARSLVRTGNYDAVELLYDSVPDTL---SQLIRTAFIPADGHRFVVADFSAIEARVIA 405

Query: 391 WIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVF 448
           W+AGE   ++AF +G+D+Y  T ++ F  P+DK   + E R  GK+  LA GYQGG    
Sbjct: 406 WLAGEATTLEAFRDGKDLYCETASRMFGVPVDKHGANAELRQKGKIAVLACGYQGGVGAL 465

Query: 449 KTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKK 508
           K M                                         A++  L  +  + +  
Sbjct: 466 KAMG----------------------------------------ALRMGLAESELQPLVD 485

Query: 509 AWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRL 568
           AWRA +  V+QLW D+    A  ++   +IS R   +V  L        + I LPS RRL
Sbjct: 486 AWRAANPNVVQLWADIN---AAAIE---AISTRLPTSVGALTFTVESGIMFIRLPSGRRL 539

Query: 569 VYSDVK-GDCSYLNTATS--------QLMRERTYGGKLTENIVQAISRDILCEGMKNATK 619
            Y   K G+  +  TA +        +  +  TYGGKLTENIVQA++RD+L  GM    +
Sbjct: 540 AYVKPKLGENRFGGTAITHEGITTGRKWGQLETYGGKLTENIVQAVARDLLTFGMHQVDR 599

Query: 620 NGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            G+ IV+ VHDEIV ET      +V  +C LM   P WA GLPL A+GY    Y K
Sbjct: 600 AGHRIVMHVHDEIVVETATA---TVDEICKLMAITPDWAAGLPLAADGYACDFYMK 652


>gi|315656936|ref|ZP_07909823.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii subsp. holmesii ATCC 35242]
 gi|315492891|gb|EFU82495.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii subsp. holmesii ATCC 35242]
          Length = 655

 Score =  301 bits (772), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 232/712 (32%), Positives = 333/712 (46%), Gaps = 95/712 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  LF DIET SP  L K GV+ Y E     + L +Y+ D  PV++ D     +MP ++L
Sbjct: 1   MRTLFCDIETFSPVQLAKAGVYPYCEHPDFDLLLFSYSVDGGPVEIVDLANGQSMPDEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL----------GIDIPSKRWICTSVLARTNGLPSS 108
             L D  V+  AHN+ FER+     L          G   P ++W CT V +   GLP S
Sbjct: 61  AALVDPDVVKWAHNAAFERVCLSAWLHRHHSELLGDGFLDP-RQWRCTMVWSAYLGLPMS 119

Query: 109 LKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----WQLFGEYCK 164
           L      L     + K   G+ LI +FC  +  S        N   A    W  F +Y +
Sbjct: 120 LDAIAAVLKLD--VQKDSAGRKLIKQFCTPATPSVLNGGKHRNPPSADPTGWAHFIDYNR 177

Query: 165 RDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
           RDVE  + +  RL   P+ + E D + LDQ IND G  +D  LV     +    R     
Sbjct: 178 RDVEVEQAIHDRLACFPMPESEWDTYALDQRINDAGILLDHTLVDNAVAVDEHHRNASLA 237

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
              KLT   + +      L+ +L    G +L  +++  + S L  +  T   K+++  R 
Sbjct: 238 RAQKLTG--LDNPNSPIQLKQWL-ATRGCELESLAKAEVDSALDTA--TGAVKEVLELRG 292

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR-------QER 335
             + S++ K   +     SDGR RG +QFYGA RTGR++G + Q QNLPR       Q R
Sbjct: 293 DLAKSSVKKYQAMQNVAGSDGRARGLIQFYGAGRTGRFAGRLVQVQNLPRNYLPDLDQAR 352

Query: 336 SEEILTQTIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
           +  + T  + AL    E++ D L   S  +R+  I S G + +VAD + IEARV+AW+AG
Sbjct: 353 TL-VRTGNLDALELLYESVPDTL---SQLIRTAFIPSTGHRFIVADFSAIEARVIAWLAG 408

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           E   ++AF  G+D+Y  T ++ F  P++K  V+ E R  GK+  LA GY G     K M 
Sbjct: 409 ETSTLEAFREGKDLYCETASRMFGVPVEKHGVNGELRQKGKIAVLACGYGGSVGALKAMG 468

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
           +   L++      +K                                      +  AWR 
Sbjct: 469 A---LNMGLAEHELKP-------------------------------------IVDAWRQ 488

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
            +  ++ LW D+ E          +IS+R+   +  L          I LPS RRL Y  
Sbjct: 489 ANPHIVGLWADVEEAAIA------AISSRQPIRLRNLRFSVESGIFFIELPSGRRLAYVQ 542

Query: 573 VK-GDCSYLNTATSQLMRE--------RTYGGKLTENIVQAISRDILCEGMKNATKNGYD 623
            + G+  +  T+ +              TYGGKL ENIVQAI+RD+L  GM    K G+ 
Sbjct: 543 PRLGENRWGGTSVTYTGTTTARRWGQLETYGGKLVENIVQAIARDLLVTGMHAVAKAGHQ 602

Query: 624 IVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           IV+ VHDEIV + P+   F+V   C+LM+  P+WA+GLPL A+GYE   YRK
Sbjct: 603 IVMHVHDEIVIDEPENSGFTVTDACALMSTLPAWAEGLPLDADGYECAYYRK 654


>gi|317132759|ref|YP_004092073.1| DNA-directed DNA polymerase [Ethanoligenens harbinense YUAN-3]
 gi|315470738|gb|ADU27342.1| DNA-directed DNA polymerase [Ethanoligenens harbinense YUAN-3]
          Length = 662

 Score =  301 bits (772), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 235/725 (32%), Positives = 341/725 (47%), Gaps = 114/725 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + IDIET S   L K GV+ Y       I L  Y+ D  PVK+ D      +P D+L
Sbjct: 1   MKTISIDIETFSDVDLGKCGVYRYCSSPAFEILLFGYSVDGGPVKVVDLACGEKIPEDIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL-----GID---------------IPSKRWICTSV 98
             L D+TV+  A N+ FER+   + L     G+D               +  + W C+ V
Sbjct: 61  DALTDDTVLKWAFNANFERVCLSRYLRDMGRGLDPFHDNHPLSLEHARFLNPEGWRCSMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA--- 155
            A T GLP SLK     L  ++   KM+EGKALI  F      S P   T+AN  +    
Sbjct: 121 WAATMGLPLSLKGVGAVLQLADQ--KMDEGKALIKYF------SVPCAPTKANGGRTRNL 172

Query: 156 -------WQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV 206
                  W  F +Y +RDVE    + ++L   P+ D   D + +DQ INDRG RID+DLV
Sbjct: 173 PSDDPGKWATFKKYNQRDVEVEMMIQRKLRSFPVPDFVWDEYHIDQEINDRGVRIDMDLV 232

Query: 207 LKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILS 266
            K  ++  + R +L E +  +T+  + +      ++ +L    G+++  + +  + ++L 
Sbjct: 233 EKAIDMDTRSRSELTEKMQAITN--LENPNSVQQMKQWLS-DNGMEVDSLGKKAVTALLK 289

Query: 267 HSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQ 326
            +   +L + L L R   + S++ K  T+  AV SD R RG   FYGA+RTGRW+G + Q
Sbjct: 290 TAP-PELTEVLEL-RQQLAKSSVKKYQTMQRAVCSDSRARGMFMFYGANRTGRWAGRLIQ 347

Query: 327 PQNLPRQERSEEILTQTIQALNRGETIA----DPLGLASDCVRSCIIASNGKKLVVADLA 382
            QNLP+    +    + +      E +     D     S  +R+  I  +G +  VAD +
Sbjct: 348 LQNLPQNHLPDLDAARALVKSGDYEAVKMIYEDVPDTLSQLIRTAFIPKDGCRFYVADFS 407

Query: 383 GIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALG 440
            IEARV+AW AGE WK  AFANGEDIY +T  + F+ P+ K  V+ E RA GK+ ELA G
Sbjct: 408 AIEARVIAWYAGEKWKSDAFANGEDIYCSTARRMFHKPVVKHGVNGELRAKGKIAELACG 467

Query: 441 YQGGAKVFKTMAS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLI 499
           Y G     K M +   GL                            +D+ P+        
Sbjct: 468 YGGSTGALKAMGALEMGLS---------------------------EDELPD-------- 492

Query: 500 GTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVH 559
                 +  +WR  +Q +++ W D+ +     V+        +   + RL        + 
Sbjct: 493 ------IVSSWRDANQQIVKFWWDVDKAVMAAVKN------HKTTRLGRLAFFWQAGMLF 540

Query: 560 IVLPSSRRLVYSDVK-------GDC-SYLNT-ATSQLMRERTYGGKLTENIVQAISRDIL 610
           I LPS R L Y   K       G+C +Y     T +  R  +YG K  ENIVQA SRDIL
Sbjct: 541 ITLPSGRNLAYVKPKVGMNRFGGECITYEGVGGTKKWERLESYGPKFVENIVQATSRDIL 600

Query: 611 CEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEA 670
           C  MK       D+ + +HDE+V E    P  S+ TLC  M + P+WA GL L+A+GY  
Sbjct: 601 CNSMKMLRH--CDVCMHIHDELVIEA--DPRVSLDTLCEQMGRVPAWADGLVLRADGYVC 656

Query: 671 KRYRK 675
             Y+K
Sbjct: 657 DFYKK 661


>gi|153814242|ref|ZP_01966910.1| hypothetical protein RUMTOR_00451 [Ruminococcus torques ATCC 27756]
 gi|145848638|gb|EDK25556.1| hypothetical protein RUMTOR_00451 [Ruminococcus torques ATCC 27756]
          Length = 644

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 218/710 (30%), Positives = 342/710 (48%), Gaps = 102/710 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   LP  GV  YA  EQ  I L AY+ +DEP K+ D      MP +++
Sbjct: 1   MDTLAIDIETYSDVSLPDCGVHRYAASEQFEILLFAYSLNDEPTKIIDIASGQTMPEEIM 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D++V+  A N+ FER    +  G+ +  + W CT+V A    LP SL+    ALN 
Sbjct: 61  ECLMDDSVVKTAFNAAFERNCINRFFGLSLKPEGWRCTAVQASMLSLPLSLEGVGEALNL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVE 168
            +   KM EGK LI  FC       P   T+AN            + W+LF  YC RDV+
Sbjct: 121 DKK--KMSEGKDLIRYFCM------PCKPTKANGGRTRNLPSDAPEKWELFKTYCIRDVD 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDED 223
             +++  +L   P+ D E++L+ +DQ INDRG  +D +L+   +    L  +   K   +
Sbjct: 173 VEKQIRNKLAKFPIPDREQELYCMDQRINDRGIMVDRELISNAVACDLLYKEAASKRAYE 232

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSIL--SHSNITQLAKDLILNR 281
           I  L +           L+ +L    GI++  +++  ++ ++  +   ++++ K     R
Sbjct: 233 ISGLEN-----PNSVSQLKDWLNE-KGIEVDSLAKAAVEELVEKTEGEVSEMMK----LR 282

Query: 282 LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILT 341
           L+ S +++ K   +  +V  DGR+ G LQFYGA+RTGRW+G + Q  NLP+    +  L 
Sbjct: 283 LSMSKTSVKKYEAMERSVCPDGRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHMEDLELA 342

Query: 342 QTIQALNRGETI-----ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           ++I    R + +     + P  L S+ +R+  +A  G + +V+D + IEARV+ ++AGE 
Sbjct: 343 RSIVKEGRYDLVELLYDSTPEVL-SELIRTAFVAKPGCRFIVSDFSAIEARVMGYLAGEG 401

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASH 454
           W ++ F     IY  T +K F+ PI++++K    RA GKV  LA  Y G      +M + 
Sbjct: 402 WVMEEFRGAGKIYEQTASKMFHIPIEEITKGSPYRARGKVASLACQYGGAEGALVSMGAL 461

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
                                                F  +++L G       ++WR  +
Sbjct: 462 ------------------------------------NFVEEEELKGLV-----QSWRTAN 480

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
             ++  W ++       V+E      R++  V R+ +      + I LPS R L Y   +
Sbjct: 481 PHIVNYWYEIDGAVKAAVKE------RKMTTVGRVTVYYQSGMLKIALPSGRVLSYVRPR 534

Query: 575 --------GDCSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIV 625
                      SY    T+ +  R  +YG K  ENIVQA +RD+L E M    K G+DIV
Sbjct: 535 MTVNRFGSESVSYEGVGTNRKWTRIESYGAKFCENIVQATARDVLAEAMLRLEKKGFDIV 594

Query: 626 LTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             +HDE+V E P+    SV  +  +M   P W +GLPLKA G+E+  Y+K
Sbjct: 595 CHIHDEVVLEVPEGTS-SVEEVNEIMAVCPDWCEGLPLKAAGFESPFYKK 643


>gi|118852|sp|P06225|DPOL_BPSP2 RecName: Full=DNA polymerase
 gi|216151|gb|AAA32600.1| DNA polymerase (gene L; ttg start codon) [Bacillus phage SPO2]
 gi|579197|emb|CAA25691.1| unnamed protein product [Bacillus phage SPO2]
          Length = 648

 Score =  301 bits (770), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 233/709 (32%), Positives = 340/709 (47%), Gaps = 96/709 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+AY E     I L AYA+DD+PVK+ D  +   +P ++L
Sbjct: 1   MKTLSIDIETFSSVDLLKAGVYAYTEAPDFEILLFAYAFDDDPVKIIDLAQGDTLPHEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L    V+  A+N+ FER    K   + +   +W CT+V A T GLP +L     AL  
Sbjct: 61  VALTSSKVIKTAYNANFERTCIAKHFNLMLLPAQWRCTAVHATTLGLPGNLDGVAKALKL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVE 168
           S    K + GKALI  F      S P   T+AN            + W+ F  YC +DVE
Sbjct: 121 SAQ--KDKAGKALIRYF------SVPCKPTKANGQRVRNLPEHDPEKWEKFKVYCIQDVE 172

Query: 169 ATRELFKRLIPLS--DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             R +  R+      + E  LW LDQ INDRG RID+DLV        Q +  L  +  K
Sbjct: 173 VERAIKNRISKFEPLESEHKLWALDQEINDRGVRIDVDLVKHAIACDEQYQAGLIAEAKK 232

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           LT   + +   T  L+ +L    G+ +  +++  ++ ++ ++N   + + L L R   + 
Sbjct: 233 LTG--LPNPNSTAQLKKWLEE-KGLTISSLAKDKIEELIENTNDETVHRVLRL-RQEMAK 288

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           +++ K   + +A+  D R+RG LQFYGASRTGRW+G + Q QNLP Q + E++   T + 
Sbjct: 289 TSVKKYLAMEKALCPDNRVRGLLQFYGASRTGRWAGRLVQVQNLP-QNKIEDL--DTARN 345

Query: 347 LNRG---ETIADPLG----LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
           L +G   E I    G    + S  VR+  I S G +  V+D + IEARV+AW+AGE+W++
Sbjct: 346 LLKGGHYEAIELLYGQVPFVLSQLVRTAFIPSEGNEFYVSDFSAIEARVIAWLAGEEWRL 405

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
           + F     IY  + A+ F  P++ ++K    R  GKV ELALGYQGG      M + + G
Sbjct: 406 EVFNTHGKIYEASAAQMFKVPVESITKGSPLRQKGKVAELALGYQGGKGALIQMGALNMG 465

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           L                            + + PE                KAWR  ++ 
Sbjct: 466 L---------------------------AEGELPELV--------------KAWRTANKK 484

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD 576
           +++ W D+       V+E   +  +       L        + + LPS RRL Y+  K +
Sbjct: 485 IVKFWYDVEAAAIKAVKERKPVKLQH-----GLTFLYESGILFVQLPSGRRLAYAKPKLE 539

Query: 577 ---------CSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVL 626
                     +Y     S +  R  TYGGKL ENIVQA +RD L   +      GY  V+
Sbjct: 540 LDERFGKEALTYEGKLESGKWGRLNTYGGKLVENIVQATARDCLAITLMRLDNAGYKTVM 599

Query: 627 TVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            VHDE V + P      +  + ++M +  SWAKGLPL A+G+    Y+K
Sbjct: 600 HVHDEAVLDVPRGKN-ELDKVEAIMGEPISWAKGLPLTADGFVTDYYKK 647


>gi|332088061|gb|EGI93186.1| DNA-directed DNA polymerase [Shigella boydii 5216-82]
          Length = 975

 Score =  300 bits (769), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 178/447 (39%), Positives = 255/447 (57%), Gaps = 13/447 (2%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + +  
Sbjct: 6   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAA 64

Query: 64  ETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +  
Sbjct: 65  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEILGVPQDK 124

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS 181
            K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL   +
Sbjct: 125 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 184

Query: 182 --DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG  +D+ L     E + QE+K+L +   ++TDG ++++ Q  
Sbjct: 185 YQGTELALWHRDQQINDRGVCMDIQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRD 244

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    G++L DM   TL+  ++  ++    K+L+  R  +S ++  K   L + V
Sbjct: 245 ALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRQQASTTSTSKYKALMKGV 304

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       + 
Sbjct: 305 SHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDNI 364

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGEDIYVT 411
           + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF       G D+Y  
Sbjct: 365 MELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYKL 424

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELA 438
            YAKA+   +++V+K+QR IGKV+ELA
Sbjct: 425 AYAKAYGIEVERVTKDQRQIGKVLELA 451



 Score =  130 bits (328), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 122/249 (48%), Gaps = 11/249 (4%)

Query: 432 GKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPE 491
           G ++    GY GG   F T A    LDL + +         +   +A+S +     +   
Sbjct: 732 GHLIVHNCGYGGGVSAFITFALVYSLDLDELANAALPNIPRDVIREAKSWYYESVKRKST 791

Query: 492 FAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVM 551
           + + +++   AC+ +K+ WR  H      W +L       +      + ++      L +
Sbjct: 792 YGLSERVF-IACDSLKRLWRRAHPATCDFWYELERTVRTAIA-----TPQKTLYCGYLKI 845

Query: 552 RRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTATSQLMRERTYGGKLTENIVQAIS 606
           RR    + I LPS R + Y      KG+ +Y+  N+ + +  R +TYGGKL EN+ QA +
Sbjct: 846 RRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSYSRKWQRLKTYGGKLVENVTQAAA 905

Query: 607 RDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAE 666
           RD+L   M      GY IVLTVHDEI+SE PD+P +S   +  L+   P WA  +PL A 
Sbjct: 906 RDVLAGNMPLIEDAGYSIVLTVHDEIISEAPDSPDYSAEHVSQLLATVPDWATSIPLNAG 965

Query: 667 GYEAKRYRK 675
           G+E+ RYRK
Sbjct: 966 GFESYRYRK 974


>gi|218133416|ref|ZP_03462220.1| hypothetical protein BACPEC_01281 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990791|gb|EEC56797.1| hypothetical protein BACPEC_01281 [Bacteroides pectinophilus ATCC
           43243]
          Length = 644

 Score =  300 bits (768), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 217/710 (30%), Positives = 342/710 (48%), Gaps = 102/710 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   LP  GV  YA  EQ  I L AY+ +DEP ++ D      MP +++
Sbjct: 1   MDTLAIDIETYSDVSLPDCGVHRYAASEQFEILLFAYSLNDEPTRIIDLASGQTMPDEIM 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D++V+  A N+ FER    +  G+ +  + W CT+V A    LP SL+    ALN 
Sbjct: 61  ECLMDDSVVKTAFNAAFERNCINRFFGLSLKPEGWRCTAVQASMLSLPLSLEGVGEALNL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVE 168
            +   KM EGK LI  FC       P   T+AN            + W+LF  YC RDV+
Sbjct: 121 DKK--KMSEGKDLIRYFCM------PCKPTKANGGRTRNLPSDAPEKWELFKTYCIRDVD 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDED 223
             +++  +L   P+ D E++L+ +DQ INDRG  +D +L+   +    L  +   K   +
Sbjct: 173 VEKQIRNKLAKFPIPDREQELYCMDQRINDRGIMVDRELISHAVTCDLLYKEAASKRAYE 232

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSIL--SHSNITQLAKDLILNR 281
           I  L +           L+ +L    GI++  +++  ++ ++  +   I+++ K     R
Sbjct: 233 ISGLEN-----PNSVSQLKEWLNE-KGIEVDSLAKAAVEELVEKTEGEISEMMK----LR 282

Query: 282 LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILT 341
           L+ S +++ K   +  +V  DGR+ G LQFYGA+RTGRW+G + Q  NLP+    +  L 
Sbjct: 283 LSMSKTSVKKYEAMERSVCPDGRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHMEDLELA 342

Query: 342 QTIQALNRGETI-----ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           ++I    R + +     + P  + S+ +R+  +A  G + +V+D + IEARV+ ++AGE 
Sbjct: 343 RSIVKEGRYDLVELLYDSTP-DVLSELIRTAFVAKPGCRFIVSDFSAIEARVMGYLAGEG 401

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASH 454
           W ++ F     IY  T +K F+ PI++++K    RA GKV  LA  Y G      +M + 
Sbjct: 402 WVMEEFRGAGKIYEQTASKMFHIPIEEITKGSPYRARGKVASLACQYGGAEGALVSMGAL 461

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
                                                F  +++L G       ++WR  +
Sbjct: 462 ------------------------------------NFVEEEELKGLV-----QSWRTAN 480

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
             ++  W ++       V+E      R++  V R+ +      + I LPS R L Y   +
Sbjct: 481 PHIVNYWYEIDGAVKAAVKE------RKMTTVGRVTVYYQSGMLKIALPSGRVLSYVRPR 534

Query: 575 --------GDCSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIV 625
                      SY    T+ +  R  +YG K  ENIVQA +RD+L E M    K G+DIV
Sbjct: 535 MTVNRFGSESVSYEGIGTNRKWTRIESYGAKFCENIVQATARDVLAEAMLCLEKKGFDIV 594

Query: 626 LTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             +HDE+V E P+    SV  +  +M   P W +GLPLKA G+E+  Y+K
Sbjct: 595 CHIHDEVVLEVPEGTS-SVEEVNGIMAVCPDWCEGLPLKAAGFESPFYKK 643


>gi|300853539|ref|YP_003778523.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
 gi|300433654|gb|ADK13421.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
          Length = 649

 Score =  300 bits (767), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 227/710 (31%), Positives = 332/710 (46%), Gaps = 97/710 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + IDIET S   L K GV+ YAE     I L  Y+ D   VK+ D      +P +++
Sbjct: 1   MKFISIDIETFSSVNLQKSGVYRYAESEDFDILLFGYSVDGGEVKVIDLARGEKIPIEII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L D++V+  A N+ FERI   K LG+     +  K W CT + A T GLP SL+    
Sbjct: 61  NALTDDSVIKWAFNAQFERICLSKWLGMKAGTYLSPKSWQCTMIWAATLGLPLSLEGVGA 120

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCK 164
            L F +   K+ +GK LI  FC       P   T++N           ++ W++F  Y K
Sbjct: 121 VLGFKKQ--KLSQGKNLIKYFC------IPCSPTKSNGGRTRNLPHHDIEKWKMFTFYNK 172

Query: 165 RDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
           RDVE    +  +L   P+S  E   + LDQ IND G  +D+D V   ++ I+ + K   E
Sbjct: 173 RDVETEMAIQNKLSKFPVSKTEWQNYHLDQIINDGGINLDMDFV---RQAISCDEKFKAE 229

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
           +I K  +     +  + A      L  G+    +S+  +  +L  S+        I  +L
Sbjct: 230 NIKKAKELTGLENPNSPAQLKDWLLKQGMKTDSLSKAVVSELLQDSDGEIHEALSIRQQL 289

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
           A S  ++ K  ++   V SD R RG +QFYGA+RTGR+SG + Q QNLP+    +  L Q
Sbjct: 290 AKS--SVKKYTSMENVVCSDSRARGLIQFYGANRTGRYSGRLIQVQNLPQNHLPD--LKQ 345

Query: 343 TIQALNRGETIADPL------GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
               +  G   A  L       + S+ +R+  I   G + +VAD + IEARV+AW+AGE 
Sbjct: 346 ARSLVKSGNFTALDLLYDSIPSVLSELIRTAFIPRYGSRFIVADFSAIEARVIAWLAGER 405

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           W+I  FA G DIY  + ++ FN P+ K  ++   R  GK+ ELALGY G     K M   
Sbjct: 406 WRIDVFAGGGDIYCASASQMFNVPVKKNGINGHLRQKGKIAELALGYGGSVGALKAMG-- 463

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
                                                 A++  L+    + +  AWR  +
Sbjct: 464 --------------------------------------AIQMGLVEDELKPIVDAWRNSN 485

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY-SDV 573
             +  LW  +      VV+    I    +       +      + I LPS RRL Y   +
Sbjct: 486 PNITSLWWRIDRAVKTVVKTKQPIEIYGIG------IFYQSGILFIKLPSGRRLAYVKPL 539

Query: 574 KGDCSYLNTA--------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIV 625
            G+  +   +        T +  R  +YG K  ENIVQAISRDIL E M     + + IV
Sbjct: 540 IGENRFGGESVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILAEAMLKLATHEFQIV 599

Query: 626 LTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           + VHDE+V E P+    SV  +C +M++ P+WAKGL L A+GYE + Y+K
Sbjct: 600 MHVHDEVVIEAPNK-VSSVEEICRIMSETPAWAKGLILNADGYECEFYKK 648


>gi|94989082|ref|YP_597183.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS9429]
 gi|94542590|gb|ABF32639.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS9429]
          Length = 640

 Score =  300 bits (767), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 236/721 (32%), Positives = 340/721 (47%), Gaps = 128/721 (17%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K GV+ YA  E   I L AY+ D   V+  D T QS +P D+ 
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLTRQS-LPEDIK 58

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V   A N+ FER+   + LG+   +   +W CT VLA+  GLP+SL+   L L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPAQWQCTMVLAQELGLPASLEKCALYL 118

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRD 166
             ++   K   GK LI  F      S P   T+AN  +           WQ+F  YC +D
Sbjct: 119 KLAQE--KDAAGKNLIKYF------SVPCKPTKANGGRTRNLPEHDPGKWQMFINYCMQD 170

Query: 167 VEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           V     + ++L  +P+ D E D ++ DQ INDRG  +D +LV         + + L  ++
Sbjct: 171 VVVEMAIAEKLESVPVHDREWDYYVCDQRINDRGVALDKELVASALYCKDVKMESLSGEL 230

Query: 225 VKLTDGIIRSSRQTYA--LRMYLFLITGIDLVDM------SEGTLKSILSHSNITQLAKD 276
             LT     +SR      L+ + +   G+   D+      +EG LK +L           
Sbjct: 231 KALTGLDNPNSRAQLLPWLKEHGYSANGLTKADVEQELKKAEGELKRVLEL--------- 281

Query: 277 LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ--- 333
               +L ++ S++ K   +  A+ SDGR+ G LQFYGASRTGRW+G V Q QNL R    
Sbjct: 282 ----KLQTAMSSLKKYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIK 337

Query: 334 ---ERSEEILTQTIQALNRGETIADPLG-LASDCVRSCIIASNGKKLVVADLAGIEARVL 389
              +  E +  + I A+   E + D L       VR+ ++A +G    V+D + IEARV+
Sbjct: 338 DLDDAREYVKKRDIDAV---EILYDSLNDTLKQLVRTALVAKDGYTFYVSDFSAIEARVI 394

Query: 390 AWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFK 449
           AW AGE W++  F+    IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K
Sbjct: 395 AWFAGEQWRLDVFSTHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALK 454

Query: 450 TMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKA 509
            M +         +  VK                           +++L G     V   
Sbjct: 455 QMGA--------LNMGVK---------------------------EEELQG-----VVDD 474

Query: 510 WRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLV 569
           WR  ++ ++Q WKD+    A +     +I +R    + ++  R  K  + I LPS R L 
Sbjct: 475 WRRANKKIVQFWKDVQR--AAI----KAIKSRAPIKLGKIRFRYRKGFLFITLPSGRNLA 528

Query: 570 YSDVK---------------GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGM 614
           Y+  K               GD +Y          + TYGGKL ENIVQA +RDIL E +
Sbjct: 529 YARAKVEPGDYGDKIIYEGQGDRAYFTA-------QETYGGKLVENIVQATARDILAEAL 581

Query: 615 KNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYR 674
                 GYD+V  VHDE + E        +  +  LM++ P WA+GLPL +EGY  K Y 
Sbjct: 582 LRIEAAGYDVVFHVHDEAIIEGSG---LIIEEVNDLMSQAPEWAEGLPLNSEGYVTKYYM 638

Query: 675 K 675
           K
Sbjct: 639 K 639


>gi|307569599|emb|CAR82778.1| phage-related DNA polymerase family protein [Listeria monocytogenes
           L99]
          Length = 644

 Score =  299 bits (765), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 220/701 (31%), Positives = 332/701 (47%), Gaps = 92/701 (13%)

Query: 4   LFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L IDIET S + +   G +AY  +E   I L AYA+DDEPVK+ D T    +P  +L+ L
Sbjct: 6   LRIDIETYSGRDIKNCGAYAYTESEDFEILLFAYAYDDEPVKVIDLT-IDEIPDTVLEDL 64

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEH 121
            +  V+  AHN+ FER    K     +P ++W CT V     GLP+SL     AL  ++ 
Sbjct: 65  NNRRVLKTAHNANFERTCLAKYYNRKMPPEQWQCTMVHGTLLGLPASLDMMSKALRLAQE 124

Query: 122 LTKMEEGKALIARFCKGSIDSPPYDCTRAN---------HV-QAWQLFGEYCKRDVEATR 171
             K  EGKALI  FC       P   T+AN         H  + W  F EYC++DV   R
Sbjct: 125 --KDNEGKALIRYFCM------PCKPTKANGGRTRNYPEHASEKWAKFIEYCRQDVVVER 176

Query: 172 ELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
            + K++   P  + E+  W LDQ I D+G RID+DLV     +  QER +    + K   
Sbjct: 177 SIAKKIAKFPFPEDEQRNWELDQRIADKGVRIDVDLVK--HAIACQERYQ--ASLSKKAK 232

Query: 230 GI--IRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           G+  + +      L+ +L  + G  +  +++ ++  +L+  ++ +  ++++L R   S +
Sbjct: 233 GLTGLENPNSVQQLKDWLADM-GYPVSSLNKDSVSELLADEDLDEDVREMLLLRQEMSKT 291

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           +I K   +  A   DGR+RG LQF GA+RTGRW+G + Q QNLPR    +  + +  + L
Sbjct: 292 SIKKYEKMQHARCHDGRVRGLLQFNGANRTGRWAGRLVQVQNLPRNYIKD--IAEVRKDL 349

Query: 348 NRGETIADPL------GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKA 401
             G+  A  +       + S  +R+  IA +G    + D + IEARV+AW+AGE W++  
Sbjct: 350 KAGDYEAFEMMYSNVPDVLSQLIRTAFIAEDGYTFDITDFSAIEARVIAWLAGEQWRLDV 409

Query: 402 FANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQ 461
           F +   IY  + ++ F+ PI++V K  R  GKV ELALGY GG      M          
Sbjct: 410 FNSHGKIYEASASQMFHIPIEEVDKNLRQKGKVSELALGYNGGVNALIAMG--------- 460

Query: 462 FSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLW 521
                                          A++  L     + +  AWR     +  LW
Sbjct: 461 -------------------------------ALEMGLKENELQGIVDAWRKASPAITSLW 489

Query: 522 KDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK------- 574
           + + +          +IS R+      L        + I LPS R L Y   K       
Sbjct: 490 RGVEKHAKL------AISTRKSQKYKGLTFYYEAGILFIKLPSGRNLAYFRAKLVPGKYG 543

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
               Y         ++ TYGGKL ENIVQAI+RD L   ++     G D V+ VHDE ++
Sbjct: 544 PQICYEGVTDKGWRKQYTYGGKLVENIVQAIARDCLAISLRRIEDTGIDTVMHVHDEAIT 603

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E  ++   SV  L +++ +  SWA GLPL+ +G+ +  Y K
Sbjct: 604 EVQESES-SVDKLNAILAEPISWAPGLPLQGDGFSSDFYMK 643


>gi|268610653|ref|ZP_06144380.1| hypothetical protein RflaF_14297 [Ruminococcus flavefaciens FD-1]
          Length = 658

 Score =  299 bits (765), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 233/716 (32%), Positives = 336/716 (46%), Gaps = 100/716 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + ID+ETRS + + K GV+AYA+     ITL + + DD  V+L+D      +P D+L
Sbjct: 1   MKTIEIDLETRSDRDITKCGVYAYADSPYFAITLMSVSIDDGAVQLYDLANGDRVPEDIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKK------------------TLGIDIPSKRWICTSVLA 100
             L DE+V+  A N  FER+   +                  T+G  +    W CT +  
Sbjct: 61  TALVDESVVKRAFNVNFERVCLSRYLREEYPQIFRSYSIDADTVGDYLSPVGWQCTMIHC 120

Query: 101 RTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFC--KGSIDSPPYDCTRANHVQAWQL 158
           RT GL S+L +A  AL   +   KM EGKALI  FC    ++D  P   + A+  + W+ 
Sbjct: 121 RTLGLSSTLASAGAALKLEQQ--KMPEGKALIKYFCVPYDTVDGIPQFHSPADAPEKWET 178

Query: 159 FGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQE 216
           F  Y K+DVEA   + +RL   P+ D   + + LDQ INDRG R+D++LV     L AQ 
Sbjct: 179 FKAYNKQDVEAELAIDRRLSRFPVPDFIWEQFYLDQEINDRGIRVDMELVEAALTLDAQA 238

Query: 217 RKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKD 276
           +  L  ++ +LT   I +    Y L  +L    G     + +  +K +L    +    K 
Sbjct: 239 KATLSSEMRRLTG--IENPNSVYQLLEWLGE-QGYKSDCLDKAAVKELLK--TVKDPVKS 293

Query: 277 LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERS 336
           ++  RL  S S++ K   +  A  SD R RG   FYGASRTGRW+G + Q QNLP+    
Sbjct: 294 VLELRLMLSKSSVKKYQAMQTAACSDSRARGMFSFYGASRTGRWAGRIIQLQNLPQNHIP 353

Query: 337 EEILTQTIQALNRGET------IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
           +  LT+    +  G          D     S  +R+  +   G K ++AD + IEARV+A
Sbjct: 354 D--LTEARNTVKYGYYDEVEMFYGDVPDTLSQLIRTAFVPRPGYKFIIADFSAIEARVIA 411

Query: 391 WIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVF 448
           W+AGE W++ AFANG DIY  + +K F  P+ K  V+ E R  GKV ELA GY G     
Sbjct: 412 WLAGEKWRMDAFANGADIYCASASKMFGVPVVKHGVNGELRQKGKVAELACGYGGSVGAM 471

Query: 449 KTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKK 508
           K M    G  L      +K   T  DW  A  + +             K   T  + VKK
Sbjct: 472 KAMG---GDALNLSDSELKQIVT--DWRDASPNIV-------------KFWWTVDDAVKK 513

Query: 509 AWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRL 568
           A                            I  +       L      + + I LPS R+L
Sbjct: 514 A----------------------------IKQKITTETHGLQFSYQSKMLFITLPSGRKL 545

Query: 569 VYSDVK--------GDCSYLNT-ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK 619
            Y+  +           +Y+   A+ +  R  +YG K  ENIVQA++RD+L   M+  T 
Sbjct: 546 CYAHPQIGENQFGGESVTYMGVGASKKWERIESYGPKFVENIVQAVARDLLMFSMQ--TM 603

Query: 620 NGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
               IV  +HDE++ E       S+  +C  M + P+WA+GL L+A+GYE + YRK
Sbjct: 604 RCCFIVGHIHDEMIIEADRR--MSLDEVCRQMERTPAWAEGLLLRADGYECEFYRK 657


>gi|168179450|ref|ZP_02614114.1| DNA polymerase [Clostridium botulinum NCTC 2916]
 gi|182669649|gb|EDT81625.1| DNA polymerase [Clostridium botulinum NCTC 2916]
          Length = 653

 Score =  299 bits (765), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 239/719 (33%), Positives = 342/719 (47%), Gaps = 111/719 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPS--D 56
           M  L ID+ET     +  VG + Y E     I L AYA+DDEPVK+ D      +P   +
Sbjct: 1   MRTLAIDVETYCELDIKSVGAYKYCEHPSFEIMLLAYAYDDEPVKIIDIMNGEKIPEVLE 60

Query: 57  LLQYLRDETVMCVAHNSLFERILFKKTL-GIDIPSKRWICTSVLARTNGLPSSLKNACLA 115
              Y     V+  A N+ FER   K    G+      W CT V A T GLPSSL     A
Sbjct: 61  FDIYEHYSKVLKTAFNANFERNAIKAHFKGLKCHPGDWECTMVKALTLGLPSSLDMVGKA 120

Query: 116 LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKR 165
           L F E   KM+EGKALI  FCK      P   T+ N           ++ W+ F EYCKR
Sbjct: 121 LKFEEDKQKMKEGKALIQYFCK------PCKPTKTNGKRTRNLPEHDMEKWETFKEYCKR 174

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE  RE+   L     +  E++LW LDQ INDRG R+DL LV    +     +++L E+
Sbjct: 175 DVEVEREIRNLLNRYKTTIKEKELWQLDQHINDRGVRVDLVLVENAIKCDESYQERLKEE 234

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
            + LT   + +      L+ ++    G ++  +++ ++  ++  S    + K L L +L 
Sbjct: 235 AINLTG--LNNPNSPTQLKKWISERVGHEVTSLTKDSIPILIEESKDKNVKKILELRQLM 292

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ-----ERSEE 338
           +  S I K  T+  A   D R+RG LQFYGA+RTGRW+G + Q QNLP+      E +  
Sbjct: 293 AKTS-IKKYQTMLNARCDDERVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPDLEEARN 351

Query: 339 ILT----QTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
           +L     +TI+ L   ++I D L   S  +R+  I ++G + +VAD + IEARV+A++A 
Sbjct: 352 LLRNGDFETIEFL--FDSIPDTL---SQLIRTAFIPTDGNRFIVADFSAIEARVIAYLAN 406

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           E W++  F  G DIY  + +K F  P++K  ++   RA GK+ ELALGY G     +   
Sbjct: 407 EQWRLDVFKEGGDIYCASASKMFKVPVEKHGINGHLRAKGKIAELALGYGGAGGAIRAFD 466

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESH---HLWMQDQYPEFAVKDKLIGTACELVKKA 509
               +  +   + V       DW +A  H     W  D+  + A+ +K            
Sbjct: 467 KTGSIPDEDLPKLVS------DWRKASPHITQFWWNVDKAAKKAITEKTT---------- 510

Query: 510 WRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLV 569
             A H G+  ++                         P ++         I LPS R+L 
Sbjct: 511 -VALHHGIKFIYD------------------------PGVLF--------IQLPSGRKLS 537

Query: 570 Y-----------SDVKGDCSY--LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKN 616
           Y           SDV    +Y  +   + Q  R  TYG KL ENIVQA +RD L E M  
Sbjct: 538 YLRPKIEEGKFGSDV---ITYEGMEQTSKQWKRIETYGPKLVENIVQAFARDCLAETMAR 594

Query: 617 ATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             K G+ +V+ VHDE+V +       SV  +CS+  ++  WA GLPLKA+GYE   Y K
Sbjct: 595 VEKKGFKVVMHVHDELVLDV-SKEIGSVEEICSIFAESIEWAPGLPLKADGYECNYYMK 652


>gi|71911263|ref|YP_282813.1| phage-encoded DNA polymerase [Streptococcus pyogenes MGAS5005]
 gi|94992973|ref|YP_601072.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS2096]
 gi|71854045|gb|AAZ52068.1| phage-encoded DNA polymerase [Streptococcus pyogenes MGAS5005]
 gi|94546481|gb|ABF36528.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS2096]
          Length = 640

 Score =  298 bits (763), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 235/721 (32%), Positives = 339/721 (47%), Gaps = 128/721 (17%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K GV+ YA  E   I L AY+ D   V+  D T QS +P D+ 
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLTRQS-LPEDIK 58

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V   A N+ FER+   + LG+   +   +W CT VLA+  GLP+SL+   L L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPAQWQCTMVLAQELGLPASLEKCALYL 118

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRD 166
             ++   K   GK LI  F      S P   T+AN  +           WQ+F  YC +D
Sbjct: 119 KLAQE--KDAAGKNLIKYF------SVPCKPTKANGGRTRNLPEHDPGKWQMFINYCMQD 170

Query: 167 VEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           V     + ++L  +P+ D E D ++ DQ INDRG  +D +LV         + + L  ++
Sbjct: 171 VVVEMAIAEKLESVPVHDREWDYYVCDQRINDRGVALDKELVASALYCKDVKMESLSGEL 230

Query: 225 VKLTDGIIRSSRQTYA--LRMYLFLITGIDLVDM------SEGTLKSILSHSNITQLAKD 276
             LT     +SR      L+ + +   G+   D+      +EG LK +L           
Sbjct: 231 KALTGLDNPNSRAQLLPWLKEHGYSANGLTKADVEQELKKAEGELKRVLEL--------- 281

Query: 277 LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ--- 333
               +L ++ S++ K   +  A+ SDGR+ G LQFYGASRTGRW+G V Q QNL R    
Sbjct: 282 ----KLQTAMSSLKKYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIK 337

Query: 334 ---ERSEEILTQTIQALNRGETIADPLG-LASDCVRSCIIASNGKKLVVADLAGIEARVL 389
              +  E +  + I A+   E + D L       VR+ ++A +G    V+D + IEARV+
Sbjct: 338 DLDDAREYVKKRDIDAV---EILYDSLNDTLKQLVRTALVAKDGYTFYVSDFSAIEARVI 394

Query: 390 AWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFK 449
           AW AGE W++  F+    IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K
Sbjct: 395 AWFAGEQWRLDVFSTHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALK 454

Query: 450 TMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKA 509
            M +         +  VK                           +++L G   +     
Sbjct: 455 QMGA--------LNMGVK---------------------------EEELQGLVDD----- 474

Query: 510 WRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLV 569
           WR  ++ ++Q WKD+    A +     +I +R    + ++  R  K  + I LPS R L 
Sbjct: 475 WRRANKKIVQFWKDVQR--AAI----KAIKSRAPIKLGKIRFRYRKGFLFITLPSGRNLA 528

Query: 570 YSDVK---------------GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGM 614
           Y+  K               GD +Y          + TYGGKL ENIVQA +RDIL E +
Sbjct: 529 YARAKVEPGDYGDKIIYEGQGDRAYFTA-------QETYGGKLVENIVQATARDILAEAL 581

Query: 615 KNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYR 674
                 GYD+V  VHDE + E        +  +  LM + P WA+GLPL +EGY  K Y 
Sbjct: 582 LRIEAAGYDVVFHVHDEAIIEGSG---LIIEEVNDLMAQAPEWAEGLPLNSEGYVTKYYM 638

Query: 675 K 675
           K
Sbjct: 639 K 639


>gi|154504839|ref|ZP_02041577.1| hypothetical protein RUMGNA_02349 [Ruminococcus gnavus ATCC 29149]
 gi|153794722|gb|EDN77142.1| hypothetical protein RUMGNA_02349 [Ruminococcus gnavus ATCC 29149]
          Length = 644

 Score =  298 bits (762), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 211/705 (29%), Positives = 339/705 (48%), Gaps = 92/705 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   LP  GV  YA  EQ  I L AY+ +DEP ++ D      +P +++
Sbjct: 1   MDTLAIDIETYSDVSLPDCGVHRYAASEQFEILLFAYSLNDEPTQIIDLASGEKIPDEIM 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           +YL D++V+  A+N+ FER    +  G+ +  + W CT V A    LP SL+    ALN 
Sbjct: 61  EYLTDDSVIKTAYNAAFERNCINRFFGLSLKPEGWRCTLVQASMLSLPLSLEGVGEALNL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVE 168
            +   KM EGK LI  FC       P   T+AN            + W+LF  YC RDV+
Sbjct: 121 DKK--KMSEGKDLIRYFCM------PCKPTKANGGRTRNLPSDAPEKWELFKTYCTRDVD 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             +++  +L   P+ D E+ L+ +DQ INDRG  +D +L+          ++ + +   +
Sbjct: 173 VEKQIRNKLAKFPIPDREQKLYCMDQRINDRGIMVDQELIGHAVACDLLYKETVTKKAYE 232

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           ++   + +      L+ +L    GI++  +++  ++ ++   N      +++  RLA S 
Sbjct: 233 ISG--LENPNSVSQLKDWLNE-KGIEVDSLAKAAVEELVE--NTQGDVAEMMKLRLAMSK 287

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           +++ K   +  +V  DGR+ G LQFYGA+RTGRW+G + Q  NLP+    +  L +++  
Sbjct: 288 TSVKKYEAMERSVCPDGRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHMEDLELARSLVK 347

Query: 347 LNRGETI-----ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKA 401
             R + +     + P  + S+ +R+  +A  G + +V+D + IEARV+ ++AGE W ++ 
Sbjct: 348 EGRYDLVELLYDSTP-DVLSELIRTAFVARPGCRFIVSDFSAIEARVMGYLAGEGWVMEE 406

Query: 402 FANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDL 459
           F     IY  T +K F+ PI +++K    RA GKV  LA  Y G      +M +      
Sbjct: 407 FRGAGKIYEQTASKMFHIPIGEITKGSPYRARGKVASLACQYGGAEGALISMGAL----- 461

Query: 460 QQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQ 519
                                           F  +++L G       ++WR  +  ++ 
Sbjct: 462 -------------------------------NFVEEEELKGLV-----QSWRTANPHIVN 485

Query: 520 LWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK----- 574
            W ++       V+E      R++  V  + +      + I LPS R L Y   +     
Sbjct: 486 YWYEIDGAVKAAVKE------RKMTKVGMVTVYYQSGMLKITLPSGRVLSYVRPRMTVNR 539

Query: 575 ---GDCSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHD 630
                 SY    T+ +  R  +YG K  ENIVQA +RD+L E M    K G+DIV  +HD
Sbjct: 540 FGSESVSYEGIGTNRKWTRIESYGAKFCENIVQATARDVLAEAMLRLEKKGFDIVCHIHD 599

Query: 631 EIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E+V E P+    SV  +  +M   P W +GLPLKA G+E+  Y+K
Sbjct: 600 EVVLEVPEGTS-SVEEVNGIMAVCPDWCEGLPLKAAGFESPFYKK 643


>gi|157311150|ref|YP_001469195.1| polymerase [Streptococcus phage P9]
 gi|119104299|gb|ABL61044.1| polymerase [Streptococcus phage P9]
          Length = 640

 Score =  297 bits (761), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 233/715 (32%), Positives = 336/715 (46%), Gaps = 116/715 (16%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K GV+ YA  E   I L AY+ D   V+  D T QS +P D+ 
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLTRQS-LPEDIK 58

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V   A N+ FER+   + LG+   +   +W CT VLA+  GLPSSL+   L L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEATRE 172
             ++   K   GK LI  F   CK S  +         H  + WQ+F +YC +DV     
Sbjct: 119 KLAQE--KDTSGKNLIRYFSLPCKPSKTNGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMA 176

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++L  +P+ D E D +  DQ INDRG  +D +LV         + + L  ++  +T  
Sbjct: 177 IAEKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKAITGL 236

Query: 231 IIRSSRQTYA--LRMYLFLITGIDLVDM------SEGTLKSILSHSNITQLAKDLILNRL 282
              +SR      L+ + +   G+   D+      +EG LK +L               +L
Sbjct: 237 ANPNSRAQLLPWLKEHGYSANGLTKADVEQELKTAEGELKRVLEL-------------KL 283

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ------ERS 336
            ++ S++ K   +  A+ SDGR+ G LQFYGASRTGRW+G V Q QNL R       +  
Sbjct: 284 QTAMSSLKKYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAR 343

Query: 337 EEILTQTIQALNRGETIADPLG-LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGE 395
           E +  + I A+   E + D L       VR+ ++A +G    V+D + IEARV+AW AGE
Sbjct: 344 EYVKKRDIDAV---EILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEARVIAWFAGE 400

Query: 396 DWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHC 455
            W++  F+    IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K M +  
Sbjct: 401 QWRLDVFSTHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMGA-- 458

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
                  +  VK                           +++L G   +     WR  ++
Sbjct: 459 ------LNMGVK---------------------------EEELQGLVDD-----WRRANK 480

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK- 574
            ++Q WKD+            +I +R    + +L  R  K  + I LPS R L Y+  K 
Sbjct: 481 KIVQFWKDVQRAAI------KAIKSRAPIKLGKLRFRYRKGFLFITLPSGRNLAYARAKV 534

Query: 575 --------------GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN 620
                         GD +Y          + TYGGKL ENIVQA +RDIL E +      
Sbjct: 535 EPGDYGDKIIYEGQGDKAYFTA-------QETYGGKLVENIVQATARDILAEALLRIEAA 587

Query: 621 GYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           GY +V  VHDE + E       ++  +  LM + P WA+GLPL +EGY  K Y K
Sbjct: 588 GYGVVFHVHDEAIIEGSG---LTIEEVNDLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|281416455|ref|YP_003347375.1| DNA polymerase [Enterococcus phage phiFL4A]
 gi|270209631|gb|ACZ64170.1| DNA polymerase [Enterococcus phage phiFL4A]
          Length = 653

 Score =  296 bits (758), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 228/714 (31%), Positives = 338/714 (47%), Gaps = 101/714 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S + L KVGV+ YA+     I L AY+ D +PV+  D T  S +P +++
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLT-ISEIPDEIV 59

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V+ +A N+ FER+   K LG+   +   +W CT V A   GLP+SL      L
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKYLGVPYYLDPAQWHCTMVHANELGLPASLGQCAKYL 119

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHV----------QAWQLFGEYCKRD 166
           N  +   K   G  LI  F K      P   T+ N +          + WQ F EYC +D
Sbjct: 120 NIEQQ--KDTRGTQLINFFSK------PCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQD 171

Query: 167 VEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           V     +  +L   P+ + E  L+ LDQ INDRG  ID +L     +++A   +    ++
Sbjct: 172 VNVEMAIANKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLNEM 231

Query: 225 VKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
            +LT   + +      L+ +L    G     + +  +   L+  N+ +   +++  RL+ 
Sbjct: 232 KELTG--LENPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALALGNLPENVAEVLKLRLSL 288

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSE-EILTQT 343
           S S+  K   +  A  SD R+ G LQFYGA+RTGRW+G + Q QNLPR   SE +   Q 
Sbjct: 289 SNSSTKKYLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLSEIDFARQL 348

Query: 344 IQALN------RGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
           ++A +        E + D L      +R+ ++A  G + +V+D + IEARV+AW A +DW
Sbjct: 349 VKAKDVEGIELMYEDVPDTL---KQLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDW 405

Query: 398 KIKAFANGEDIYVTTYAKAFN----TPIDKVS---KEQRAIGKVMELALGYQGGAKVFKT 450
            ++ F     IY  T A+ F+    T  D  S   K+ R  GKV  LALGYQGG    K 
Sbjct: 406 VLEVFRTHGKIYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKA 465

Query: 451 MASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
           M +                               +++   E  ++D         +   W
Sbjct: 466 MGA-------------------------------LENGIEEHELQD---------IVDRW 485

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPR-LVMRRHKRDVHIVLPSSRRLV 569
           R  ++ +   W +  +     +Q GG      +   PR L   +    + I LPS R+L 
Sbjct: 486 RTANKRIKNFWHETQKAVIDCLQNGG------IKKGPRGLKFYKKAGFLFIQLPSGRKLA 539

Query: 570 YSDV---KGDCSYLNTATSQ-----LMRERTYGGKLTENIVQAISRDILCEGMKNATKNG 621
           Y+     +GD         Q        ++TYGGKL ENIVQA +RD+L E M+   + G
Sbjct: 540 YAKAHLKEGDYGPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMQRLEREG 599

Query: 622 YDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           Y IV  VHDE V+E P+    S+  +  +M+  P WA+GLPL AEG+E K Y K
Sbjct: 600 YPIVFHVHDEAVAEVPEGEK-SIEEMNEIMSVVPDWAEGLPLNAEGFETKYYMK 652


>gi|304439199|ref|ZP_07399117.1| DNA-directed DNA polymerase [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372331|gb|EFM25919.1| DNA-directed DNA polymerase [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 643

 Score =  296 bits (757), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 218/707 (30%), Positives = 339/707 (47%), Gaps = 97/707 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M K+ ID+ET S   L K GV+ YAE     I L AY+ DD  VK+ D      +P ++L
Sbjct: 1   MKKISIDLETYSSVDLGKSGVYKYAESEDFEILLFAYSIDDGEVKVIDLASGEIIPEEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L DE++   A N+ FER+   + L   +  + W CT + +   GLP SL+     L  
Sbjct: 61  SALSDESIEKWAFNANFERVCLSRFLEERLKPQGWYCTMIWSAYLGLPLSLEKVGEVLKL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
            +   KM EGKALI  F      S P   T+ N ++           W +F EY +RDVE
Sbjct: 121 DKQ--KMNEGKALIRYF------SIPCKPTKTNGMRTRNLPHHDLGKWYIFKEYNQRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRID---LDLVLKLQELIAQERKKLDED 223
              E+ K+L   P+   E + + +DQ INDRG  ID   +D  +K  E++ +E     + 
Sbjct: 173 TEMEIKKKLSVFPMPQSEWENYWVDQNINDRGILIDEILVDSAIKFDEILREENM---DR 229

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
            ++LT   + +      L+ +L    G+++  +++  ++S +   N     K+++  R  
Sbjct: 230 AIELTG--LENPNSPLQLKEWLNK-KGLEIDSLAKKDVESAIK--NAEGDIKEVLELRQE 284

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
            S S++ K + +      + R RG +QFYGA+RTGR+SG + Q QNL R    +  L ++
Sbjct: 285 LSKSSVRKYDAMKNVKGKENRARGLIQFYGANRTGRYSGRLIQVQNLRRNNLKDLDLARS 344

Query: 344 IQALNRGETIA----DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
           +      ET+      P  + S  +R+  I   G + +++D + IEARVLAWIA E W +
Sbjct: 345 LVKNRDYETMEFLYESPSDILSQLIRTAFIPKEGTRFIISDFSAIEARVLAWIAEEQWVL 404

Query: 400 KAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
            AF NGEDIY  T ++ F  P++K  ++   R  GK+  LA GYQG     K M    G+
Sbjct: 405 DAFENGEDIYCRTASRMFGVPVEKHGINGHLRQKGKIATLACGYQGALGALKAMG---GI 461

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
           ++      ++S                                     +  +WR  +  +
Sbjct: 462 EMGLSEDELQS-------------------------------------IVDSWREANPNI 484

Query: 518 LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC 577
           + LW D+      VV+       R       LV+   K  + I LPS RRL Y   K   
Sbjct: 485 VSLWWDIDSVVKRVVK------TRSKEEYKNLVISYEKGILFIELPSKRRLAYPKAKIGM 538

Query: 578 SYLNTAT---------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTV 628
           +     +         ++  +  +YGGK  ENIVQAI+RDIL E M    K G++IV+ +
Sbjct: 539 NRFGGESVVYEGIVVGNKWDKIESYGGKFVENIVQAIARDILAEAMMRLEKKGFNIVMHI 598

Query: 629 HDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           HDE+V E+  +   S+  +  +M+  P WA GL L A+G+E++ Y+K
Sbjct: 599 HDEVVIESDSS---SIEEVNQIMSIVPGWASGLILDADGFESEFYKK 642


>gi|29374964|ref|NP_814117.1| DNA polymerase, putative [Enterococcus faecalis V583]
 gi|29342422|gb|AAO80188.1| DNA polymerase, putative [Enterococcus faecalis V583]
 gi|315574067|gb|EFU86258.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0309B]
 gi|315582012|gb|EFU94203.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0309A]
          Length = 653

 Score =  296 bits (757), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 229/714 (32%), Positives = 337/714 (47%), Gaps = 101/714 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S + L KVGV+ YA+     I L AY+ D +PV+  D T  S +P +++
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLT-ISEIPDEIV 59

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V+ +A N+ FER+   K LGI   +   +W CT V A   GLP+SL      L
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKYLGIPYYLDPAQWHCTMVHANELGLPASLGQCAKYL 119

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHV----------QAWQLFGEYCKRD 166
           N  +   K   G  LI  F K      P   T+ N +          + WQ F EYC +D
Sbjct: 120 NIEQQ--KDTRGTQLINFFSK------PCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQD 171

Query: 167 VEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           V     +  +L   P+ + E  L+ LDQ INDRG  ID +L     +++A   +    ++
Sbjct: 172 VNVEMAIANKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLNEM 231

Query: 225 VKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
             LT   + +      L+ +L    G     + +  +   L+  N+ +   +++  RL+ 
Sbjct: 232 KALTG--LENPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALALGNLPENVAEVLKLRLSL 288

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSE-EILTQT 343
           S S+  K   +  A  SD R+ G LQFYGA+RTGRW+G + Q QNLPR   SE +   Q 
Sbjct: 289 SNSSTKKYLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLSEIDFARQL 348

Query: 344 IQALN------RGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
           ++A +        E + D L      +R+ ++A  G + +V+D + IEARV+AW A +DW
Sbjct: 349 VKAKDVEGIELMYEDVPDTL---KQLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDW 405

Query: 398 KIKAFANGEDIYVTTYAKAFN----TPIDKVS---KEQRAIGKVMELALGYQGGAKVFKT 450
            ++ F     IY  T A+ F+    T  D  S   K+ R  GKV  LALGYQGG    K 
Sbjct: 406 VLEVFRTHGKIYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKA 465

Query: 451 MASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
           M +                               +++   E  ++D         +   W
Sbjct: 466 MGA-------------------------------LENGIEEHELQD---------IVDRW 485

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPR-LVMRRHKRDVHIVLPSSRRLV 569
           R  ++ +   W +  +     +Q GG      +   PR L   +    + I LPS R+L 
Sbjct: 486 RTANKRIKNFWHETQKAVIDCLQNGG------IKKGPRGLKFYKKAGFLFIQLPSGRKLA 539

Query: 570 YSDV---KGDCSYLNTATSQ-----LMRERTYGGKLTENIVQAISRDILCEGMKNATKNG 621
           Y+     +GD         Q        ++TYGGKL ENIVQA +RD+L E M+   + G
Sbjct: 540 YAKAHLKEGDYGPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMQRLEREG 599

Query: 622 YDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           Y IV  VHDE V+E P+    S+  +  +M+  P WA+GLPL AEG+E K Y K
Sbjct: 600 YPIVFHVHDEAVAEVPEGEK-SIEEMNKIMSVVPDWAEGLPLNAEGFETKYYMK 652


>gi|57233569|ref|YP_180826.1| family A DNA-dependent DNA polymerase [Dehalococcoides ethenogenes
           195]
 gi|57224017|gb|AAW39074.1| DNA-dependent DNA polymerase, family A [Dehalococcoides ethenogenes
           195]
          Length = 646

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 226/708 (31%), Positives = 335/708 (47%), Gaps = 96/708 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y E     I L  Y+ D   V++ D T    +PSD++
Sbjct: 1   MKSLSIDIETYSSANLAKSGVYRYVESPDFEILLFGYSVDGGEVQVVDLTSGEKLPSDVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L DETV+  A N+ FERI   + LG+     I    W C+ V A T GLP SL+    
Sbjct: 61  TALTDETVIKWAFNANFERICLSRFLGLPTGKYINPASWKCSMVWAATMGLPLSLEGVGS 120

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHV----QAWQLFGEYCKRDVEAT 170
            L   +   K+ EGK LI  F +    +        NH+      W  F +Y  RD+E  
Sbjct: 121 VLKLDKQ--KLTEGKDLIKYFSQPCAPTKSNGQRTRNHLYHAPDKWSAFKKYNIRDIETE 178

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
             + ++L   P+ D   D + LDQ INDRG  +D+ LV +   +  + R +L   +  LT
Sbjct: 179 MSIQEKLTRFPVQDSIWDEYHLDQEINDRGVALDMTLVQEAIAMDGRSRSELTTAMKHLT 238

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
           +  + +      ++ +L    G++   + +  +  +L  + +  LA D++  R   + S+
Sbjct: 239 E--LDNPNSVQQMKQWL-ADNGMETDTLGKKIVAELLKTAPL-DLA-DVLSLRQQLAKSS 293

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K   +  AV +DGR RG  QF+GA+RTGRW+G + Q QNLP+     E L +    + 
Sbjct: 294 VRKYQAMENAVCTDGRARGMFQFFGANRTGRWAGRLIQMQNLPQNHL--EDLAEARALVR 351

Query: 349 RG---------ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            G         E + D L   S  +R+  +   G +L+V+D + IEARV+AW+AGE+W+ 
Sbjct: 352 FGDFDALEMLYEDVPDTL---SQLIRTAFVPKAGARLIVSDFSAIEARVIAWMAGEEWRQ 408

Query: 400 KAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             FA G DIY  + ++ F  P++K  ++   R  GK+ ELALGY G     K M +   G
Sbjct: 409 DVFAKGGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMGALDMG 468

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           L+                           +D+ P+                 AWR  +  
Sbjct: 469 LE---------------------------EDELPQLV--------------DAWRQANPC 487

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY------ 570
           +++ W D+ +     V+       +R  +   +        + I LPS RRL Y      
Sbjct: 488 IVKFWWDVDKAAMEAVR------YKRTNSTHGITFSCQSGMLFITLPSGRRLAYVKPRIG 541

Query: 571 -SDVKGDC-SYLNT-ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLT 627
            +   G C +Y    AT +  R  +YG K  ENIVQA +RDILC  M+  T     IV+ 
Sbjct: 542 ENKFGGQCITYEGVGATKKWERLDSYGPKFVENIVQATARDILCNAMQ--TLQHCSIVMH 599

Query: 628 VHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           VHDEIV E    P  S+  +C  M + PSWAKGL L+A+GYE   Y+K
Sbjct: 600 VHDEIVIEA--DPRMSLKAVCEQMGRTPSWAKGLLLRADGYETDFYKK 645


>gi|257088833|ref|ZP_05583194.1| DNA polymerase [Enterococcus faecalis CH188]
 gi|256997645|gb|EEU84165.1| DNA polymerase [Enterococcus faecalis CH188]
 gi|315160597|gb|EFU04614.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0645]
 gi|315579443|gb|EFU91634.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0630]
          Length = 653

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 229/714 (32%), Positives = 337/714 (47%), Gaps = 101/714 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S + L KVGV+ YA+     I L AY+ D +PV+  D T  S +P +++
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLT-ISEIPDEIV 59

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V+ +A N+ FER+   K LG+   +   +W CT V A   GLP+SL      L
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKYLGVPYYLDPAQWHCTMVHANELGLPASLGQCAKYL 119

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHV----------QAWQLFGEYCKRD 166
           N  +   K   G  LI  F K      P   T+ N +          + WQ F EYC +D
Sbjct: 120 NIEQQ--KDTRGTQLINFFSK------PCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQD 171

Query: 167 VEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           V     +  +L   P+ + E  L+ LDQ INDRG  ID +L     +++A   +    ++
Sbjct: 172 VNVEMAIANKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLNEM 231

Query: 225 VKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
            +LT   + +      L+ +L    G     + +  +   L+  N+ +   +++  RL+ 
Sbjct: 232 KELTG--LENPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALALGNLPENVAEVLKLRLSL 288

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSE-EILTQT 343
           S S+  K   +  A  SD R+ G LQFYGA+RTGRW+G + Q QNLPR   SE +   Q 
Sbjct: 289 SNSSTKKYLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLSEIDFARQL 348

Query: 344 IQALN------RGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
           ++A +        E + D L      +R+ ++A  G + +V+D + IEARV+AW A +DW
Sbjct: 349 VKAKDVEGIELMYEDVPDTL---KQLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDW 405

Query: 398 KIKAFANGEDIYVTTYAKAFN----TPIDKVS---KEQRAIGKVMELALGYQGGAKVFKT 450
            ++ F     IY  T A+ F+    T  D  S   K+ R  GKV  LALGYQGG    K 
Sbjct: 406 VLEVFRTHGKIYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKA 465

Query: 451 MASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
           M +                               +++   E  ++D         +   W
Sbjct: 466 MGA-------------------------------LENGIEEHELQD---------IVDRW 485

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPR-LVMRRHKRDVHIVLPSSRRLV 569
           R  ++ +   W +  +     +Q GG      +   PR L   +    + I LPS R+L 
Sbjct: 486 RTANKRIKNFWHETQKAVIDCLQNGG------IKKGPRGLKFYKKAGFLFIQLPSGRKLA 539

Query: 570 YSDV---KGDCSYLNTATSQ-----LMRERTYGGKLTENIVQAISRDILCEGMKNATKNG 621
           Y+     +GD         Q        ++TYGGKL ENIVQA +RD+L E M    K G
Sbjct: 540 YAKAHLEQGDYGPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMVRLEKAG 599

Query: 622 YDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           Y IV  VHDE V+E P+    S+  +  +M+  P WA+GLPL AEG+E K Y K
Sbjct: 600 YPIVFHVHDEAVAEVPEGEK-SIEEMNEIMSVVPDWAEGLPLNAEGFETKYYMK 652


>gi|255525749|ref|ZP_05392680.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
 gi|296188034|ref|ZP_06856426.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
 gi|255510572|gb|EET86881.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
 gi|296047160|gb|EFG86602.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
          Length = 646

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 225/702 (32%), Positives = 332/702 (47%), Gaps = 88/702 (12%)

Query: 4   LFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L IDIET S   + K GV+AY  AE   I L AYA++D+ + + D      +P  +++ L
Sbjct: 2   LSIDIETYSSVDITKSGVYAYTEAEDFEILLFAYAYEDKEINIIDLAFGEKLPQGIIEDL 61

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEH 121
            +  ++  A N+ FER    K L   +P ++W C++V A   G   SL+ A  +LN  + 
Sbjct: 62  TNPKLIKTAFNANFERTCLAKYLNKPMPPEQWRCSAVHALALGFGGSLEGAAKSLNLQQQ 121

Query: 122 LTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
             KM+EGKALI  F               ++++ W++F  YCK+DVE  R + K+L   P
Sbjct: 122 --KMKEGKALIRYFSMPCKRGERSRNLPQHNIEKWKVFKTYCKQDVEVERAVRKKLEKYP 179

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
           ++  E +LW LDQ IND G +ID  LV    E     + K  E+   LT G+   + Q  
Sbjct: 180 VTKKEWELWALDQKINDSGVKIDKVLVHSAIECDKTCQSKKTEEAAALT-GLENPNSQV- 237

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
            L+ +L    G+    +S+  ++ +L      ++ + L L R   S +++ K   +  AV
Sbjct: 238 QLKGWL-ETKGVKAESLSKEKVRELLKEVEDEKVKRVLKL-RQELSKTSVKKYEAIKRAV 295

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ-----ERSEEILTQTIQALNRGETIA 354
             D R+RG L+FYGA+RTGRWSG + Q QNLPR      E +  +L      +      +
Sbjct: 296 CKDERVRGLLKFYGANRTGRWSGKLVQTQNLPRNTMDNLEAARMLLKSGNYEMLEVLFYS 355

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYA 414
            P  L S  +R+  I +   + +V+D + IEARV+AW+AGE W I  F     +Y    +
Sbjct: 356 VPEVL-SQLIRTAFIPAFNSRFIVSDFSAIEARVIAWLAGEKWVIDTFKGSGKVYEMAAS 414

Query: 415 KAFNTPIDKVSKEQ-----RAIGKVMELALGYQGGAKVFKTM-ASHCGLDLQQFSQNVKS 468
           + F  PI+K+ K       R  GKV  LA GYQG       M A   GL  ++ S  V  
Sbjct: 415 RMFGVPIEKIVKGNMEYSLRQKGKVATLACGYQGSTGALIAMGAVKMGLKEEELSGIVA- 473

Query: 469 TSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGF 528
                                                   AWR  +  +++LW+ +    
Sbjct: 474 ----------------------------------------AWRKSNSNIVKLWRKI---- 489

Query: 529 ACVVQEGGSISARRVANVPR----LVMRRHKRDVHIVLPSSRRLVY--SDVKGDCSY--- 579
                E  +I A R   V +    L     +  + I LPS R L Y    ++ D  +   
Sbjct: 490 -----EDAAIKAVREKKVVKMQYGLEFFGSEEFLFIKLPSGRSLSYVRPRIEKDFRFNKL 544

Query: 580 ------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                 +   T    R  TYGGKLTENIVQAI+RD L   M    + GY IV  VHDE++
Sbjct: 545 KLTYEGIEQGTKAWGRLNTYGGKLTENIVQAIARDCLAYAMLRLDRAGYKIVFHVHDEVI 604

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            + P+  + S+  +  +M K   WAKGLPLKA+G+E   Y+K
Sbjct: 605 LDVPNG-FGSLKEVNEIMGKPIEWAKGLPLKADGFETDYYKK 645


>gi|139473888|ref|YP_001128604.1| putative phage DNA polymerase [Streptococcus pyogenes str.
           Manfredo]
 gi|209559298|ref|YP_002285770.1| DNA polymerase [Streptococcus phage NZ131.2]
 gi|134272135|emb|CAM30380.1| putative phage DNA polymerase [Streptococcus pyogenes str.
           Manfredo]
 gi|209540499|gb|ACI61075.1| DNA polymerase [Streptococcus phage NZ131.2]
          Length = 640

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 233/715 (32%), Positives = 336/715 (46%), Gaps = 116/715 (16%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K GV+ YA  E   I L AY+ D   V+  D T QS +P D+ 
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLTRQS-LPEDIK 58

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V   A N+ FER+   + LG+   +   +W CT VLA+  GLPSSL+   L L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEATRE 172
             ++   K   GK LI  F   CK S  +         H  + WQ+F +YC +DV     
Sbjct: 119 KLAQE--KDTSGKNLIRYFSLPCKPSKANGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMA 176

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++L  +P+ D E D +  DQ INDRG  +D +LV         + + L  ++  LT  
Sbjct: 177 IAEKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTGL 236

Query: 231 IIRSSRQTYA--LRMYLFLITGIDLVDM------SEGTLKSILSHSNITQLAKDLILNRL 282
              +SR      L+ + + + G+   D+      +EG LK +L               +L
Sbjct: 237 DNPNSRAQLLPWLKEHGYSVNGLTKADVEQELKTAEGELKRVLEL-------------KL 283

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ------ERS 336
            ++ S++ K   +  A+ SDGR+ G LQFYGASRTGRW+G V Q QNL R       +  
Sbjct: 284 QTAMSSLKKYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAR 343

Query: 337 EEILTQTIQALNRGETIADPLG-LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGE 395
           E +  + I A+   E + D L       VR+ ++A +     V+D + IEARV+AW AGE
Sbjct: 344 EYVKKRDIDAV---EILYDSLNDTLKQLVRTALVAKDCCTFYVSDFSAIEARVIAWFAGE 400

Query: 396 DWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHC 455
            W++  F+    IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K M +  
Sbjct: 401 QWRLDVFSTHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMGA-- 458

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
                  +  VK                           +++L G   +     WR  ++
Sbjct: 459 ------LNMGVK---------------------------EEELQGLVDD-----WRRANK 480

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK- 574
            ++Q WKD+            +I +R    + +L  R  K  + I LPS R L Y+  K 
Sbjct: 481 KIVQFWKDVQRAAI------KAIKSRAPIKLGKLRFRYRKGFLFITLPSGRNLAYARAKV 534

Query: 575 --------------GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN 620
                         GD +Y          + TYGGKL ENIVQA +RDIL E +      
Sbjct: 535 EPGDYGDKIVYEGQGDKAYFTA-------QETYGGKLVENIVQATARDILAEALLRIEAA 587

Query: 621 GYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           GY +V  VHDE + E       ++  +  LM + P WA+GLPL +EGY  K Y K
Sbjct: 588 GYGVVFHVHDEAIIEGSG---LTIEEVNDLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|21910979|ref|NP_665247.1| DNA polymerase A domain-containing protein [Streptococcus pyogenes
           MGAS315]
 gi|28876473|ref|NP_795675.1| putative DNA polymerase A domain [Streptococcus pyogenes phage
           315.6]
 gi|28895334|ref|NP_801684.1| DNA polymerase [Streptococcus pyogenes SSI-1]
 gi|50913380|ref|YP_059352.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
 gi|21905187|gb|AAM80050.1| putative DNA polymerase A domain - phage-associated [Streptococcus
           pyogenes MGAS315]
 gi|28810580|dbj|BAC63517.1| putative DNA polymerase [Streptococcus pyogenes SSI-1]
 gi|50902454|gb|AAT86169.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
          Length = 640

 Score =  295 bits (755), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 233/716 (32%), Positives = 338/716 (47%), Gaps = 118/716 (16%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K GV+ YA  E   I L AY+ D   V+  D T QS +P D+ 
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLTRQS-LPEDIK 58

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V   A N+ FER+   + LG+   +   +W CT VLA+  GLPSSL+   L L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEATRE 172
             ++   K   GK LI  F   CK S  +         H  + WQ+F +YC +DV     
Sbjct: 119 KLAQE--KDTSGKNLIRYFSLPCKPSKTNGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMA 176

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++L  +P+ D E D +  DQ INDRG  +D +LV         + + L  ++  LT G
Sbjct: 177 IAEKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKALT-G 235

Query: 231 IIRSSRQTYAL---RMYLFLITGIDLVDM------SEGTLKSILSHSNITQLAKDLILNR 281
           +   + +T  L   + + +  +G+   D+      +EG LK +L               +
Sbjct: 236 LDNPNSRTQLLPWLKEHGYSASGLTKADVEKELKTAEGELKRVLEL-------------K 282

Query: 282 LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ------ER 335
           L ++ S++ K   +  A  SDGR+ G LQFYGASRTGRW+G V Q QNL R       + 
Sbjct: 283 LQTAMSSLKKYEAMERARCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDA 342

Query: 336 SEEILTQTIQALNRGETIADPLG-LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
            E +  + I A+   E + D L       VR+ ++A +G    V+D + IEARV+AW AG
Sbjct: 343 REYVKKRDIDAV---EILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEARVIAWFAG 399

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           E W++  F+    IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K M + 
Sbjct: 400 EQWRLDVFSTHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMGA- 458

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
                   +  VK                           +++L G   +     WR  +
Sbjct: 459 -------LNMGVK---------------------------EEELQGLVDD-----WRRAN 479

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
           + ++Q WKD+            +I +R    + +L  R  K  + I LPS R L Y+  K
Sbjct: 480 KKIVQFWKDVQRAAI------KAIKSRAPVRLGKLRFRYRKGFLFITLPSGRNLAYARAK 533

Query: 575 ---------------GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK 619
                          GD +Y          + TYGGKL ENIVQA +RDIL E +     
Sbjct: 534 VEPGDYGDKIVYEGQGDKAYFTA-------QETYGGKLVENIVQATARDILAEALLRIEA 586

Query: 620 NGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            G+ +V  VHDE + E       ++  +  LM + P WA+GLPL +EGY  K Y K
Sbjct: 587 AGHGVVFHVHDEAIIEGSG---LTIEEVNDLMAQAPEWAEGLPLNSEGYITKYYMK 639


>gi|225871341|ref|YP_002747288.1| phage DNA polymerase [Streptococcus equi subsp. equi 4047]
 gi|225700745|emb|CAW95387.1| putative phage DNA polymerase [Streptococcus equi subsp. equi 4047]
          Length = 640

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 233/715 (32%), Positives = 335/715 (46%), Gaps = 116/715 (16%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K GV+ YA  E   I L AY+ D   V+  D T QS +P D+ 
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLTRQS-LPEDIK 58

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V   A N+ FER+   + LG+   +   +W CT VLA+  GLPSSL+   L L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEATRE 172
              +   K   GK LI  F   CK S  +         H  + WQ+F +YC +DV     
Sbjct: 119 KLVQE--KDTSGKNLIRYFSLPCKPSKANGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMA 176

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++L  +P+ D E D +  DQ INDRG  +D +LV         + + L  ++  LT  
Sbjct: 177 IAEKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTGL 236

Query: 231 IIRSSRQTYA--LRMYLFLITGIDLVDM------SEGTLKSILSHSNITQLAKDLILNRL 282
              +SR      L+ + + + G+   D+      +EG LK +L               +L
Sbjct: 237 DNPNSRAQLLPWLKEHGYSVNGLTKADVEQELKTAEGELKRVLEL-------------KL 283

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ------ERS 336
            ++ S++ K   +  A+ SDGR+ G LQFYGASRTGRW+G V Q QNL R       +  
Sbjct: 284 QTAMSSLKKYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAR 343

Query: 337 EEILTQTIQALNRGETIADPLG-LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGE 395
           E +  + I A+   E + D L       VR+ ++A +     V+D + IEARV+AW AGE
Sbjct: 344 EYVKKRDIDAV---EILYDSLNDTLKQLVRTALVAKDCCTFYVSDFSAIEARVIAWFAGE 400

Query: 396 DWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHC 455
            W++  F+    IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K M +  
Sbjct: 401 QWRLDVFSTHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMGA-- 458

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
                  +  VK                           +++L G   +     WR  ++
Sbjct: 459 ------LNMGVK---------------------------EEELQGLVDD-----WRRANK 480

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK- 574
            ++Q WKD+            +I +R    + +L  R  K  + I LPS R L Y+  K 
Sbjct: 481 KIVQFWKDVQRAAI------KAIKSRAPIKLGKLRFRYRKGFLFITLPSGRNLAYARAKV 534

Query: 575 --------------GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN 620
                         GD +Y          + TYGGKL ENIVQA +RDIL E +      
Sbjct: 535 EPGDYGDKIVYEGQGDKAYFTA-------QETYGGKLVENIVQATARDILAEALLRIEAA 587

Query: 621 GYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           GY +V  VHDE + E       ++  +  LM + P WA+GLPL +EGY  K Y K
Sbjct: 588 GYGVVFHVHDEAIIEGSG---LTIEEVNDLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|227520155|ref|ZP_03950204.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0104]
 gi|227072400|gb|EEI10363.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0104]
          Length = 653

 Score =  294 bits (752), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 229/714 (32%), Positives = 335/714 (46%), Gaps = 101/714 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S + L KVGV+ YA+     I L AY+ D +PV+  D T  S +P +++
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLT-ISEIPDEIV 59

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V+ +A N+ FER+   K LG+   +   +W CT V A   GLP+SL      L
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKHLGVPYYLDPAQWHCTMVHANELGLPASLGQCAKYL 119

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHV----------QAWQLFGEYCKRD 166
           N  +   K   G  LI  F K      P   T+ N +          + WQ F EYC +D
Sbjct: 120 NIEQQ--KDTRGTQLINFFSK------PCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQD 171

Query: 167 VEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           V     +  +L   P+ + E  L+ LDQ INDRG  ID +L     +++A   +    ++
Sbjct: 172 VNVEMAIANKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLNEM 231

Query: 225 VKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
             LT   + +      L+ +L    G     + +  +   L+  N+ +   +++  RL+ 
Sbjct: 232 KALTG--LENPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALALGNLPENVAEVLKLRLSL 288

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSE-EILTQT 343
           S S+  K   +  A  SD R+ G LQFYGA+RTGRW+G + Q QNLPR   SE +   Q 
Sbjct: 289 SNSSTKKYLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLSEIDFARQL 348

Query: 344 IQALN------RGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
           ++A +        E + D L      +R+ ++A  G + +V+D + IEARV+AW A +DW
Sbjct: 349 VKAKDVEGIELMYENVPDTL---KQLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDW 405

Query: 398 KIKAFANGEDIYVTTYAKAFN----TPIDKVS---KEQRAIGKVMELALGYQGGAKVFKT 450
            +  F     IY  T A+ F+    T  D  S   K+ R  GKV  LALGYQGG    K 
Sbjct: 406 VLDVFRTHGKIYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKA 465

Query: 451 MASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
           M +                               +++   E  ++D         +   W
Sbjct: 466 MGA-------------------------------LENGIEEHELQD---------IVDRW 485

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPR-LVMRRHKRDVHIVLPSSRRLV 569
           R  ++ +   W +  +     +Q GG      +   PR L   +    + I LPS R+L 
Sbjct: 486 RTANKRIKNFWHETQKAVIDCLQNGG------IKKGPRGLKFYKKAGFLFIQLPSGRKLA 539

Query: 570 YSDV---KGDCSYLNTATSQ-----LMRERTYGGKLTENIVQAISRDILCEGMKNATKNG 621
           Y+     +GD         Q        ++TYGGKL ENIVQA +RD+L E M    K G
Sbjct: 540 YAKAHLKEGDYGPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMVRLEKAG 599

Query: 622 YDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           Y IV  VHDE V+E P+    S+  +  +M+  P WA+GLPL AEG+E K Y K
Sbjct: 600 YPIVFHVHDEAVAEVPEGEK-SIEEMNKIMSIVPDWAEGLPLNAEGFETKYYMK 652


>gi|116630096|ref|YP_815268.1| DNA polymerase I [Lactobacillus gasseri ATCC 33323]
 gi|238854131|ref|ZP_04644478.1| DNA polymerase [Lactobacillus gasseri 202-4]
 gi|116095678|gb|ABJ60830.1| DNA polymerase I - 3'-5' exonuclease and polymerase domain
           [Lactobacillus gasseri ATCC 33323]
 gi|238833207|gb|EEQ25497.1| DNA polymerase [Lactobacillus gasseri 202-4]
          Length = 644

 Score =  294 bits (752), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 218/713 (30%), Positives = 341/713 (47%), Gaps = 108/713 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M ++ IDIET S   L + GV+ YA+     + L  YA D  PVK+ D T+   +P  ++
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSDDFELLLFGYATDLGPVKVVDLTQGEKIPQPIV 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D T++  A N+ FER+   + +G  +    W C+ V + T GLP SL +    L  
Sbjct: 61  KALDDPTIIKSAFNAQFERVCLSRFVGHRLKPAGWHCSRVWSATLGLPLSLSDVGTVLGL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
                K+  GK L+  FC       P   T++N  +           WQ F +Y +RDVE
Sbjct: 121 PRQ--KITAGKELVRYFCT------PCKPTKSNQNRTRNFPYHAPDKWQQFKQYNQRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDED 223
              E+ ++L   P+S  E + + +DQ INDRG RID  LV   +K QE    +  ++ + 
Sbjct: 173 VEMEITQKLERFPVSQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQENFHDQYLQVSQK 232

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  L +           L+ +L    G+++  +S+ ++  +L  +   ++ + L L +L 
Sbjct: 233 LTGLAN-----PNSPLQLKDWLNQ-RGMNIDSLSKASVAQLL-QTTTGKVHQVLSLRQLL 285

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
           S  S++ K   + +A+  DGR+ G LQFYGA+RTGRW+G + Q QNLPR    +  L + 
Sbjct: 286 SK-SSVKKYQAMQKAMCRDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPD--LEEA 342

Query: 344 IQALNRGETIADPL------GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
            + + +G T A  +       + S  +R+  I S G    VAD + +EARV+AW++GE+W
Sbjct: 343 RELVKQGNTTALSMLYDSVPDVLSQLIRTAFIPSQGHHFYVADFSAVEARVIAWLSGEEW 402

Query: 398 KIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTM-ASH 454
           + KAFAN EDIY  + ++ F  P+ K  V+ E R  GK+ ELALGY G     K M A++
Sbjct: 403 RQKAFANNEDIYCASASQMFGVPVVKHGVNGELRQKGKIAELALGYGGSIGALKAMGATN 462

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            GL  ++        S  + W  A  H                                 
Sbjct: 463 LGLTEEELH------SLVQMWRNASPH--------------------------------- 483

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPR---LVMRRHKRDVHIVLPSSRRLVYS 571
             ++Q W D+ +     ++     +   +  + R   + +R         L S R+L YS
Sbjct: 484 --IVQFWWDIDKAAKECIKSHLPQATHGIKFIYRSGCMFLR---------LRSGRKLCYS 532

Query: 572 DVKGDCSYLNTATSQLM---------RERTYGGKLTENIVQAISRDILCEGMKNATKNGY 622
             K   +   + +   M         R  TYG KL ENIVQA SRD+L E M+     G 
Sbjct: 533 KPKIGINRFGSESITFMGINAVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEDAGN 592

Query: 623 DIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +V+ +HDE V + P    +S+  +  +MT+ P WA GL L A G+ +  Y+K
Sbjct: 593 PVVMHIHDEAVIDAPAN--YSLEKMVKIMTEVPRWADGLILNAAGFVSDFYKK 643


>gi|315654969|ref|ZP_07907874.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii ATCC 51333]
 gi|315490930|gb|EFU80550.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii ATCC 51333]
          Length = 640

 Score =  294 bits (752), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 224/701 (31%), Positives = 318/701 (45%), Gaps = 88/701 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET SP  L K GV+ Y       I L +YA D   V+  D      +P  +L
Sbjct: 1   MRTLSIDIETYSPVILAKAGVYKYCNHPDFKILLFSYAIDSCTVRTVDLASGEQLPDAVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A+N+ FER      LG  +    W C+ V A T GLP SLK+    LN 
Sbjct: 61  DALADSAVTKWAYNASFERTCLSAYLGRLLDPAGWRCSMVWAATLGLPLSLKDVGKVLNL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDS----PPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
                KM+EGK LI  FC    +S    P  D         W+LF  Y  RDVE    + 
Sbjct: 121 DAQ--KMDEGKDLIKHFCVPDDNSQRRLPSSDPA------GWKLFKMYNARDVEVETAIR 172

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           ++L   P+ D   + + +DQ INDRG RID  L      +  + R +      KLT   +
Sbjct: 173 QKLADFPVPDYLWEQYEVDQRINDRGIRIDTTLAANAIAIDEEHRAQALARAHKLTG--L 230

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G  +  M++ ++   L+  N T   ++ +  R   S S++ K 
Sbjct: 231 DNPASPLQLQEWLNQ-HGCPIESMAKESVDDALA--NATGQVREALELRQELSRSSVAKY 287

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             + +   +D R  G LQFYGA+RTGRW+G + Q QNLPR    +    + +     GET
Sbjct: 288 RKMIDVTCTDQRAHGLLQFYGANRTGRWAGRLVQVQNLPRNYLPDLTQARGLVRDGNGET 347

Query: 353 -------IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
                  + D L   S  +R+  I S   + +VAD + IEARVLAW+AGE+  + AF NG
Sbjct: 348 LEMLYSSVPDTL---SQLIRTAFIPSGAHRFIVADYSAIEARVLAWLAGEETTLAAFKNG 404

Query: 406 EDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
           ED+Y  T +  F  P++K  V+ E R  GK+  LA GY G     K M            
Sbjct: 405 EDLYCATASAMFGVPVEKHGVNSELRQKGKIAVLACGYNGSVGALKAMG----------- 453

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                        A+K  L     + +  AWR  +  ++QLW  
Sbjct: 454 -----------------------------ALKMGLSEDELQPIVDAWRQANPNIVQLWHK 484

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-GDCSYLNT 582
           +       +  G  ++ R       L   +    + I LPS RRL Y     G   +  T
Sbjct: 485 VDNAATRAISTGRPLTLR------NLGFEKKSGILFITLPSGRRLAYVKPGIGVNRFGGT 538

Query: 583 ATS--------QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
           + +        +  +  TYGGKL ENIVQA +RD+L E +      G+ IV+ +HDE+V 
Sbjct: 539 SITYWGQGVARKWQKLETYGGKLVENIVQATARDLLAEAITRIENAGHQIVMHIHDEVVI 598

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           + P     +V  +C+LM + P WA+GLP+ A GYE   Y+K
Sbjct: 599 DEPINSGTTVADICALMNELPQWAEGLPIDAAGYECGFYQK 639


>gi|238018841|ref|ZP_04599267.1| hypothetical protein VEIDISOL_00701 [Veillonella dispar ATCC 17748]
 gi|237864607|gb|EEP65897.1| hypothetical protein VEIDISOL_00701 [Veillonella dispar ATCC 17748]
          Length = 644

 Score =  293 bits (751), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 230/704 (32%), Positives = 338/704 (48%), Gaps = 93/704 (13%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           +L ID+ET S  P+ K G   Y +     I L AY++DDEPV++ D T +  +P  ++  
Sbjct: 2   ELSIDVETYSDCPI-KYGAQRYVDDTTFEILLFAYSFDDEPVEVIDMT-KDPLPERVVDA 59

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           L ++ +   A N+ FE +  KK    D     W CTSVLA    LP+SL N   AL   E
Sbjct: 60  LYNKEITKTAFNAAFEMLCLKKYFP-DADYTNWECTSVLALYCSLPASLDNVSKALRLGE 118

Query: 121 HLTKMEEGKALIARFC---KGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL 177
              K   GK LI  F    K +  +P       +  + W  + EY ++DV   R + KRL
Sbjct: 119 --AKDARGKRLIQFFSVPRKPTKTNPKTRNMPEDAPEKWAEYIEYNRQDVVVERAIRKRL 176

Query: 178 IPLSDG--ERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDEDIVKLTDGII 232
           + L     E + WLLDQ IN RG ++D++LV   L   + I +E  +  + +  L     
Sbjct: 177 LSLKPPAIEHEYWLLDQDINWRGVKVDMELVDAALACNDEIVEEATESSKILTGL----- 231

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +   T  L+ +L    G DL  M +  + ++L+  +I    + ++ NR     S+I K 
Sbjct: 232 ENPNSTMQLKEWLTARLGYDLETMRKDDVSNLLAQ-DIPSDVRKVLQNRQVLGNSSIKKY 290

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ-----ERSEEIL-TQTIQA 346
             +  AV SDGR+ G LQFYGA R+GRW+G V Q QNLPR      + + ++L ++ ++ 
Sbjct: 291 LAMKNAVCSDGRIHGMLQFYGAMRSGRWAGRVVQLQNLPRNYLEDLDTARDVLKSRDVEM 350

Query: 347 LNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           L+      +P  +    +R+ ++A +G + +VAD + IEARV+AW+A E W+   FA G 
Sbjct: 351 LDL--LYGNPGDVIKQLIRTALVAEDGHRFIVADFSAIEARVIAWLAHEKWRQDVFAQGG 408

Query: 407 DIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
           DIY  + +  F+ P++K  V+   R  GKV ELALGY GG    K M S           
Sbjct: 409 DIYCASASSMFHVPVEKHGVNGHLRQKGKVAELALGYGGGVGAMKAMDS----------- 457

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDL 524
                                + + PE     +L G     + +AWR     + + WKD 
Sbjct: 458 ---------------------KGEIPE----KELPG-----IIEAWRQASPRITKFWKDA 487

Query: 525 TEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK------GDCS 578
                 VV+ G  +   +  N+      + K  + I LPS RRL Y+  +      G  S
Sbjct: 488 DSAAKQVVRTGEPVRIIQ-GNIKFF---KSKGFLFIELPSGRRLAYARPRLGLNQFGSES 543

Query: 579 YLNTATSQLM----RERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                  Q+     R  TYGGKL ENIVQA++RD L   M   +K GY IV  +HDE+V 
Sbjct: 544 IEYDGMDQVKNTWGRVETYGGKLVENIVQAVARDCLAASMLRLSKAGYKIVAHIHDEVVI 603

Query: 635 ETPDTPYFSVGTL---CSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E P      VG+L     +M +   W +GL L A G+E   Y K
Sbjct: 604 EAP----IGVGSLEEVIDIMCEPEPWNEGLILNAAGFENPYYMK 643


>gi|313898058|ref|ZP_07831597.1| DNA-directed DNA polymerase [Clostridium sp. HGF2]
 gi|312957086|gb|EFR38715.1| DNA-directed DNA polymerase [Clostridium sp. HGF2]
          Length = 646

 Score =  293 bits (749), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 224/708 (31%), Positives = 332/708 (46%), Gaps = 96/708 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S +PL K GV+ Y E     I L AY+ D +PV++ D      +P ++L
Sbjct: 1   MKTLSIDIETYSDEPLQKTGVYRYVESPNFEILLFAYSVDHQPVQVIDLACGEQIPKEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L DE V+  A N+ FERI   + LG      +  + W C+ V A T GLP SL+    
Sbjct: 61  LALEDEDVIKWAFNAAFERICLSRFLGYPTGEYLDPESWRCSMVWAATMGLPLSLEGVGA 120

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCK 164
            L   +   K+ EGK LI  FC+      P   T+ N  +           W +F +Y  
Sbjct: 121 VLGLEKQ--KLTEGKDLIKYFCQ------PCAPTKTNGQRTRNRPFHAPDKWAMFKKYNI 172

Query: 165 RDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
           RDVE    + +RL   P+     D + +DQ INDRG R+D++LV    E+  + R KL E
Sbjct: 173 RDVETEMGIQQRLARFPVPAQVWDEYHMDQEINDRGVRLDMELVAAAIEMDTRSRTKLTE 232

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
            + ++T+  + +      ++ +L    G++   + +  +  +L  S   +L++ L L R 
Sbjct: 233 TMKEITE--LENPNSVQQMKAWLS-DNGLETDTLGKKAVAELLK-SAPPKLSQVLTL-RQ 287

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
             + S++ K   + + V +DGR RG  QFYGA+RTGR+SG   Q QNLP+   S+    +
Sbjct: 288 QLAKSSVRKYQAMEKTVCADGRARGMFQFYGANRTGRFSGRNIQLQNLPQNHLSDLAEAR 347

Query: 343 TIQALNRGETIA----DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
           ++      E +     D     S  +R+  I   G + +VAD + IEAR++AW AGE W+
Sbjct: 348 SLVRSGNFEAVELLYEDVPDTLSQLIRTAFIPREGTQFLVADFSAIEARIIAWFAGEKWR 407

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCG 456
              FA G DIY  + ++ F  P++K  ++   R  GK+ ELALGY G     K M +   
Sbjct: 408 QDVFAKGGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMGA--- 464

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           LD+                          +D+ P                  AWR  +  
Sbjct: 465 LDMG-----------------------LTEDELPPLV--------------DAWRQSNPN 487

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-- 574
           +++ W ++       V+   + S   +    R  M      + I LPS R+L Y   K  
Sbjct: 488 IVKFWWNVDHAVMEAVKFKHTTSEYGLTFSCRSGM------LFITLPSGRKLAYVKPKIG 541

Query: 575 -----GDCSYLNTATSQLMRER--TYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLT 627
                G C       S    ER  +YG K  ENIVQA +RDILC  M+  T     IV+ 
Sbjct: 542 TNKFGGQCITYEGIGSTKKWERLDSYGPKFVENIVQATARDILCYAMQ--TLRCCSIVMH 599

Query: 628 VHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +HDE+V E    P  S+  +C  M + P WAKGL L+A+GY    Y+K
Sbjct: 600 IHDEVVIEA--DPSMSLDAICEQMGRTPPWAKGLLLRADGYATPFYKK 645


>gi|225573258|ref|ZP_03782013.1| hypothetical protein RUMHYD_01449 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039390|gb|EEG49636.1| hypothetical protein RUMHYD_01449 [Blautia hydrogenotrophica DSM
           10507]
          Length = 645

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 232/718 (32%), Positives = 337/718 (46%), Gaps = 120/718 (16%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ YA      + L  Y  D   V++ D      +P +++
Sbjct: 4   MRTLSIDIETYSDVDLSKCGVYKYASSPAFEVLLFGYTADGGDVRVVDLACGEQIPEEVI 63

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D +V   A N++FER+     LG  +  + W CT V + T GLP SL++A  AL  
Sbjct: 64  SALSDTSVTKWAFNAMFERVCLSNFLGEWLEPEGWHCTMVWSATLGLPLSLESAGAALGL 123

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVE 168
            +   K+ EGK LI  FC       P   T+AN            + W+ F  Y  RDVE
Sbjct: 124 EKQ--KLTEGKDLIRYFCV------PCRPTKANGGRTRNRPEHDPEKWERFKAYNLRDVE 175

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
              ++ KRL   P+ D   + + LDQ INDRG  +D++LV +   + A+ R++L + + +
Sbjct: 176 TEMQIQKRLSNFPVPDAIWEEYHLDQEINDRGIGVDMELVRQAIAMDARSREQLTDALQE 235

Query: 227 LTD----GIIRSSRQTYALRMYLFLITG----IDLVDMSEGTLKSILSHSNITQLAKDLI 278
           LT       ++  +Q  A         G     +LV  +   LK++LS     QLAK   
Sbjct: 236 LTGLDNPNSVQQMKQWLADHGLETDTLGKKVVAELVRSAPEPLKTVLSLRQ--QLAK--- 290

Query: 279 LNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEE 338
                   S++ K   +  AV +DGR  G  QFYGA+RTGR+SG + Q QNLP+   S+ 
Sbjct: 291 --------SSVKKYAAMENAVCADGRAHGMFQFYGANRTGRFSGRLIQLQNLPQNHMSD- 341

Query: 339 ILTQTIQALNRG----------ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARV 388
            L Q  +AL RG          E I D L   S  +R+  +  +G+K +VAD + IEARV
Sbjct: 342 -LAQA-RALMRGGNYEAISMLYEDIPDTL---SQLIRTAFVPQDGRKFIVADFSAIEARV 396

Query: 389 LAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAK 446
           +AW AGE W++K F +G+DIY  + ++ F+ P++K  V+   R  GK+ ELALGY G   
Sbjct: 397 IAWFAGERWRLKVFEDGDDIYSASASQMFHVPVEKHGVNGHLRQKGKIAELALGYGGSVG 456

Query: 447 VFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELV 506
             K+M                                         A++  L     + +
Sbjct: 457 ALKSMG----------------------------------------ALEMGLAEEELQPL 476

Query: 507 KKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSR 566
             AWR  +  + Q W D+       V++   + +  +    R  M      + I LPS R
Sbjct: 477 VDAWRTSNPMITQFWWDVDRAVKECVKKRVPMESHGLHFDYRSAM------LFITLPSGR 530

Query: 567 RLVYSDV--------KGDCSYLN-TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNA 617
           RL Y           +   +Y+  +   +  R  +YG K  ENIVQ  +RDILC  M+  
Sbjct: 531 RLAYVKPRIGENQFGRESVTYMGVSGAKKWERLESYGPKFVENIVQGTARDILCYAMR-- 588

Query: 618 TKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           T     IV  VHDEI+ E       S+  +C  M + PSWAKGL L+A+GYE + Y+K
Sbjct: 589 TLRNCAIVAHVHDEIIIEADRR--MSLSAVCEQMGRTPSWAKGLKLRADGYECEFYQK 644


>gi|331007743|ref|ZP_08330869.1| phage-like DNA polymerase [gamma proteobacterium IMCC1989]
 gi|330418451|gb|EGG92991.1| phage-like DNA polymerase [gamma proteobacterium IMCC1989]
          Length = 601

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 213/664 (32%), Positives = 308/664 (46%), Gaps = 86/664 (12%)

Query: 34  AYAWDDEPVKLW----DRTEQSAMPSDLLQYLRDETVMCVAHNSLFERILFKKTLG-IDI 88
           AYA  DE   LW    D  E    PS+   Y         A NS FE  ++       + 
Sbjct: 2   AYAIGDEDPILWLPGDDLPEFVTNPSEFTIY---------AWNSFFEWCIWHHVQEWSNA 52

Query: 89  PSKRWICTSVLARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCT 148
           P   W  T+ LA    +P +L     AL   +   K + GK LI R  K      P    
Sbjct: 53  PIFLWTDTAALAAVLAMPRALGACAKALGLPQDQQKDKRGKYLIQRLSK------PNRGK 106

Query: 149 RANHVQAWQLFGEYCKRDVEATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLK 208
           R       + F EYC++DV   R +  RL PLS  ER +W LDQTIN RG  ID   V  
Sbjct: 107 RIQDADLLEEFYEYCRQDVVVERAVLARLRPLSTQERKVWELDQTINIRGVFIDNQSVEN 166

Query: 209 LQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS 268
              +I Q  +KL++++ +LT   + +  Q   +  Y+    G  L+   +  L+++L   
Sbjct: 167 ALLIIDQVTEKLNQEVAQLTASHLTNVSQRQRVMNYISDELGYSLIKFDKAYLETVLEDE 226

Query: 269 NITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQ 328
            +  +A+ LI  R     ++  K   L + V+ D R  G L ++GA+ TGRWSG  FQPQ
Sbjct: 227 TLPPIARRLIEIRQQLGKTSTAKYAALKKIVTEDNRAHGLLMYHGAT-TGRWSGKHFQPQ 285

Query: 329 NLPRQERSEEILTQTIQALNRGET------IADPLGLASDCVRSCIIASNGKKLVVADLA 382
           NLPR   S +     I+     ++        DP+   S  +R  I A  GK+L+V D +
Sbjct: 286 NLPRP--SFKDTDNCIRLFKHADSELLELIYDDPMEALSSSLRGMICAPEGKRLIVVDYS 343

Query: 383 GIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQ 442
            IEARVL W+AG++  +     G +IY  T ++ +  P +KV++EQR IGKV  LALGYQ
Sbjct: 344 QIEARVLPWLAGQEDALTKIRQGVEIYKITASQIYGVPPEKVNEEQRFIGKVATLALGYQ 403

Query: 443 GGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTA 502
           GGAK F+ MA   G+++              D + A+                       
Sbjct: 404 GGAKAFQGMAEVYGVEI--------------DTDLADE---------------------- 427

Query: 503 CELVKKAWRAKHQGVLQLWKDLTE-GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIV 561
              +K  WR  ++ +++ W  + +     V   G +   R +        R     +   
Sbjct: 428 ---IKVDWRVANRKIVKFWWGVEKAALNAVTHPGKTFEIRAIK------FRFTDNYLFCR 478

Query: 562 LPSSRRLVYSDVKGDCSYL----------NTATSQLMRERTYGGKLTENIVQAISRDILC 611
           LPS R L Y   K                N+ T +  R+ TYGGKL ENI QA++RD++ 
Sbjct: 479 LPSGRLLAYYQPKTSIGKFDKEQVTFMGTNSLTRKWERQNTYGGKLVENITQAVARDLMA 538

Query: 612 EGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAK 671
           E M      GY++VL+VHDE+++E  D  + SV     LM + P WAKGLP+ +EG+E  
Sbjct: 539 EAMLRVENAGYEVVLSVHDELIAEANDD-FGSVEEFEQLMCELPVWAKGLPVTSEGFECL 597

Query: 672 RYRK 675
           RYRK
Sbjct: 598 RYRK 601


>gi|57234138|ref|YP_181815.1| family A DNA-dependent DNA polymerase [Dehalococcoides ethenogenes
           195]
 gi|57224586|gb|AAW39643.1| DNA-dependent DNA polymerase, family A [Dehalococcoides ethenogenes
           195]
          Length = 662

 Score =  291 bits (744), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 235/730 (32%), Positives = 339/730 (46%), Gaps = 124/730 (16%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + IDIET S   L K GV+ YAE     I L  YA D   V++ D  +   +P +++
Sbjct: 1   MKNISIDIETFSDIDLNKCGVYKYAESPNFEILLFGYAVDGGKVQVIDLAQGEHIPQEII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKK---TLGIDIPS-----------------KRWICTSV 98
             L D+ V   A N+ FER+   +    LG+ +                   + W C+ V
Sbjct: 61  DALTDDEVTKWAFNANFERVCLSRYLSDLGVSLDPFHDNHPLSTECARFLNPEGWRCSMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN------- 151
            A T GLP SLK     L   +   KM+EGKALI  F      S P   T+AN       
Sbjct: 121 WAATMGLPLSLKGVGQVLKLEDQ--KMDEGKALIKYF------SVPCAPTKANGGRTRNM 172

Query: 152 ---HVQAWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV 206
                + W+ F  Y KRDVE    + +RL   P+ D   D + +DQ INDRG R+D+DLV
Sbjct: 173 PFHDPEKWETFKAYNKRDVEVEMAIQQRLTNFPVPDFVWDEYRIDQEINDRGVRLDMDLV 232

Query: 207 LKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILS 266
            K  E+  + R +L   +  +T+  + +      ++ +L    G++   + +  +  ++ 
Sbjct: 233 AKAIEMDTRSRTELTTAMKDITE--LDNPNSVQQMKQWLS-DNGLETDSLGKKVVAELIK 289

Query: 267 HSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQ 326
            +  ++L   L L R   + S++ K  T+  AV  DGR RG   FYGA+RTGRW+G + Q
Sbjct: 290 TAP-SELQTVLEL-RQQLAKSSVKKYQTMERAVCDDGRARGMFMFYGANRTGRWAGRLIQ 347

Query: 327 PQNLPRQERSEEILTQTIQALNRG---------ETIADPLGLASDCVRSCIIASNGKKLV 377
            QNLP+     E L      +  G         E + D L   S  +R+  I  +G +L 
Sbjct: 348 LQNLPQNHL--EDLADARALVKSGDFDAVKLLYEDVPDTL---SQLIRTAFIPKDGTQLY 402

Query: 378 VADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVM 435
           V+D + IEARV+AW AGE W+ K FA+G DIY  + ++ F+ P++K  V+   R  GK+ 
Sbjct: 403 VSDFSAIEARVIAWYAGEMWRQKVFADGGDIYCASASQMFHVPVEKHGVNGHLRQKGKIA 462

Query: 436 ELALGYQGGAKVFKTM-ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAV 494
           ELALGY G     K M A   GL                            +D+ P    
Sbjct: 463 ELALGYGGSVGALKAMGAIEMGLS---------------------------EDELPPLV- 494

Query: 495 KDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRH 554
                         AWR  +  +++ W D+       V+   + S+  +    R  M   
Sbjct: 495 -------------DAWRQTNPHIVKFWWDVDRAVMEAVKHKHTTSSYGLTFSCRSGM--- 538

Query: 555 KRDVHIVLPSSRRLVYSDVK-------GDC-SYLNT-ATSQLMRERTYGGKLTENIVQAI 605
              + I LPS R L Y   K       G+C +Y    AT +  R  +YG K  ENIVQA 
Sbjct: 539 ---LFITLPSGRNLAYVKPKVGTNKFGGECITYEGVGATKKWERLDSYGPKFVENIVQAT 595

Query: 606 SRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKA 665
           SRDILC  MK  T    +IV+ +HDE+V E    P+ S+  LC  M + P WA+GL L+A
Sbjct: 596 SRDILCYAMK--TLRNCEIVMHIHDELVIEA--DPHMSLDVLCEQMGRTPPWARGLQLRA 651

Query: 666 EGYEAKRYRK 675
           +GY    Y+K
Sbjct: 652 DGYTTPFYKK 661


>gi|313895585|ref|ZP_07829141.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975711|gb|EFR41170.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 645

 Score =  290 bits (742), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 227/707 (32%), Positives = 330/707 (46%), Gaps = 95/707 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + ID+ET S  PL K GV+ YAE     I L  Y+ D   V++ D      +P ++L
Sbjct: 1   MKSISIDVETFSSVPLAKAGVYKYAESEDFEILLFGYSVDGGEVQVVDLANGEEIPKEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L DETV   A N++FER+   + LGI +    W C+ + A T GLP SLK+    L  
Sbjct: 61  AALTDETVTKWAFNAMFERVCLSRHLGIHLKPNAWRCSMIWAATLGLPLSLKDVGAVLWL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVE 168
                K+EEGK LI  FC       P   TR+N            + W+LF EY KRDVE
Sbjct: 121 DRQ--KLEEGKDLIRYFC------VPCKATRSNGGRTRNLPADAPEKWKLFTEYNKRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLD--EDI 224
               +  RL   P+ + E + +++DQ INDRG  +D   V   Q +   ER K    E  
Sbjct: 173 TEMAIQARLKKFPVPESEWENYVIDQEINDRGILVDTTFV--TQAICCDERSKAVCLERA 230

Query: 225 VKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
             LTD  + +      L  +L    G+ +  +++  +  +L  +  T   ++++  R   
Sbjct: 231 QNLTD--LENPNSPLQLMDWLH-GKGLSVESLAKSEVTKMLKTA--TGDVREVLELRQQL 285

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTI 344
           S +++ K   +     +D R RG  QFYGA+RTGR++G + Q QNLP+   ++    +T+
Sbjct: 286 SKTSVKKYMAMEAVTGADHRARGLFQFYGANRTGRFAGRLIQLQNLPQNHLAQLKEVRTL 345

Query: 345 QALNRGETIADPLGLASDC----VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                 E +       SD     +R+  +     + VVAD A IEARVLAW+AGE W + 
Sbjct: 346 VKDGDFELLDMLYDSTSDVLSQLIRTSFVPHPACRFVVADYAAIEARVLAWLAGEQWVLD 405

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F    DIY  T ++ F+  ++K  +  + R  GK   L+ GY G       M +     
Sbjct: 406 VFREHGDIYCETASRMFHCKVEKHGENADLRQKGKQAVLSCGYGGSVGALVAMGA----- 460

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +K++ +    +L    WRA +  ++
Sbjct: 461 -------------------------------VESGMKEEELQPLVDL----WRASNPHIV 485

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDV-HIVLPSSRRLVYSDVK-GD 576
           Q W D+       V+       RRV      +   +K  V  I LPS R L Y+  + G+
Sbjct: 486 QFWWDVDRAVKTCVK-------RRVEVETHGIRCVYKSGVLFIRLPSGRELAYAKPRIGE 538

Query: 577 CSYLNTA--------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTV 628
             +   +        T +  R  T+GGKL ENI Q  +RD+L   MK     G+DIV+ V
Sbjct: 539 NRFGGESVTYEGLGMTKKWERIETFGGKLVENITQGTARDLLVFAMKQLRNRGFDIVMHV 598

Query: 629 HDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           HDEIV E P     SV  +CS+M +NP WAKGLPLKA+GYE + YRK
Sbjct: 599 HDEIVLEVP-YGVSSVEEICSIMAENPPWAKGLPLKADGYECEFYRK 644


>gi|220930425|ref|YP_002507334.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
 gi|220000753|gb|ACL77354.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
          Length = 652

 Score =  290 bits (741), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 218/699 (31%), Positives = 330/699 (47%), Gaps = 79/699 (11%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L IDIET S   L K GV+ Y E     I L AYA+DDEP+ + D  +   +P  + + L
Sbjct: 5   LSIDIETYSSVDLIKCGVYRYVEAPDFEILLFAYAYDDEPITVIDLADFEELPEQVTKDL 64

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEH 121
            D  V+  A+N+ FER    K     +P ++W CTSV A T GLP +L      L     
Sbjct: 65  TDPDVIKAAYNANFERTCIAKFYNKPMPPEQWRCTSVHALTLGLPGNLDGVAKVLGLDAQ 124

Query: 122 LTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEATRELFKRL 177
             K   GK LI  F   CK +  +        +H    W+ F +YCK+DV   R + K++
Sbjct: 125 --KDTAGKNLIKYFSVPCKPTKVNGGRTRNFPHHAPDKWKQFKDYCKQDVVVERAIRKKI 182

Query: 178 --IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT--DGIIR 233
              P+ + E  LW LDQ IND G R+D  LV +  +   Q   +LD +  +LT  D    
Sbjct: 183 EKYPVPEHEWKLWTLDQKINDAGVRLDPVLVQQALKCDLQYATRLDAEAKELTGLDNPNS 242

Query: 234 SSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLN 293
           +++ T  L+     +      D   G L        +T++ +     R   S ++  K  
Sbjct: 243 TTQLTVWLKKQGLTVDNGLGKDYIPGLLDQAKGDETVTRMLE----LRKEMSKTSTKKYE 298

Query: 294 TLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI 353
            +  A+ SD R RG LQF GA+RT RW+G + Q QNLP+ +  +  + + +    + E I
Sbjct: 299 AMERAMCSDDRARGLLQFCGANRTWRWAGRLIQVQNLPQNKIPDLGVARELLHSGKFEAI 358

Query: 354 A----DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIY 409
                 P  + S  +R+  I S+G + +V+D + IEARV+AW+AGE W++K F +   IY
Sbjct: 359 ELLFNSPPFVLSQLIRTAFIPSDGCRFIVSDFSAIEARVIAWLAGESWRMKVFKSHGKIY 418

Query: 410 VTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCGLDLQQFSQNV 466
             + +  F+ PI++++K    R  GK+ ELALGY G     + M +   GLD        
Sbjct: 419 EASASHMFHVPIEEITKGNPLRQKGKIAELALGYGGSIGALEAMGALKMGLD-------- 470

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                               D+ P+                 AWR  +  +++LW D+ +
Sbjct: 471 -------------------ADELPDLVT--------------AWRNSNPKIVKLWWDVDK 497

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK------GDCSYL 580
                V+E   +  +       +        + I LPS R+L Y   K      G  +  
Sbjct: 498 AAMTAVREHMPVRIQY-----GITFSYKDGFLFIKLPSGRKLAYVKPKIKDGKFGRPALT 552

Query: 581 NTATSQLMR--ER--TYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSET 636
                Q+ +  ER  TYG KL ENIVQA++RD L   M      GYDI + VHDE++ + 
Sbjct: 553 YEGMDQIKKTWERIDTYGPKLVENIVQAVARDCLAVNMLRLDDAGYDIRMHVHDEVILDV 612

Query: 637 PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           P+T   ++  +  +M++   WA GLPL+A+GYE + Y+K
Sbjct: 613 PNTDTDALAQVNEIMSQPIDWAPGLPLRADGYETEFYKK 651


>gi|295114921|emb|CBL35768.1| DNA polymerase I-3'-5' exonuclease and polymerase domains
           [butyrate-producing bacterium SM4/1]
          Length = 646

 Score =  290 bits (741), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 226/714 (31%), Positives = 330/714 (46%), Gaps = 108/714 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L ID+ET S QPL K GV+ Y E     I L AY+ D  PV+  D      +PS++L
Sbjct: 1   MQTLSIDLETYSDQPLAKTGVYRYVESPDFEILLFAYSVDGAPVQQIDLACGEKIPSEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L D+ V   A N+ FERI   + LG      +    W C+ V A   GLP SL+ A  
Sbjct: 61  CALEDDKVTKWAFNANFERICLSRFLGYPTGDYLEPDSWKCSMVWAAYMGLPLSLEGAGA 120

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCK 164
            L   +   K+ EGK LI  FC+      P   T++N  +           W  F +Y  
Sbjct: 121 VLGLEKQ--KLAEGKDLIKYFCQ------PCAPTKSNGQRTRNLPKHSPDKWLAFKKYNI 172

Query: 165 RDVEATRELFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
           RDVE    +  RL+  P+ D   + + LDQ INDRG  +D++LV +  ++  + R +L +
Sbjct: 173 RDVETEMSIQARLLKYPVPDSVWEEYHLDQEINDRGVGLDMELVRQAIQMDGRSRSELTQ 232

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
            + +LT   + +      ++ +L    G++   + +  +  +L  +   QL K L L R 
Sbjct: 233 AMKELTS--LDNPNSVQQMKQWL-ADNGVETDTLGKKAVAELLKTAP-QQLQKVLTL-RQ 287

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
             + S++ K   +  AV +DGR RG  QFYGA+RTGRW+G + Q QNLP+    +  LT+
Sbjct: 288 QLAKSSVKKYQAMETAVCADGRARGMFQFYGANRTGRWAGRIIQMQNLPQNHLDD--LTE 345

Query: 343 TIQALNRG---------ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
               +  G         E + D L   S  +R+  +    +K +VAD + IEARV+AW+A
Sbjct: 346 ARGLVRAGGFDALEMLYEDVPDTL---SQLIRTAFVPQGNRKFIVADFSAIEARVIAWLA 402

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTM 451
            E W+   FA G+DIY  + ++ F  P++K  V+   R  GK+ ELALGY G     K M
Sbjct: 403 DEKWRQDVFAEGKDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAM 462

Query: 452 AS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
            +   GL                            +D+ P                  AW
Sbjct: 463 GALEMGLS---------------------------EDELPALV--------------SAW 481

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
           R  +  ++Q W  +            +++ +       ++       + I LPS R L Y
Sbjct: 482 RQANPKIVQFWWAVDRAVM------DAVTRKTTTKTHGIIFSARNGMLFITLPSGRSLSY 535

Query: 571 SDVK-------GDC-SYLNT-ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNG 621
              K       GDC +Y     T +  R  +YG K  ENIVQA SRDILC  MK  T   
Sbjct: 536 VKPKIGENRFGGDCITYEGVGGTKKWERIDSYGPKFVENIVQATSRDILCYAMK--TLRC 593

Query: 622 YDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             IV+ +HDE+V E       S+  +C  M + P WA GL L+A+GYE   Y+K
Sbjct: 594 CSIVMHIHDEVVIEADRR--MSLQAVCDQMGRTPPWANGLQLRADGYETDFYKK 645


>gi|331085755|ref|ZP_08334838.1| hypothetical protein HMPREF0987_01141 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406678|gb|EGG86183.1| hypothetical protein HMPREF0987_01141 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 646

 Score =  289 bits (739), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 218/700 (31%), Positives = 338/700 (48%), Gaps = 87/700 (12%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L IDIET S   L   GV+ Y+      I L AY+ DDE     D       P + ++ L
Sbjct: 5   LAIDIETYSDVDLISCGVYKYSSSPHFEILLIAYSVDDEETVCIDVANGEEPPKEFIEML 64

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEH 121
            D+TV   A N+ FER  F          + W CT+V A    LP SL+     L   + 
Sbjct: 65  FDDTVTKTAFNANFERTCFSNYYHHSFRPEAWRCTAVQATMLALPLSLEGVGAVLGLDKQ 124

Query: 122 LTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVEATR 171
             KM EGK LI  FC       P   T++N            + W+ F  YC RDV+  +
Sbjct: 125 --KMTEGKELIKYFCS------PCKATKSNGGRTRNLPKDAPEKWRWFKTYCIRDVDVEK 176

Query: 172 ELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
           ++ +RL   P+   E++++ LDQ INDRG  +D +LV          ++       +LT 
Sbjct: 177 QIRQRLAKFPIPKREQEIYCLDQRINDRGIMVDRNLVNHAVACDLLYKETATARAYELTG 236

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLK--SILSHSNITQLAKDLILNRLASSGS 287
             + +      L+++L    G+++  +++ T+K  S+ +  ++ ++ K     RLA+S +
Sbjct: 237 --LENPNSVSQLKLWL-KEKGLEVDSLAKDTVKDLSMKAEGDVQEVLK----LRLATSKT 289

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K   +  +V ++ R+ G LQFYGA+RTGRW+G + Q  NLP+    +  L + + + 
Sbjct: 290 SVKKYEAIDRSVCAENRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHLPDLELARALVSE 349

Query: 348 NRGETI-----ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF 402
            R E +     + P  + S+ +R+  +A  G + +++D + IEARVLAW+AGE+W+++ F
Sbjct: 350 GRYEEVELFYESTP-NVLSELIRTAFVAKPGCRFIISDYSAIEARVLAWLAGEEWRLQVF 408

Query: 403 ANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCGLDL 459
                IY  + +  F+  I++++K    R  GK+ ELALGY G      +M +   GL  
Sbjct: 409 ETHGKIYEASASAMFHVAIEEITKTSPLRQKGKISELALGYGGAVGALTSMGALKMGLTE 468

Query: 460 QQFSQNVKSTSTFEDWEQAESH---HLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++    V +      W  A  H     W  D+    AV+DK               K   
Sbjct: 469 EELPGLVST------WRSANPHITAFWWAVDEAAVTAVRDK---------------KPSK 507

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANV-PRLVMRRHKRDVHIVLPSSRRLVYSDVKG 575
           V ++  +   G   V    G    R+++ V PR+++ +  R+          L Y  +  
Sbjct: 508 VGRVSFEYKSGILFVTLPSG----RKLSYVKPRMMLNKFGRE---------GLTYEGI-- 552

Query: 576 DCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
                   + + MR  TYG KL ENIVQA SRDIL E M    K G+DIV  VHDE+V E
Sbjct: 553 ------GESKKWMRLETYGPKLVENIVQAASRDILAEAMLRLEKEGFDIVCHVHDEVVLE 606

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            PD    SV  +  +M  NP W +GLPLKA G+E+  Y+K
Sbjct: 607 VPDGKS-SVEEVNEIMAVNPVWTEGLPLKAAGFESPFYKK 645


>gi|323693311|ref|ZP_08107529.1| DNA-dependent DNA polymerase, family A [Clostridium symbiosum
           WAL-14673]
 gi|323502794|gb|EGB18638.1| DNA-dependent DNA polymerase, family A [Clostridium symbiosum
           WAL-14673]
          Length = 646

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 221/708 (31%), Positives = 337/708 (47%), Gaps = 96/708 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S +PL K GV+ Y E     I L AY+ D + V++ D      +P ++L
Sbjct: 1   MKTLSIDIETYSDEPLQKTGVYRYVESPNFEILLFAYSVDSQSVQVIDLACGEQIPKEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L +ETV+  A N+ FERI   + LG      + S+ W C+ + A T GLP SL+    
Sbjct: 61  LALENETVIKWAFNANFERICLSRFLGYPTGEYLDSESWRCSMIWAATMGLPLSLEGVGA 120

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCK 164
            L   +   K+ EGK LI  FC+      P   T+ N  +           W +F +Y  
Sbjct: 121 VLGLEKQ--KLSEGKDLIKYFCQ------PCAPTKTNGQRTRNRPFHAPDKWAMFKKYNI 172

Query: 165 RDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
           RDVE    + +RL   P+     D + +DQ INDRG R+D++LV    E+  + R +L E
Sbjct: 173 RDVETEMGIQQRLAKFPVPAQVWDEYHMDQEINDRGVRLDMELVAAAIEMDTRSRTELTE 232

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
            + ++T+  + +      ++ +L    G++   + +  +  +L  ++  +L++ L L R 
Sbjct: 233 TMKEITE--LENPNSVQQMKAWLS-DNGLETDTLGKKAVTELLKSAS-PKLSQVLTL-RQ 287

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
             + S++ K   + + V +DGR RG  QFYGA+RTGR+SG   Q QNLP+    +    +
Sbjct: 288 QLAKSSVRKYQAIEKTVCADGRARGMFQFYGANRTGRFSGRNIQLQNLPQNHLPDLAEAR 347

Query: 343 TIQALNRGETIA----DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
           ++      E +     D     S  +R+  I   G + +VAD + IEARV+AW AGE W+
Sbjct: 348 SLVRSGNFEAVKLLYEDVPDTLSQLIRTAFIPREGTQFLVADFSAIEARVIAWFAGEKWR 407

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCG 456
            + FA G DIY  + ++ F  P++K  ++   R  GK+ ELALGY G     K M +   
Sbjct: 408 QEVFAKGGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMGA--- 464

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           LD+                          +++ P                  AWR  +  
Sbjct: 465 LDMG-----------------------LTEEELPPLV--------------DAWRQSNPN 487

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-- 574
           +++ W ++       V+   + S+  +    R  M      + I LPS R+L Y   K  
Sbjct: 488 IVKFWWNVDHAVMEAVKFKHTTSSYGLTFSCRSGM------LFITLPSGRKLAYVKPKLG 541

Query: 575 -----GDC-SYLNT-ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLT 627
                G C +Y     T +  R  +YG K  ENIVQA +RDILC  MK  T     IV+ 
Sbjct: 542 TNKFGGQCITYEGIGGTKKWERLDSYGPKFVENIVQATARDILCYAMK--TLRCCSIVMH 599

Query: 628 VHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +HDE+V E    P  S+  +C  M + P WAKGL L+A+GY    Y+K
Sbjct: 600 IHDEVVIEA--DPRMSLEAVCEQMGRTPPWAKGLLLRADGYATPFYKK 645


>gi|313618507|gb|EFR90506.1| DNA polymerase [Listeria innocua FSL S4-378]
          Length = 684

 Score =  288 bits (736), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 228/708 (32%), Positives = 335/708 (47%), Gaps = 96/708 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y  A+   + L  YA D + VK+ D  +   +P ++L
Sbjct: 39  MKNLEIDIETYSSTNLQKSGVYRYVEADDFEVILFGYAVDGDEVKVIDLMDGEKIPKEIL 98

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDI-----PSKRWICTSVLARTNGLPSSLKNAC 113
             L DET+   A N+ FER+   + LG        PS  W C+ V +   GL  SL+   
Sbjct: 99  DALTDETITKWAFNAQFERVCLSRYLGYPTGTYLNPSS-WKCSMVWSAYMGLALSLEGVG 157

Query: 114 LALNFSEHLTKMEEGKALIARFC----KGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L   +   K+ EGK LI  FC       I+         + +  WQ F  Y KRDVEA
Sbjct: 158 AVLGLEKQ--KLTEGKDLIRYFCLPCTPTKINGGRTRNLSTDEIDKWQQFKAYNKRDVEA 215

Query: 170 TRELFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
             ++ +RLI  P+ +   D + LDQ INDRG ++D+D V +   +     +KL   + ++
Sbjct: 216 EIQIQQRLIKFPVPEDIWDEYHLDQEINDRGIKVDMDFVKQAIAMDDISHEKLLTVMQQI 275

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T+  + +      ++ +L    G+++  + +  +   L  ++  +L + L L R   + S
Sbjct: 276 TN--LDNPNSVQQMKSWL-CENGLEMETLGKKAVAEKLKETD-GELNEVLSL-RQQLAKS 330

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ-----ERSEEIL-- 340
           ++ K   +  AV SD R RG  QFYGA+RTGR++G + Q QNLP+      + +  I+  
Sbjct: 331 SVKKYTAMENAVCSDSRARGMFQFYGANRTGRFAGRLVQLQNLPQNHMPDLKEARNIVRN 390

Query: 341 --TQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
              +T++ L   E I D L   S  +R+  +   G K +VAD + IEARVL+W+AGE W+
Sbjct: 391 GDVETLEMLY--EDIPDTL---SQLIRTAFVPRVGHKFIVADFSAIEARVLSWLAGETWR 445

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCG 456
            K FA+G DIY  + ++ F  P++K  V+   R  GK+ ELALGY G     K M     
Sbjct: 446 TKVFASGGDIYCASASQMFKVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMG---- 501

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
                                               A++  L     + +  AWR  +  
Sbjct: 502 ------------------------------------ALEMGLEEEELKPLVNAWRMSNPN 525

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           + Q W D+       V+E  S     +              + IVLPS RRL Y   + G
Sbjct: 526 ITQFWWDVDRAAKQCVKENKSQETHSIE------FHCFSGMLFIVLPSGRRLAYVKPRIG 579

Query: 576 DCSYLNTA--------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLT 627
           +  +   +        T +  R  +YG K  ENIVQAISRDIL   MK+     Y IV  
Sbjct: 580 ENQFGGESVTYEGVGGTKKWERLESYGPKFVENIVQAISRDILMHAMKSLRH--YRIVAH 637

Query: 628 VHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           VHDE++ ET   P  SV  +C  M++ P WAKGL L A+GYE   Y+K
Sbjct: 638 VHDEVIIET--NPQISVTEVCKQMSQVPPWAKGLLLDADGYECDFYQK 683


>gi|255994008|ref|ZP_05427143.1| prophage LambdaSa04, DNA polymerase [Eubacterium saphenum ATCC
           49989]
 gi|255993676|gb|EEU03765.1| prophage LambdaSa04, DNA polymerase [Eubacterium saphenum ATCC
           49989]
          Length = 666

 Score =  287 bits (734), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 230/721 (31%), Positives = 328/721 (45%), Gaps = 108/721 (14%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL-- 58
           KL+IDIET S   +   G++ YAE     + L AYA DD  V+L D T+   +    L  
Sbjct: 5   KLYIDIETFSSVDIRTAGLYKYAESGDFEVLLLAYAIDDGDVELIDLTDGGEITQQKLVG 64

Query: 59  --QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLAL 116
             + L  +  +  AHN+ FE    K+ L I I   RW CT V     G P+SL+    AL
Sbjct: 65  VRRLLESQNYIKCAHNAHFEMECLKRALHIIIRPSRWECTMVKGMYRGYPASLEKMGEAL 124

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN---------HV-QAWQLFGEYCKRD 166
           +  E   K+  GKALI  FCK      P   T+ N         H  + W+LF EYCKRD
Sbjct: 125 DMPEDKAKLRTGKALINYFCK------PCKPTKTNGGRTRNLPKHASEKWELFREYCKRD 178

Query: 167 VEATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
           VE  RE+ K L  +  G    W+ D  +N RG  +D  LV +    I  E K    D +K
Sbjct: 179 VEVAREIDKMLPDVPQGVHTEWMRDYLVNWRGIAVDEALV-EAAIAIDGEVKSAHLDTIK 237

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
              G+     +   L  +L      ++  ++  ++K++L  S++T  A+ ++        
Sbjct: 238 RITGVDNPRSRAQVLD-WLNDTLDEEITSLNAASVKALLE-SDLTDDARAVLTAWQGLGK 295

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           ++  K  TL  A   D R+RG LQFYGASRTGRW+G + QP NLPR +     L Q  + 
Sbjct: 296 TSTKKYETLRAAAQKDNRVRGLLQFYGASRTGRWAGRLVQPHNLPRGDVYN--LNQAGEL 353

Query: 347 LNRGE---------TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
           +  G          ++ + L   S  +R+C +   G K V+ D + IEARVLAW+AGE W
Sbjct: 354 VKAGHKKDIELLHGSVPNTL---SGLIRTCFVPREGCKFVICDYSAIEARVLAWLAGEHW 410

Query: 398 KIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ-----RAIGKVMELALGYQGGAKVFKTMA 452
            ++ F     IY  T A+ +N     + K       R  GK+  LALGYQG     + M 
Sbjct: 411 VLEEFKGDGKIYEATAARMYNIDKSTIIKGHSNYAYRQKGKIATLALGYQGAVGALRQMG 470

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
           +              S   F D                     D+L G     + +AWR 
Sbjct: 471 A--------------SEDEFTD---------------------DELRG-----LVRAWRV 490

Query: 513 KHQGVLQLWK--------DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPS 564
            +  + +LW+         +++ F         IS +   N    +      ++ I LPS
Sbjct: 491 ANPCIAELWRYTEMMAKSTVSDEFYSGTNPMIPISFKSTLNAVNGI------NLAIGLPS 544

Query: 565 SRRLVYSD---VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN- 620
            R L Y +   V G   Y +   +   +E+TYGGKL ENIVQAI+RD+L + +   TK  
Sbjct: 545 GRELYYHNPVIVDGAIYYTDYTHAGKTKEQTYGGKLVENIVQAIARDVLADAINRITKTL 604

Query: 621 -----GYDIVLTVHDEIVSETPDTPYFSVGTLC-SLMTKNPSWAKGLPLKAEGYEAKRYR 674
                   IVL VHDE+V E        V  L   + +  PSWA+GLPLK E + +  Y+
Sbjct: 605 VVGGINAHIVLHVHDEVVVEAEAGCAEKVQELLEGVFSTPPSWAEGLPLKGESFISDYYK 664

Query: 675 K 675
           K
Sbjct: 665 K 665


>gi|256617076|ref|ZP_05473922.1| DNA polymerase I [Enterococcus faecalis ATCC 4200]
 gi|257088361|ref|ZP_05582722.1| DNA polymerase I [Enterococcus faecalis D6]
 gi|256596603|gb|EEU15779.1| DNA polymerase I [Enterococcus faecalis ATCC 4200]
 gi|256996391|gb|EEU83693.1| DNA polymerase I [Enterococcus faecalis D6]
          Length = 645

 Score =  286 bits (733), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 217/709 (30%), Positives = 334/709 (47%), Gaps = 99/709 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIE+ S   + K G + Y+E +   I L AY+ D +PV++ D  +   +P D++
Sbjct: 1   MKHLSIDIESFSSADISKCGAYKYSESSDFEILLFAYSVDGQPVEVVDLAQGETIPEDVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
           + L DETV+  A N+ FER+   + LG++  +  + W CT V A T GLP SL      L
Sbjct: 61  KSLSDETVIKHAFNANFERVCLSRFLGLNGFLNPRGWHCTMVWAATLGLPLSLAGVGAVL 120

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANH----------VQAWQLFGEYCKRD 166
              +   K+ EGK L+  FC       P + T+ N           +  W+ F  Y  RD
Sbjct: 121 GLDKQ--KLSEGKDLVRYFCM------PCNATKVNQGRTRNLPRHSLDKWRDFVAYNIRD 172

Query: 167 VEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           VE    + ++L   P++    + + LDQ INDRG  ID+ L      L    + +++E +
Sbjct: 173 VEVEVAIQQKLSNFPVTQEIWEEYWLDQEINDRGIEIDMILADSAVNLDEVSKNEINEQL 232

Query: 225 VKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
            KLT   + +      +R +L    G+++  + +  +K ++  +N  +L K+++L R   
Sbjct: 233 KKLTG--LENPNSVLQMRSWLSQ-HGLEVESLGKAAVKELIEQTNDDKL-KEVLLLRQQL 288

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTI 344
           + S++ K   +      D R RG  QFYGA+RTGR++G   Q QNLP+   S+  L +  
Sbjct: 289 AKSSVRKYQAMQNYACLDNRARGLFQFYGANRTGRFAGRGIQLQNLPQNHMSD--LAEAR 346

Query: 345 QALNRGE-----TIADPLG-LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
           + +  GE      + D +  + S+ +R+  I   G K +V+D + IEARV+AW+AGE W+
Sbjct: 347 ELVRNGEYELLALLYDNVPEVLSELIRTAFIPKPGMKFIVSDFSAIEARVIAWLAGEKWR 406

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMAS-HC 455
            + F NG DIY  + ++ F  P++K  V+   R  GK+ ELALGY G       M + + 
Sbjct: 407 KEVFRNGGDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALTAMGALNM 466

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
           GL   +    V S                                         WR  + 
Sbjct: 467 GLTEDELQPLVAS-----------------------------------------WRETNP 485

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK- 574
            + +LW D+       V  G       +              + I L S RRL Y   + 
Sbjct: 486 AITKLWWDIDSAAKGCVSVGAKTETHGI------TFEYKSGFMFIQLLSGRRLAYVKPRI 539

Query: 575 GDCSYLNTA--------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVL 626
           G   +   A        T +  R  +YG K  ENIVQA++RDILC  M+N     Y IV 
Sbjct: 540 GQNRFGGAAVTYEGVGTTKKWERLESYGPKFVENIVQAMARDILCFAMQNLKD--YRIVG 597

Query: 627 TVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            VHDE++ E P     +V  + S+M++ P+WAKGL L A+GYE   Y+K
Sbjct: 598 HVHDEVIIEVPKE--VTVEEVNSIMSQTPNWAKGLLLNADGYECDFYQK 644


>gi|300764694|ref|ZP_07074685.1| hypothetical protein LMHG_11074 [Listeria monocytogenes FSL N1-017]
 gi|300514580|gb|EFK41636.1| hypothetical protein LMHG_11074 [Listeria monocytogenes FSL N1-017]
          Length = 645

 Score =  286 bits (732), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 223/707 (31%), Positives = 328/707 (46%), Gaps = 95/707 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L +D+ET S   L K GV+ Y+E     I L AY+ D  PV++ D      +P+++L
Sbjct: 1   MKHLSLDLETYSSVDLSKCGVYKYSESPDFEILLFAYSVDGGPVEVVDLKMDETIPAEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L DETV+  A N+ FER+   + LG+D  +  + W CT V   T GLP SL      L
Sbjct: 61  TSLSDETVIKHAFNASFERVCLSRFLGLDGFLNPRGWQCTMVWGATLGLPLSLVGVGAVL 120

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRD 166
              +   K+ EGK LI  FC       P + T+ N  +           W  F  Y  RD
Sbjct: 121 GLDKQ--KLTEGKDLIRYFC------VPCNPTKVNGGRTRNLPHHAPTKWSAFKTYNSRD 172

Query: 167 VEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           VE    +  +L   P+ D     + LDQ INDRG  ID D V    +L    +  L++ +
Sbjct: 173 VEVEIAIQGKLSNFPVLDSVWKEYWLDQEINDRGIEIDKDFVEAAVQLDELSKAGLNQQL 232

Query: 225 VKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
            +LT   + +      +R +L L  G++   + +  +  +L       L + L+L R   
Sbjct: 233 QELTG--LENPNSVLQMRGWL-LDHGLETESLGKKAVAELLEQPIDENLKQVLVL-RQQL 288

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTI 344
           + S++ K   +     SD R RG  QFYGA+RTGR++G   Q QNLP+   S+    +++
Sbjct: 289 AKSSVKKYQAMQNFACSDNRSRGLFQFYGANRTGRFAGRGIQLQNLPQNHMSDLSEARSL 348

Query: 345 QALNRGETIADPLG----LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
              +  E +    G    + S+ +R+  +   G K +V+D + IEARV+AW++GE W+ +
Sbjct: 349 VKQSNFEMLNILYGNVPNVLSELLRTAFVPREGMKFIVSDFSAIEARVIAWLSGEKWRQE 408

Query: 401 AFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTM-ASHCGL 457
            F NG DIY  + ++ F  P++K  V+   R  GK+ ELALGY G     K M A   GL
Sbjct: 409 VFKNGGDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMDALEMGL 468

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
              +    V S                                         WR  +  +
Sbjct: 469 TEDELQPLVNS-----------------------------------------WRDSNINI 487

Query: 518 LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-GD 576
            +LW  + +     V+E      RR  +   +        + I L S R+LVY   K G+
Sbjct: 488 TELWWAVDKAVKTCVKE------RRSTSTHGIKFEYKSGFLFIQLLSGRKLVYVKPKIGE 541

Query: 577 CSYLNT--------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTV 628
             +           AT +  R  +YG K  ENIVQAI+RDILC  M+N  K  Y IV  V
Sbjct: 542 NKFGGEAVTYEGVGATKKWERLESYGPKFVENIVQAIARDILCFAMENLRK--YRIVGHV 599

Query: 629 HDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           HDE++ E P      V  +C LM++ P WA+GL L A+GYE + Y+K
Sbjct: 600 HDEVIIEVPMES--KVEDICQLMSQTPKWAEGLLLNADGYECEFYQK 644


>gi|167630957|ref|YP_001681456.1| DNA polymerase i, putative [Heliobacterium modesticaldum Ice1]
 gi|167593697|gb|ABZ85445.1| DNA polymerase i, putative [Heliobacterium modesticaldum Ice1]
          Length = 646

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 227/704 (32%), Positives = 326/704 (46%), Gaps = 88/704 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y E     I L  Y+ D   V++ D     A+PS ++
Sbjct: 1   MRALNIDIETYSSVDLAKSGVYRYTESPDFAILLFGYSVDGGEVQVVDLMCSEAIPSKVV 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L D+ V   A N+ FERI   K LG+     +    W CT V +   GLP SL+    
Sbjct: 61  DALTDKDVTKWAFNAQFERICLSKWLGLPTGQYLDPMSWRCTMVWSAYMGLPLSLEGTGA 120

Query: 115 ALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEAT 170
            L   +   K+ EGK LI  F   CK ++ +         H    W  F  Y  RDVE  
Sbjct: 121 VLGLEKQ--KLTEGKDLIRHFSVPCKPTVSNEGRTRNLPIHAPDKWAAFKAYNLRDVETE 178

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
             + ++L   P+ +G    + LDQ INDRG  +D+DLV +  E+  + R KL   I +LT
Sbjct: 179 MAIQQKLAKFPVPEGVWGEYHLDQEINDRGVALDMDLVRQAIEMDNRSRSKLTGMIRELT 238

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
           +  + +      ++ +L    G++   + +  +  +L  ++   L K L L R + + S+
Sbjct: 239 E--LENPNSVVQMKQWLS-DHGLETDTLGKKAVVELLKTAS-EPLGKVLEL-RQSLAKSS 293

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K   +   V +DGR RG  QFYGA+RTGRW+G + Q QNLP+    +  L Q    + 
Sbjct: 294 VKKYTAMENVVCTDGRARGMFQFYGANRTGRWAGRLIQLQNLPQNHMPD--LEQARSLVR 351

Query: 349 RG-----ETIADPLG-LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF 402
            G     E + D +  + S+ +R+  +   G K +VAD + IEARV+AW+AGE W+ + F
Sbjct: 352 SGNFAALEMLYDSVPEVLSELIRTAFVPKKGCKFIVADFSAIEARVIAWLAGEKWRQEVF 411

Query: 403 ANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQ 460
            +G DIY  + ++ F+ P++K  V+   R  GK+ ELALGY G     K M +      +
Sbjct: 412 ESGGDIYCASASQMFHVPVEKNGVNGHLRQKGKIAELALGYGGSVGALKAMGALEMGLEE 471

Query: 461 QFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQL 520
           +  Q + S                                        AWR+ +  +++L
Sbjct: 472 EELQPLVS----------------------------------------AWRSSNPKIVRL 491

Query: 521 WKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK------ 574
           W D+       V+E      R       +          I LPS RRL Y   +      
Sbjct: 492 WWDIDRAAMKAVRE------RTTTETHGIRFSYQSGMFFITLPSGRRLAYVKPRIGQNRF 545

Query: 575 -GDCSYLNTATSQLMRER--TYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDE 631
             DC            ER  +YG KLTENIVQA SRDILC  M+N       IV+ VHDE
Sbjct: 546 GSDCITYEGVGGAKKWERIESYGPKLTENIVQATSRDILCYAMRNLRH--CSIVMHVHDE 603

Query: 632 IVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           IV E       S   +C  M + P WAKGL L+A+GYE   Y+K
Sbjct: 604 IVIEADRR--MSTEAVCKQMGQTPPWAKGLLLRADGYETDFYKK 645


>gi|227875067|ref|ZP_03993212.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35243]
 gi|304390310|ref|ZP_07372263.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|306817354|ref|ZP_07451099.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35239]
 gi|227844345|gb|EEJ54509.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35243]
 gi|304326066|gb|EFL93311.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|304649795|gb|EFM47075.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35239]
          Length = 655

 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 225/711 (31%), Positives = 327/711 (45%), Gaps = 93/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  LF DIE+ S   L K GV+ YAE     + L  Y+ D  P+++ D     ++P ++L
Sbjct: 1   MRTLFCDIESFSLAQLAKTGVYPYAEHPDFELLLFGYSIDGGPIEVVDLANGQSIPDEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPS---------KRWICTSVLARTNGLPSSL 109
             L D +V+  AHN+ FER+     L    P          ++W CT + +   GLP SL
Sbjct: 61  AALVDPSVVKWAHNAAFERVCLSAWLRTHHPELLADGFLGPRQWRCTMIWSAYLGLPMSL 120

Query: 110 KNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----WQLFGEYCKR 165
                 L     + K   GK LI +FC  +  S      R N   A    W  F +Y +R
Sbjct: 121 DAVATVLKLD--VQKDTVGKKLIKQFCTPATPSVLNGGKRRNPPSADPTGWARFIDYNRR 178

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE    +  RL   P+ + E D + LDQ IND G  +D  LV     +    R      
Sbjct: 179 DVEVELAIHDRLACFPMPESEWDTYTLDQRINDAGILLDHTLVDNAVGVDEHHRNATLAR 238

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
              LT   + +      L+ +L    G  L  +++  + + L  +  T   K+++  R  
Sbjct: 239 AQTLTG--LENPNSPIQLKQWL-ASRGCVLDSLAKAEVDAALDTA--TGTVKEVLGLRGD 293

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR-------QERS 336
            + S++ K   +     SDGR RG +QFYGA RTGR++G + Q QNLPR       Q R+
Sbjct: 294 LAKSSVKKYQAMQNVAGSDGRARGLIQFYGAGRTGRFAGRLVQVQNLPRNYLPDLDQART 353

Query: 337 EEILTQTIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGE 395
             + T  ++AL    E++ D L   S  +R+  I S G + +VAD + IEARV+AW+AGE
Sbjct: 354 L-VRTGNLEALELLHESVPDTL---SQLIRTAFIPSPGHRFIVADFSAIEARVIAWLAGE 409

Query: 396 DWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
              ++AF  G+D+Y  T ++ F  P++K  V+ E R  GK+  LA G+ G     + M +
Sbjct: 410 TTTLQAFREGKDLYCETASRMFGVPVEKHGVNGELRQKGKLAVLACGFGGSTGALERMGA 469

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
              L +      +K                                      +  AWRA 
Sbjct: 470 ---LTMGLAEHELKP-------------------------------------IVDAWRAA 489

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           +  ++ LW  + E     +    SI  R       L        + I LPS RRL Y   
Sbjct: 490 NPHIVALWAGVEEAAIAAIASRQSIRLR------NLRFSVEAGILFIELPSGRRLAYVKP 543

Query: 574 K-GDCSYLNTATSQLMRE--------RTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + G+  +  T+ +              TYGGKLTENIVQAI+RD+L  GM    K G+ I
Sbjct: 544 RLGENRWGGTSITYTGTTTARRWGQLETYGGKLTENIVQAIARDLLVTGMHAVAKAGHQI 603

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V+ VHDEIV + P+   F+    C LM+  P+WA+GLPL A+GYE   YRK
Sbjct: 604 VMHVHDEIVIDEPENSGFTATGACELMSTLPAWAEGLPLDADGYECAYYRK 654


>gi|153955279|ref|YP_001396044.1| Phage-related DNA polymerase [Clostridium kluyveri DSM 555]
 gi|219855702|ref|YP_002472824.1| hypothetical protein CKR_2359 [Clostridium kluyveri NBRC 12016]
 gi|146348137|gb|EDK34673.1| Phage-related DNA polymerase [Clostridium kluyveri DSM 555]
 gi|219569426|dbj|BAH07410.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 644

 Score =  284 bits (726), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 225/711 (31%), Positives = 331/711 (46%), Gaps = 104/711 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M+ + IDIET S   L K GV+ YAE     I L  Y+ D   V++ D      +P++++
Sbjct: 1   MNSISIDIETFSSANLQKCGVYRYAESDDFEILLFGYSVDGGAVQVVDLACGEKIPNEII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D +V   A N++FER+   K L +   +    W C+ V +   GLP SL+     L
Sbjct: 61  NALMDNSVTKWAFNAMFERVCLSKWLNLTDYLDPTSWKCSMVWSAYMGLPLSLEGVGAVL 120

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRD 166
              +   K+ EGK LI  FC       P   T++N           +  W+ F  Y  RD
Sbjct: 121 GLEKQ--KLTEGKDLIKYFCT------PCSPTKSNGGRVRNLPKHDMDKWERFKAYNIRD 172

Query: 167 VEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           VEA   + +RL   P+ +     + LDQ INDRG  ID+  V +  ++  Q R+KL   +
Sbjct: 173 VEAEMSIQQRLSKFPIPENIWSEYHLDQKINDRGIAIDMAFVKQAVKMDEQSREKLMALM 232

Query: 225 VKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
             +T+  + +      ++ +L    G++   + +  +  +L  +    L   L L R   
Sbjct: 233 QDITN--LENPNSIQQMKEWL-ADNGLETDSLGKKAVAEMLKTAP-EPLGTVLEL-RQQL 287

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTI 344
           + S+I K   +  AV +DGR RG  QFYGA+RTGR+SG + Q QNLP+    +    +  
Sbjct: 288 AKSSIKKYTAMENAVCNDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPD---LEQA 344

Query: 345 QALNRGETIADPLGLA--------SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           +AL R     D L L         S+ +R+  +   G K +VAD + IEARV+AW+AGE 
Sbjct: 345 RALVRSGNF-DALTLIYDSIPEVLSELIRTAFVPQEGMKFIVADFSAIEARVIAWLAGEK 403

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMAS- 453
           W+I  F NG DIY  + ++ FN P++K  V+   R  GK+ ELALGY G     K+M + 
Sbjct: 404 WRIDVFQNGGDIYCASASQMFNVPVEKNGVNGHLRQKGKIAELALGYGGSVGALKSMGAL 463

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G++ ++    V                                          AWR  
Sbjct: 464 EMGIEEEELQPLV-----------------------------------------TAWRQS 482

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY--- 570
           +  + +LW D+       V++        +  + +  M      + IVLPS RRL Y   
Sbjct: 483 NPNITKLWWDVDHAVKTCVKQKIPTETHGIKFIYQSGM------LFIVLPSGRRLSYVKP 536

Query: 571 ---SDVKGDCSYLNT---ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
               +V G  S        T +  R  +YG K  ENIVQAISRDILC  M+  T     I
Sbjct: 537 RMGENVFGGESVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILCHAMQ--TLKNCSI 594

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDEI+ E       S+ T+C  M + P+WA GL L A+GYE + Y+K
Sbjct: 595 VAHVHDEIIIEA--DMRMSLSTICEQMARTPTWANGLLLSADGYECQFYQK 643


>gi|227497454|ref|ZP_03927686.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
 gi|226833079|gb|EEH65462.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
          Length = 649

 Score =  282 bits (721), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 228/710 (32%), Positives = 322/710 (45%), Gaps = 97/710 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L +D+ET SP  L   GV+ YAE     I L  Y+ D  P K+ D      +P  +L
Sbjct: 1   MRSLSLDLETFSPTNLATAGVYRYAEDEAFRILLFGYSIDGAPAKVIDLARGEPIPPGIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIP---------SKRWICTSVLARTNGLPSSL 109
           Q L D TV   A N+ FER+     L    P          + W CT V A + GLP SL
Sbjct: 61  QALTDPTVTKSAFNASFERVCMSAYLRRHHPDLLAEGFLGPRGWRCTMVWAASLGLPMSL 120

Query: 110 KNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTR---ANHVQAWQLFGEYCKRD 166
             A  AL     + K   G+ LI RF   SI  P  D  R   ++    WQ +  Y +RD
Sbjct: 121 DGAAKALRLP--IEKDPAGQKLIRRF---SI--PGKDGIRVLPSDDPVGWQQYISYNRRD 173

Query: 167 VEATRELFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           V+   +L  RL   P+ + E + + LDQ IND G RID  L     E+ ++ R       
Sbjct: 174 VDVEVQLASRLARNPMLEAEWETYWLDQRINDTGVRIDTQLAAHAVEVDSRHRDTCLARA 233

Query: 225 VKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
            +LT   + +      L+ +L    G +L  +++  +++ L    +T    +++  R   
Sbjct: 234 QQLTG--LENPNSPIQLKDWL-AAHGCELESLTKTEVEAALE--TVTGDVAEVLRLRQDL 288

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTI 344
           S S++ K   +     SD R RG +Q+ GA RTGR++G + Q QNLPR    +  L    
Sbjct: 289 SRSSVKKYQAMLTVAGSDDRARGLIQYMGAGRTGRFAGRLIQVQNLPRNHMPD--LASAR 346

Query: 345 QALNRG-----ETIADPL-GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
             LN G     E +  PL    S  +R+  I S   + +VAD + IEARVLAW+AGE+  
Sbjct: 347 SLLNAGNSDALELLYSPLPDTLSQLIRTAFIPSKDHRFIVADFSAIEARVLAWLAGEEGT 406

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMAS-HC 455
           ++AF  G+D+Y  T ++ F  P++K   + E R  GK+  LA GY G     K M +   
Sbjct: 407 LQAFREGKDLYCQTASRMFGVPVEKHGANSELRQKGKIAVLACGYGGSVGALKAMGALRM 466

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
           GLD  +    V                                          AWR  + 
Sbjct: 467 GLDESELKPLV-----------------------------------------DAWRDANP 485

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK- 574
            V+Q W D+ +     V+       R    V R+ +      + I LPS R L Y   + 
Sbjct: 486 MVVQFWHDIEQAAITTVE------TRTPTQVGRIHLSYRSGCLFIALPSRRELCYPRPRL 539

Query: 575 -----GDCSYLNTATSQLMRE----RTYGGKLTENIVQAISRDILCEGMKNATKNGYDIV 625
                G  S L        R+     TYGGKLTEN+VQA +RD+L   M +    G+ IV
Sbjct: 540 GENRFGMTSILFDGVDGTTRKWGPIETYGGKLTENLVQATARDLLTHAMHHVDAAGHRIV 599

Query: 626 LTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           + +HDEIV + P T   SV  + +LMT+ P+WA GLPL A+GYE   Y K
Sbjct: 600 MHIHDEIVVDEP-TDGASVEDIVTLMTRLPTWADGLPLDADGYECGFYMK 648


>gi|298346386|ref|YP_003719073.1| DNA-directed DNA polymerase [Mobiluncus curtisii ATCC 43063]
 gi|298236447|gb|ADI67579.1| DNA-directed DNA polymerase [Mobiluncus curtisii ATCC 43063]
          Length = 658

 Score =  280 bits (716), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 219/702 (31%), Positives = 327/702 (46%), Gaps = 90/702 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           +  L +D+ET S   L + GV+ Y +     I LC+Y+ DD  V   D      +P +++
Sbjct: 19  VKSLALDLETFSAVNLSQCGVYRYCDDPSFRILLCSYSVDDSDVVTVDLASGEQLPPEVV 78

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D +V+  A+N+ FER      LG  +    W CT V A T GLP SLK+    L  
Sbjct: 79  AALDDPSVIKWAYNAAFERTCLSAHLGHRLDPTGWRCTMVWAATLGLPLSLKDVGTVLGL 138

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFK 175
           +    K+ EGK LI  F    K  I   P D +      AW LF +Y  RDVE    + +
Sbjct: 139 AHQ--KLAEGKDLIKYFSLPTKTGIRHQPSDDS-----AAWALFKQYNARDVEVETTIRR 191

Query: 176 RLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIR 233
           +L   P+ D     + +DQ INDRG  ID  L         + RK+      +LT   + 
Sbjct: 192 KLSHHPVPDEVWGQYEVDQRINDRGIHIDTRLATNAMACDKKYRKRTLARAQELTG--LD 249

Query: 234 SSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLN 293
           +      L+ +L    G  +  M++  + S L  +  T   ++ +  R   S S++ K  
Sbjct: 250 NPASPLQLQSWL-AEQGCKISSMAKEDVDSALDTA--TGSVREALELRQDLSKSSVAKYR 306

Query: 294 TLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE-- 351
            +++A  +DGR  G LQFYGASRTGRW+G + Q QNLPR    +  L Q    ++ G+  
Sbjct: 307 KMADATCADGRAHGLLQFYGASRTGRWAGRLVQVQNLPRNYLPD--LAQARSLVHYGDFD 364

Query: 352 -------TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
                  ++ D L   S  +R+  I S   + +VAD + IEARVLAW+AGE+  + AF N
Sbjct: 365 VLEMLYPSVPDTL---SQLIRTAFIPSENHRFIVADYSAIEARVLAWLAGEETTLAAFTN 421

Query: 405 GEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           GED+Y  T +  F  P++K   + E R  GK+  LA GY G     K M           
Sbjct: 422 GEDLYCATASAMFGVPVEKHGANAELRQKGKIAVLACGYNGSVGALKAMG---------- 471

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                         A+K  L  +  + +  AWRA +  ++ +W 
Sbjct: 472 ------------------------------ALKMGLTASELQPIVDAWRAANPNIVAMWH 501

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-GDCSYLN 581
           D+ +     +Q   +I+ R    +  L     K  + I LPS RRL Y     G   +  
Sbjct: 502 DVDQ---TAIQ---AITTRSTVTLGNLSFTGTKGMLFITLPSGRRLAYVKPGLGVNRFGG 555

Query: 582 TATS--------QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
           T+ +        +  +  TYGGKL ENIVQA +RD+L E +      G+++V+ +HDE+V
Sbjct: 556 TSITYWGQGINRKWQQLETYGGKLVENIVQATARDLLAEAITRIENAGHEVVMHIHDEVV 615

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +       +V  +C+LM + P+WA GLP+ A GY+   Y K
Sbjct: 616 VDESKDSGTTVADICTLMNQLPTWALGLPIDAAGYKCDFYMK 657


>gi|167761124|ref|ZP_02433251.1| hypothetical protein CLOSCI_03522 [Clostridium scindens ATCC 35704]
 gi|167661243|gb|EDS05373.1| hypothetical protein CLOSCI_03522 [Clostridium scindens ATCC 35704]
          Length = 662

 Score =  280 bits (715), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 230/735 (31%), Positives = 330/735 (44%), Gaps = 134/735 (18%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ YAE     I L  Y+ D   VK+ D  +   +P +L+
Sbjct: 1   MQTLSIDIETYSSINLSKCGVYKYAEAPDFEILLFGYSVDGCDVKVIDLAQGEHLPQELI 60

Query: 59  QYLRDETVMCVAHNSLFERIL---FKKTLGIDIP-----------------SKRWICTSV 98
             L D++++  A N+ FER+    + + LGI +                  S+ W C+ V
Sbjct: 61  DALTDDSIIKWAFNANFERVCLSRYLRDLGISLDPFHDSHHLSQECSHFLNSESWRCSMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN------- 151
            A T GLP SL+     L   +   K+ EGK LI  F      S P   T+AN       
Sbjct: 121 WAATMGLPLSLEGVGSVLGLEKQ--KLTEGKELIKYF------SVPCAPTKANGGRTRNR 172

Query: 152 ---HVQAWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV 206
                + W  F  Y  RDVE    +  RL   P+ +     + +DQ INDRG RID+DLV
Sbjct: 173 PFHDPEKWDAFKRYNIRDVETEMGIKDRLSKFPVPEAVWYEYHIDQEINDRGVRIDMDLV 232

Query: 207 LKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILS 266
            +  E+  + R +L   I K+TD  + +      ++ +L    G++   + +  +  ++ 
Sbjct: 233 TEAIEMDTRSRTELTSAIKKMTD--LENPNSVQQMKQWLS-NNGLETDSLGKKVVAELIK 289

Query: 267 HS-----NITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWS 321
            +     N+ +L + L       + S++ K  T+  AV  DGR RG   FYGA+RTGRW+
Sbjct: 290 TAPPELQNVLELRQQL-------AKSSVRKYQTMERAVCDDGRARGMFAFYGANRTGRWA 342

Query: 322 GCVFQPQNLPRQERSEEILTQTIQALNRG---------ETIADPLGLASDCVRSCIIASN 372
           G + Q QNLP+     E L      +  G         E + D L   S  +R+  I  +
Sbjct: 343 GRLIQLQNLPQNHL--EDLADARALVKSGDFDAVKLLYEDVPDTL---SQLIRTAFIPKS 397

Query: 373 GKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRA 430
             +  V+D + IEARV+AW AGE W+ K FA G DIY  + ++ F+ P++K  ++   R 
Sbjct: 398 DTQFYVSDFSAIEARVIAWYAGETWRQKVFAEGGDIYCASASQMFHVPVEKHGINGHLRQ 457

Query: 431 IGKVMELALGYQGGAKVFKTM-ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQY 489
            GK+ ELALGY G     K M A   GL                            +D+ 
Sbjct: 458 KGKIAELALGYGGSIGALKAMGAIEMGLS---------------------------EDEL 490

Query: 490 PEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRL 549
           P                  AWR  +  +++ W D+       V+   + S   +    R 
Sbjct: 491 PPLV--------------DAWRQTNPNIVKFWWDVDRAVMEAVKHKHTTSCYGLTFSCRS 536

Query: 550 VMRRHKRDVHIVLPSSRRLVYSDVK-------GDCSYLNTATSQLMRER--TYGGKLTEN 600
            M      + I LPS R L Y   K       G+C       S    ER  +YG K  EN
Sbjct: 537 GM------LFITLPSGRNLAYVKPKIGTNKFGGECITYEGVGSTKKWERLDSYGPKFVEN 590

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQA SRDILC  MK  T    +IV+ +HDE+V E    P  S+  LC  M + P WA+G
Sbjct: 591 IVQATSRDILCYAMK--TLRNCEIVMHIHDELVIEA--DPCMSLDVLCEQMGRTPPWARG 646

Query: 661 LPLKAEGYEAKRYRK 675
           L L+A+GY    Y+K
Sbjct: 647 LKLRADGYTCPFYKK 661


>gi|150391701|ref|YP_001321750.1| DNA-directed DNA polymerase [Alkaliphilus metalliredigens QYMF]
 gi|149951563|gb|ABR50091.1| DNA-directed DNA polymerase [Alkaliphilus metalliredigens QYMF]
          Length = 649

 Score =  279 bits (713), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 225/702 (32%), Positives = 329/702 (46%), Gaps = 90/702 (12%)

Query: 4   LFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L  DIET S   L K GV+ Y  A+   I L AY+ D   VK+ D      +P  +L  L
Sbjct: 7   LHCDIETYSSVNLAKCGVYRYVQADDFEILLFAYSTDGSEVKIIDLARGEKIPPLILSAL 66

Query: 62  RDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACLALN 117
            D+ V+  AHN+ FERI F + LG      I  + W CT   A   GLP SL      L 
Sbjct: 67  EDDKVIKYAHNASFERICFSRFLGYPVGKYISPESWRCTMTWAAYMGLPLSLVGVGAVLG 126

Query: 118 FSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHV-----QAWQLFGEYCKRDVEATRE 172
             +   KM EGK LI  FC G       +  R  ++     + W+ F  Y  RDVEA  E
Sbjct: 127 LGKQ--KMTEGKDLIRFFC-GPCSPTKTNGNRTRNLPSDDPEKWERFKSYNIRDVEAEME 183

Query: 173 LFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++LI  P+ D   D + L + IND G ++D+D V +   +      KL + + ++T+ 
Sbjct: 184 IEQKLIKFPVPDFIWDEYHLSERINDSGIKVDMDFVKQAIAMNEISHTKLMDQMQEITE- 242

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
            + +      ++ +L    G++   + +  +  +L  +    LA+ L L R   + S++ 
Sbjct: 243 -LDNPNSVQQMKDWLS-DNGLETDTLGKKAVAELLKDAP-EHLAEVLKL-RQQLAKSSVK 298

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  AV SDGR+RG   F GA+RTGR+S  + Q QNLP+    +  L +    +  G
Sbjct: 299 KYTAMENAVCSDGRIRGMFTFLGANRTGRFSSKIVQLQNLPQNHMMD--LKEARSIVKNG 356

Query: 351 ETIA------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
           ++ A      D     S  +R+  +   G K +VAD + IEARVL+W+AGE W+ + FAN
Sbjct: 357 DSEALELLYEDIPDTLSQLIRTAFVPKEGNKFIVADFSAIEARVLSWLAGEQWRNEVFAN 416

Query: 405 GEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           G DIY  + ++ F  P++K  V+   R  GK+ ELALGY G     K M           
Sbjct: 417 GGDIYCASASQMFRVPVEKHGVNAHLRQKGKIAELALGYGGSVGALKAMG---------- 466

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                         A++  L     + +  AWRA +  +++ W 
Sbjct: 467 ------------------------------ALEMGLEEEELKPLVNAWRASNPNIVKFWW 496

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY------SDVKGD 576
           D+       ++E  S   + V N+    M      + IVLPS R+L Y       ++ G 
Sbjct: 497 DVDREVKKCIKEKKS---QEVQNIKFHYMSGM---LFIVLPSGRKLAYVKPNIGENIFGG 550

Query: 577 CSYLNT---ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
            S       AT +  R  +YG K  ENIVQAISRDIL   MK  T +   IV  VHDE++
Sbjct: 551 ESVTYEGVGATKKWERIESYGPKFVENIVQAISRDILMYAMK--TLSTCSIVAHVHDEVI 608

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            E   +   S+  +C  M + P WAKGL L A+GYE   Y+K
Sbjct: 609 IEADQS--LSLDMVCKQMGRVPPWAKGLLLDADGYECDFYKK 648


>gi|304406771|ref|ZP_07388426.1| DNA-directed DNA polymerase [Paenibacillus curdlanolyticus YK9]
 gi|304344304|gb|EFM10143.1| DNA-directed DNA polymerase [Paenibacillus curdlanolyticus YK9]
          Length = 653

 Score =  278 bits (712), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 217/706 (30%), Positives = 321/706 (45%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K G + YA+     I + AY+WD  PV++ D  +   +P +++
Sbjct: 1   MRTLNIDIETYSSIDIKKAGAYKYAQSPDFQILMFAYSWDGGPVQIVDLAQGEYLPQEIV 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D  V+  A+N+ FE     +      P ++W CT V     G  + L     AL  
Sbjct: 61  EALADPAVVKHAYNAAFEWYCLNRFF--YSPIEQWRCTQVHGLYCGYTAGLGAVGEALGI 118

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHV----------QAWQLFGEYCKRDVE 168
            +   K+  G +LI  FC       P   TR N +          + W+LF EYC  DV 
Sbjct: 119 PQDKRKLGTGGSLIRTFCI------PCKPTRTNGMRTRTLPHHEPEKWKLFKEYCVGDVV 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
           A  E+ +RL   P+ D E  LW LDQ IN RG   DL +V     +  Q   +L  + + 
Sbjct: 173 AEMEIQRRLSAFPVPDQEWQLWHLDQRINARGLFCDLQMVEGALAVDEQVTSELRAEAIS 232

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           LT   + + +    L  +L   TG ++ ++ +GT+  ++   +  + A+ ++  R   S 
Sbjct: 233 LTG--LDNPKSVQQLSKWLAEETGEEVENLQKGTVSKLIDKLDEGK-ARRVLEIRQELSK 289

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           ++  K   +  A  SD R+RG LQFYGA+RTGRW+G + Q QNLPR   S     + +  
Sbjct: 290 TSTKKYAAMQTAAGSDQRVRGLLQFYGANRTGRWAGRLVQIQNLPRNYLSTLEYARQLVV 349

Query: 347 LNRGETIADPLGLASDC----VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF 402
             + E +    G   D     +R+  +   GK+L VAD + IEARV+AW+AGE W++  F
Sbjct: 350 ERKVEMLKFVYGNVPDTLSQLIRTAFVVPAGKQLGVADFSAIEARVIAWLAGEQWRLDVF 409

Query: 403 ANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQ 460
           A    IY  + ++ F  PI+++ K  + R  GKV ELALGYQGG      M +       
Sbjct: 410 ATHGKIYEASASQMFGVPIEQIGKGSDLRQKGKVAELALGYQGGKGALIAMGA------- 462

Query: 461 QFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQL 520
              Q +                     + PE   +              WR  ++ ++ L
Sbjct: 463 -LDQGLTEA------------------ELPEIVTR--------------WRNANRRIVDL 489

Query: 521 WKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVH-IVLPSSRRLVYSDV------ 573
           W  + E  A  V E G     R     R      K+D   I LPS R+L Y+        
Sbjct: 490 WYSM-EAAAIEVMETGQPVGVRGLIFARESHHATKQDFFTITLPSGRKLFYAKPFLREND 548

Query: 574 --KGDCSY--LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
             K    Y  ++  + +     TYGGKL EN VQAI+RD L   +      GY IVL VH
Sbjct: 549 FGKPALHYWGMDQTSKKWTVLNTYGGKLVENCVQAIARDCLAVTLMRLDHVGYPIVLHVH 608

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE+ +E        +  +  +M +   WA GLPLK +G+    Y K
Sbjct: 609 DEVGAELSSAD--ELDRMLEIMAQPIQWAPGLPLKGDGFVTNFYMK 652


>gi|237738628|ref|ZP_04569109.1| DNA polymerase [Fusobacterium sp. 2_1_31]
 gi|229424111|gb|EEO39158.1| DNA polymerase [Fusobacterium sp. 2_1_31]
          Length = 656

 Score =  278 bits (711), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 220/710 (30%), Positives = 335/710 (47%), Gaps = 90/710 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K G + YA  +   I L AY+ D + VK+ D  +  A+P ++L
Sbjct: 1   MRTLNIDIETFSSVDIGKSGAYKYAMSDDFQILLFAYSVDGQDVKIIDLAQGEAIPGEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L+DET +  A+N++FE        GI+ P ++W CT V     G  + L     A+  
Sbjct: 61  DLLKDETCIKYAYNAVFEWWCLNMA-GIETPLEQWHCTMVHGLYCGYTAGLAAIGNAMGL 119

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN---------HV-QAWQLFGEYCKRDVE 168
            +   K+  G ALI  FC       P + T++N         H  + W+LF EYC +DV 
Sbjct: 120 PQDKKKLTTGSALIRYFC------IPCNPTKSNGNRTRNLPHHAPEKWELFKEYCIQDVV 173

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
              E+ +RL   P+ + E  LW+LD  +N  G R+D +LV     + A  R  L E+   
Sbjct: 174 TEMEIGRRLSAFPVPEREWKLWVLDTFMNAYGVRVDSELVNGALYIDALSRANLLEEARD 233

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           +T   + +   T  L  +L    G ++ ++ + T+  ++   +  + AK ++  R   S 
Sbjct: 234 ITK--LDNPNSTSQLLNWLEE-AGEEVENLQKATVGKMIDTLDDGK-AKRVLEIRQELSK 289

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           +++ K   + EA+  D R+RG LQFYGA+RTGR++G + Q QNLPR       + + +  
Sbjct: 290 TSVKKYKAMDEAMCKDERVRGLLQFYGANRTGRYAGRLVQVQNLPRNYIETLDVARDVIK 349

Query: 347 LNRGETIADPLGLASDC----VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF 402
              GE +    G   D     +R+  I S G   VV+D + IEARV+AW+AGE+W+++ F
Sbjct: 350 KGDGELLEMLYGNIPDTLSQLIRTAFIPSEGNHFVVSDFSAIEARVIAWLAGEEWRMEVF 409

Query: 403 ANGEDIYVTTYAKAFNTPIDKVSKEQ-----RAIGKVMELALGYQGGAKVFKTM-ASHCG 456
                IY  + ++ F  PI+ ++K +     RA GKV ELALGYQG       M A+  G
Sbjct: 410 KTHGKIYEASASQMFGVPINTIAKGEENYHLRAKGKVAELALGYQGSVGALTAMGAADMG 469

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           L  ++                       M+D                  +   WR   + 
Sbjct: 470 LTDEE-----------------------MKD------------------IVDRWRKSSKR 488

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIV-LPSSRRLVY----- 570
           +++LW  L E  A  V E G     +   + +     + +D   + LPS R+L Y     
Sbjct: 489 IVELWYAL-ENAAVEVLETGEPQIVKCVKLAKEYDFIYGQDFFTIELPSGRKLFYPKPFL 547

Query: 571 -----SDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIV 625
                  ++     +N  T +     TYGGKLTENIVQAI+RD L E +      G+ IV
Sbjct: 548 KENQFGQMQMHYMGINQTTKKWEVIPTYGGKLTENIVQAIARDCLAETLLRVKAKGWPIV 607

Query: 626 LTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             VHDEI+ + P +    +  +   MT+  SWAKGL L A G+    Y K
Sbjct: 608 FHVHDEIILDVPKS--VELEEVIKTMTEEISWAKGLILNAAGFTGSYYMK 655


>gi|167757895|ref|ZP_02430022.1| hypothetical protein CLOSCI_00226 [Clostridium scindens ATCC 35704]
 gi|167664549|gb|EDS08679.1| hypothetical protein CLOSCI_00226 [Clostridium scindens ATCC 35704]
          Length = 645

 Score =  278 bits (710), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 222/715 (31%), Positives = 326/715 (45%), Gaps = 114/715 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ YA      + L  YA D   V + D      +P + +
Sbjct: 4   MRTLSIDIETYSDVDLSKCGVYKYASSPAFEVLLFGYAADGGDVHVVDLACGEQIPEEAI 63

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D +V     N++ ER+     LG  +  + W CT V + T GLP SL++A  AL  
Sbjct: 64  SALSDTSVTKWTFNAMLERVCLSNFLGEWLEPEGWYCTMVWSATLGLPLSLESAGAALGL 123

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN---------HV-QAWQLFGEYCKRDVE 168
            +   K+ EGK LI  FC       P   T+AN         H  + W+ F  Y  RDVE
Sbjct: 124 EKQ--KLTEGKDLIRYFCV------PCRPTKANGGRTRNRPEHAPEKWERFKAYNLRDVE 175

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
              ++ KRL   P+ D   + + LDQ INDRG  +D++LV +   +  + R++L   + +
Sbjct: 176 TEMQIQKRLSNFPVPDAIWEEYHLDQEINDRGIGVDMELVRQAIAIDTRSRERLTAAMRE 235

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAK-------DLIL 279
           LT+  + +      ++ +L             G     L    + +L K       +++ 
Sbjct: 236 LTE--LENPNSAQQMKQWL----------ADHGLETDTLGKKAVAELVKTAPEPLREVLS 283

Query: 280 NRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ------ 333
            R   + S++ K   +  AV +D R  G  QFYGA+RTGR+SG + Q QNLP+       
Sbjct: 284 LRQQLAKSSVKKYTAMENAVCADSRAHGMFQFYGANRTGRFSGRLIQLQNLPQNHMGDLA 343

Query: 334 ERSEEILTQTIQALN-RGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
           E    + +   +AL+   E I D L   S  +R+  +  +G+K +VAD + IEARV+AW 
Sbjct: 344 EARALVRSGNYEALSVLYEDIPDTL---SQLIRTAYVPQDGRKFIVADFSAIEARVIAWF 400

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKT 450
           AGE W++K F +G DIY  + ++ F+ P++K  V+   R  GK+ ELALGY G     K+
Sbjct: 401 AGERWRLKVFEDGGDIYCASASQMFHVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKS 460

Query: 451 MASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
           M                                         A++  L     + +  AW
Sbjct: 461 MG----------------------------------------ALEMGLAEEELQPLVDAW 480

Query: 511 RAKHQGVLQLWKDLTEGFA-CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLV 569
           R  +  + Q W D+      C+ Q       R       L        + I LPS RRL 
Sbjct: 481 RGSNPMITQFWWDVDRAVKDCIRQ-------RIPTETHGLRFDYRSAMLFINLPSGRRLA 533

Query: 570 Y-------SDVKGD-CSYLN-TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN 620
           Y       +   G+  +Y+  + T +  R  +YG K  ENIVQ  +RDILC  M+  T  
Sbjct: 534 YVKPRIGENQFGGESVTYMGVSGTKKWERLESYGPKFVENIVQGTARDILCYAMQ--TLK 591

Query: 621 GYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
              IV  VHDEI+ E       SV  +C  M + P WAKGL L+A+GYE + Y+K
Sbjct: 592 NCSIVAHVHDEIIIEADRR--MSVAAVCEQMGRTPPWAKGLKLRADGYECEFYQK 644


>gi|268610175|ref|ZP_06143902.1| family A DNA-dependent DNA polymerase [Ruminococcus flavefaciens
           FD-1]
          Length = 654

 Score =  278 bits (710), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 222/716 (31%), Positives = 338/716 (47%), Gaps = 104/716 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +L IDIET S + + + GV+ YAE     + L +Y+ D  PV   D      +P ++L
Sbjct: 1   MKQLTIDIETASDEDISECGVYRYAESEYFDLLLVSYSIDGGPVATVDIDSGDTLPDEIL 60

Query: 59  QYLRDETVMCVAHNSLFERIL--------------FKKTLGIDIPSKRWICTSVLARTNG 104
             L D++V+  A N  FER+               F+  +G  I  + W C  + +R  G
Sbjct: 61  SALTDKSVIKKAFNVNFERVCLSVYLRRNYPEIAGFEDAVGNYIAPESWHCDMIHSRYLG 120

Query: 105 LPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPP----YDCTRANHVQAWQLFG 160
           + SSL +  +         K++EGK LI  FC    D       YD  +++  + W+ F 
Sbjct: 121 MMSSLDD--MGKLLRLKEKKLDEGKDLIKYFCTLHQDKQGNLLFYD--KSDAPKKWKEFI 176

Query: 161 EYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           EY +RDVE   ++ + L  +P+ D   + + +DQ INDRG  +D     K  EL +  +K
Sbjct: 177 EYNRRDVEVELKIQRLLSEMPVPDFIWEEFYIDQRINDRGILVDTKFAEKAVELDSNVKK 236

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLI-TGIDLVDMSEGTLKSILSHSNITQLAKDL 277
           +L   + +LT    R        +M  +L+  GI+   + + ++  +L+ +      K++
Sbjct: 237 ELFPKLKELT----RLDNPNSPAQMKDWLMRQGIEADSLDKKSMPLLLASA--PDDVKEV 290

Query: 278 ILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSE 337
           ++     S S++ K +T+  A   DGR RG   FYGA+RTGR++G + Q QNLP+     
Sbjct: 291 LMLYQQLSKSSVSKYHTMLGASCKDGRARGMFNFYGANRTGRFAGRIIQLQNLPQNHLDN 350

Query: 338 EILTQTIQALNRG------ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
             L +T   +  G      E   D   + S  +R+  I   GKK VVAD + IEARV++W
Sbjct: 351 --LAETKWLIKSGDLDAVKERFEDIPDVLSQLIRTAFIPPEGKKFVVADFSAIEARVISW 408

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFK 449
           +AGE W+++AFANGEDIY    AK F  P++K  V+   R  GK+ ELA GY G     K
Sbjct: 409 LAGETWRMEAFANGEDIYCACAAKMFGVPVEKNGVNGHLRQKGKIAELACGYGGSIGAIK 468

Query: 450 TMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKA 509
            M                                       E  + D  + +  E     
Sbjct: 469 AMGG------------------------------------TELNLTDDELYSLVE----D 488

Query: 510 WRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLV 569
           WR     +++LW D+      V+ +  S++  R+     + +      + I LPS RRL 
Sbjct: 489 WRKTSPNIVKLWSDVQSVAVKVITDQSSMTFGRLKFSYEIGI------LFIELPSGRRLA 542

Query: 570 Y--------SDVKGDCSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKN 620
           Y         + K   +Y     + + +R  TYG KL ENI Q I+RD+L   M  A   
Sbjct: 543 YVRPKVEKDDNGKTIITYEGVGDNKKWLRLETYGAKLVENITQGIARDLLLHSM--AAMK 600

Query: 621 GYDIVLTVHDEIVSE-TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             DIV  VHDE++ E  PDT   +V  +C LM + P WA+GL L+A+GYE + Y K
Sbjct: 601 DMDIVGHVHDEVIVECDPDT---TVVQVCHLMEQTPDWAEGLLLRADGYECEFYMK 653


>gi|300909464|ref|ZP_07126925.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
 gi|300893329|gb|EFK86688.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
          Length = 644

 Score =  278 bits (710), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 216/711 (30%), Positives = 333/711 (46%), Gaps = 104/711 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M ++ IDIET S   L + GV+ YA+     + L  YA D  PVK+ D T+   +P  ++
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSDDFELLLFGYATDFGPVKVVDLTQGEKIPPQII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L +  ++  A N+ FER+   + +G  +    W C+ V + T GLP SL++    L  
Sbjct: 61  EVLDNPNIIKSAFNAQFERVCLSRFVGHRLKPTGWHCSRVWSATLGLPLSLRDIGSVLGL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
                K+  GK L+  FC       P   T+AN  +           WQ F +Y +RDVE
Sbjct: 121 PRQ--KITAGKELVRYFCT------PCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDED 223
              E+ ++L   P+   E + + +DQ INDRG RID  LV   +K Q +   +  +  ++
Sbjct: 173 VEMEITQKLECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKE 232

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  L +           L+ +L    GI    +S+ ++  +L  +  T + + L L +L 
Sbjct: 233 LTGLAN-----PNSPLQLKDWL-QQQGIKTNSLSKASVAQLLQTTTGT-VHQVLALRQLL 285

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ-----ERSEE 338
           S  S++ K   + +A+  DGR+ G LQFYGA+RTGRW+G + Q QNLPR      E + E
Sbjct: 286 SK-SSVKKYQAMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARE 344

Query: 339 ILTQ-TIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           ++ Q  + AL    +++ D L   S  +R+  I S      VAD + +EARV+AW++ E 
Sbjct: 345 LVKQGNVPALAMLYDSVPDVL---SQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEK 401

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTM-AS 453
           W+ ++FA  EDIY  + ++ F  P+ K  ++ E R  GK+ ELALGY G     K M A+
Sbjct: 402 WRQESFAKNEDIYCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGAT 461

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             GL                             D+ P                 + WR  
Sbjct: 462 KLGL---------------------------TDDELPPLV--------------QMWRNA 480

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
              ++Q W D+ +      +E       +  +  + + R     + + L S R L Y   
Sbjct: 481 SPHIVQFWWDVDKA----AKECIKTHLPQTTHGMKFIYRSGC--MFLRLRSGRYLCYPQP 534

Query: 574 KGDCSYLNTATSQLM---------RERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           K   +   + +   M         R  TYG KL ENIVQA SRD+L E M+     G  +
Sbjct: 535 KIGINRFGSESITFMGINTVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEATGNTV 594

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V+ +HDE V + P     S+ T+  LMTK P WA GL L A G+ +  Y+K
Sbjct: 595 VMHIHDEAVIDAPFNR--SLDTMVQLMTKVPDWANGLILNAAGFVSDFYKK 643


>gi|227872576|ref|ZP_03990912.1| DNA-directed DNA polymerase [Oribacterium sinus F0268]
 gi|227841577|gb|EEJ51871.1| DNA-directed DNA polymerase [Oribacterium sinus F0268]
          Length = 643

 Score =  277 bits (709), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 227/713 (31%), Positives = 334/713 (46%), Gaps = 109/713 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K G + YA  EQ  I L AY++D E V++ D      +P  +L
Sbjct: 1   MRHLSIDIETFSDIDIQKAGAYRYAQSEQFRIMLFAYSFDGEEVQVVDLENGEEIPHFIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L+D  V+  A+N+ FE        GI  P  +W CT V A    LP+ L N   AL  
Sbjct: 61  TALQDMEVIKHAYNAAFEWYCLN-CAGIKTPLDQWQCTMVHAMYLSLPAGLANTGEALGI 119

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL- 177
           +E   K   GK LI  FC       PY   + + V+ W+ F EY ++DV +  E+  RL 
Sbjct: 120 AEDKKKSAVGKQLIRYFC-----VKPY---KPDAVK-WKAFKEYNRQDVVSEMEIENRLS 170

Query: 178 -IPLSDGERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDEDIVKLTDGIIR 233
             P+ + E + W  D  +N  G ++D +LV   +K+QE   Q  ++L  + V+LT   + 
Sbjct: 171 GFPVPELEWERWRQDIAMNAYGVKVDTELVNGAIKIQE---QCEEELLNEAVRLTQ--LE 225

Query: 234 SSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLN 293
           +      L  ++    G  L +  + T++S L      ++ + L + R     +++ K  
Sbjct: 226 NPNSPTQLLNWVN-AQGYPLENTQKATIESALKEDLPLKVRRVLEI-RQQLGKTSVKKYE 283

Query: 294 TLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE-- 351
            ++  +    R+RG  QFYGAS+TGR+SG + Q QNLPR     E L +T + + R +  
Sbjct: 284 AMTNTIGEGDRVRGISQFYGASKTGRFSGRLVQMQNLPRNYL--EPLAETRECVKRQDYE 341

Query: 352 -------TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
                  +I D L   S  +R+  I S G + VVAD + IEARV+AW+A E W  + FA 
Sbjct: 342 TLKLLFDSIPDTL---SQLIRTAFIPSTGNQFVVADFSAIEARVIAWLAKETWVQEVFAT 398

Query: 405 GEDIYVTTYAKAFNTPIDKVSKEQ-----RAIGKVMELALGYQGGAKVFKTMAS-HCGLD 458
              IY  T ++ F+ PI+K++K       R  GKV  LALGYQGG     +M +   GL 
Sbjct: 399 HGKIYEATASQMFHVPIEKIAKGNPEYALRQKGKVATLALGYQGGTNALISMGALKMGLS 458

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                      +++ PE   +              WRA +Q ++
Sbjct: 459 ---------------------------EEELPEIVTR--------------WRAANQRIV 477

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHK------RDVHIVLPSSRRLVY-- 570
            LW  +       V++G      R   V  L+ R  +      R + I LPS R+L Y  
Sbjct: 478 ALWSAVGSYALRTVRDG------RARQVNGLIFRMEQDLKHGLRFLTIELPSKRKLFYCK 531

Query: 571 -----SDVKGDCSYL---NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGY 622
                +   G+  Y    N  T +     T+GGKL ENIVQ I+RD LCE +   T  GY
Sbjct: 532 PYIGLNQFGGESLYFYTQNQTTKKWEESSTFGGKLVENIVQGIARDCLCETLDRITSKGY 591

Query: 623 DIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            IV  VHDE++ +       +V  LC +M +   WAKGL LK  G+  + Y+K
Sbjct: 592 RIVFHVHDEVIVDAGMD--LTVEELCGIMAEPIPWAKGLILKGAGFSGQFYQK 642


>gi|293401134|ref|ZP_06645278.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305260|gb|EFE46505.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 646

 Score =  276 bits (706), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 227/717 (31%), Positives = 332/717 (46%), Gaps = 114/717 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   LPK GV+ Y E     I L AY+ D +PV++ D      +P +++
Sbjct: 1   MKTLSIDIETYSDVQLPKTGVYRYCESDNFEILLFAYSIDSQPVQVVDLACGETIPEEII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L D+TV+  A N+ FERI   + LG      +  + W C+ + A T GLP SL+    
Sbjct: 61  AALEDDTVIKWAFNAAFERICLSRFLGYPTGTYLSPESWRCSMIWAATMGLPLSLEGVGA 120

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCK 164
            L   +   K+ EGK LI  FC+      P   T+AN  +           W+ F  Y  
Sbjct: 121 VLGLEKQ--KLTEGKDLIKYFCQ------PCAATKANGGRTRNRPFHAPDKWEAFKRYNI 172

Query: 165 RDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
           RDVE    +  +L   P+ +   + + +DQ INDRG R+D++LV +   +  + R++L  
Sbjct: 173 RDVETEMGIQHKLRKFPVPNEVWEEYHIDQEINDRGVRLDMELVSQAIAMDTRSREELTA 232

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
            I  +T+  + +      ++ +L    GI+   + +  +  +L  +    LA D++  R 
Sbjct: 233 AIKDMTE--LENPNSVQQMKQWLS-DNGIETDSLDKKAVAELLKDAP-DNLA-DVLTLRQ 287

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
             + S++ K   + + V SDGR RG  QFYGA+RTGR+SG   Q QNLP+    +  L++
Sbjct: 288 QLAKSSVRKYQAMEKTVCSDGRARGMFQFYGANRTGRFSGRNIQLQNLPQNHLPD--LSE 345

Query: 343 TIQALNRG---------ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
               +  G         E + D L   S  +R+  I        VAD + IEARV+AW A
Sbjct: 346 ARSLVRSGDFDGVELLYEDVPDTL---SQLIRTAFIPRENALFYVADFSAIEARVIAWFA 402

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTM 451
           GE W+ + F  G DIY  + ++ F  P++K  ++   R  GK+ ELALGY G     K M
Sbjct: 403 GESWRQQVFEKGGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAM 462

Query: 452 AS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHL---WMQDQYPEFAVKDKLIGTACELVK 507
            +   GL+ ++    V +      W QA    +   W  D+    AVK K   T      
Sbjct: 463 GALDMGLNEEELPALVDA------WRQANPRIVEFWWAVDRAVMEAVKYKHTTT------ 510

Query: 508 KAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRR 567
                          D    F+C   + G +                     I LPS R+
Sbjct: 511 ---------------DYGLTFSC---KSGML--------------------FITLPSGRK 532

Query: 568 LVYSDVK-------GDC-SYLNT-ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
           L Y   K       G C +Y     T +  R  +YG K  ENIVQA +RDILC  MK  T
Sbjct: 533 LAYVKPKIGTNKFGGSCITYEGVGGTKKWERLDSYGPKFVENIVQATARDILCYAMK--T 590

Query: 619 KNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                IV+ +HDE+V E    P  S+  +C  M + P WAKGL L+A+GY    Y+K
Sbjct: 591 LRCCSIVMHIHDELVIEA--DPKVSLDAICEQMGRTPPWAKGLLLRADGYTTPFYKK 645


>gi|220930221|ref|YP_002507130.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
 gi|220000549|gb|ACL77150.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
          Length = 647

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 220/711 (30%), Positives = 324/711 (45%), Gaps = 104/711 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           ++ L +D+ET S   L K GV+ YAE     I L  Y+ D   V++ D      +P +++
Sbjct: 4   INSLSLDLETYSSVNLQKSGVYRYAESDDFEILLFGYSVDSGEVQVVDLAGGEEIPDEII 63

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D++V   A N++FER+   K L +   +    W C+ V +   GLP SL+     L
Sbjct: 64  NALMDDSVTKWAFNAMFERVCLSKWLNLTEYLDPASWKCSMVWSAYMGLPLSLEGVGAVL 123

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRD 166
              +   K+ EGK LI  FC       P   T++N           +  W+ F  Y  RD
Sbjct: 124 GLEKQ--KLTEGKDLIKYFCT------PCSPTKSNGGRVRNLPEHDMDKWERFKVYNIRD 175

Query: 167 VEATRELFKRLIPLSDGERDLW---LLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           VE+   + +RL      E ++W    LDQ INDRG  ID+  V +  E+    R+KL   
Sbjct: 176 VESEMLIQQRLSKFQVPE-NIWKEYHLDQVINDRGIAIDMTFVKQAVEMDEHSREKL--- 231

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLI-TGIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
            + L   I          +M  +L   G++   + +  +  +L  +    L   L L R 
Sbjct: 232 -IALMQDITNLENPNSVQQMKDWLADNGLETDSLGKKVVAEMLKTAP-EPLGTVLEL-RQ 288

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
             + S++ K   +  AV SDGR RG  QFYGA+RTGR+SG + Q QNLP+    +  L Q
Sbjct: 289 QLAKSSVKKYTAMENAVCSDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPD--LEQ 346

Query: 343 TIQALNRGETIADPL------GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
               +  G   A  L       + S+ +R+  I   G K +VAD + IEARV+AW+AGE 
Sbjct: 347 ARALVRSGNFDALTLLYDSIPEVLSELIRTAFIPREGMKFIVADFSAIEARVIAWLAGEK 406

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMAS- 453
           W++  F  G DIY  + ++ FN P++K  V+   R  GK+ ELALGY G     K+M + 
Sbjct: 407 WRLNVFQKGGDIYCASASQMFNVPVEKHGVNGHLRQKGKIAELALGYGGAVGALKSMGAL 466

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G++ ++    V                                          AWR  
Sbjct: 467 EMGIEEEELQPLV-----------------------------------------TAWRQS 485

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           +  + +LW D+       V++    +   +  + +  M      + IVLPS RRL Y   
Sbjct: 486 NPNITKLWWDVDRAVKTCVKQKTPTATHGIKFIYQSGM------LFIVLPSGRRLAYVKP 539

Query: 574 KGDCSYLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           +   +   +          T +  R  +YG K  ENIVQAISRDILC  M+  T     I
Sbjct: 540 RMGENMFGSESVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILCHAMQ--TLKNCSI 597

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDEI+ E       S+  +C  M K P+WA GL L A+GYE + Y+K
Sbjct: 598 VAHVHDEIIIEADMG--MSLSAICEQMAKTPTWANGLLLSADGYECQFYQK 646


>gi|331083931|ref|ZP_08333040.1| hypothetical protein HMPREF0992_01964 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330403356|gb|EGG82916.1| hypothetical protein HMPREF0992_01964 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 646

 Score =  275 bits (702), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 220/713 (30%), Positives = 322/713 (45%), Gaps = 106/713 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y E     I L  Y+ D   VK+ D      +P ++ 
Sbjct: 1   MKNLEIDIETYSSANLSKSGVYRYVESPDFEIILFGYSIDGGEVKVVDLACGETIPKEVY 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L D++V   A N+ FERI   K LG      +    W C+ V +   GLP SL+   +
Sbjct: 61  DALEDDSVTKWAFNAQFERICLSKFLGYKQGTYLEPDSWKCSMVWSAYMGLPLSLEGVGV 120

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCK 164
            L   +   K+ EGK LI  FC       P + T+ N            + W+ F  Y  
Sbjct: 121 VLGLEKQ--KLTEGKELIKYFCT------PCNPTKVNGGRMRNLPHHDTEKWERFKAYNI 172

Query: 165 RDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
           RDVEA  ++  RL   P+ D   D + LDQ INDRG ++D+D V K  E+    R+ L  
Sbjct: 173 RDVEAEMQIQSRLQKFPVPDFVWDEYHLDQEINDRGIKVDMDFVEKCLEIDNVSRESLMT 232

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
            +  LT   + +      ++ +L    GI+   + +  + +++    +     +++  R 
Sbjct: 233 KMQVLTS--LTNPNSVVQMKGWL-SDNGIETETLGKKAVAALIDE--VPDEMSEILALRQ 287

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
             + S++ K   +  +V  DGR+RG  QFYGA+RTGR++G + Q QNLP+     E L +
Sbjct: 288 KLAKSSVRKYQAMQNSVCEDGRVRGMFQFYGANRTGRFAGRLVQLQNLPQNHM--EDLAE 345

Query: 343 TIQALNRGETIADPLGLASD--------CVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
               +  G+   D L L  D         +R+  I +  +  +VAD + IEARV+AW AG
Sbjct: 346 ARGLVRSGDY--DSLDLLYDDIPDTLSQLIRTAFIPTVNESFIVADFSAIEARVIAWFAG 403

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           E W+   FA G DIY  + ++ F  P++K  V+   R  GK+ ELALGY G     K M 
Sbjct: 404 ESWRADVFAKGGDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSTGALKAMG 463

Query: 453 S-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
           +   GL                            +++ PE                 AWR
Sbjct: 464 ALEMGL---------------------------AEEELPELV--------------SAWR 482

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY- 570
             +  +++ W D+       ++   S +   V    R  M      + I LPS R L Y 
Sbjct: 483 CSNPNIVRFWWDVDSAVKKAIKSKTSTATHGVHFSCRSGM------LFITLPSGRVLSYV 536

Query: 571 SDVKGDCSYLNT--------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGY 622
               G+  +           +T +  R  +YG K  ENIVQA SRDIL   MK  T    
Sbjct: 537 KPCMGENKFGGESVTYEGVGSTKKWERLESYGPKFVENIVQATSRDILMYAMK--TLRCC 594

Query: 623 DIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            IV  VHDEI+ E    P  S+  +C  M + P WA+GL L+A+GYE + Y+K
Sbjct: 595 SIVAHVHDEIIIEA--DPRMSLDAICEQMGRTPPWAEGLLLRADGYECQFYKK 645


>gi|256847832|ref|ZP_05553277.1| DNA polymerase I [Lactobacillus coleohominis 101-4-CHN]
 gi|256715521|gb|EEU30497.1| DNA polymerase I [Lactobacillus coleohominis 101-4-CHN]
          Length = 644

 Score =  275 bits (702), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 216/711 (30%), Positives = 332/711 (46%), Gaps = 104/711 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +L IDIET S   L + GV+ YA+     + L  YA D  PVK+ D T+  ++P  ++
Sbjct: 1   MKQLSIDIETYSNTNLNQTGVYRYADSKDFELLLFGYAIDFGPVKVIDLTQGESIPPQVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D T++  A N+ FER+   + +   +    W C+ V + T GLP SL++    L  
Sbjct: 61  KALDDPTIIKSAFNAQFERVCLSRFVSHRLKPAGWHCSRVWSATLGLPLSLRDVGTVLGL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
                K+  GK L+  FC       P   T+AN  +           WQ F +Y +RDVE
Sbjct: 121 PRQ--KITAGKELVRYFCT------PCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDED 223
              E+ ++L   P+   E + + +DQ INDRG RID  LV   +K Q +   +  +  + 
Sbjct: 173 VEMEITQKLECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKK 232

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  L +           L+ +L    GI    +S+ ++  +L  +  T + + L L +L 
Sbjct: 233 LTGLAN-----PNSPLQLKDWLHQ-QGIKTDSLSKASVAQLLQTTTGT-VHQVLALRQLL 285

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ-----ERSEE 338
           S  S+I K   + +A+  DGR+ G LQFYGA+RTGRW+G + Q QNLPR      E + E
Sbjct: 286 SK-SSIKKYQAMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARE 344

Query: 339 ILTQ-TIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           ++ Q  + AL    +++ D L   S  +R+  I S      VAD + +EARV+AW++ E 
Sbjct: 345 LVKQGNVPALAMLYDSVPDVL---SQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEK 401

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTM-AS 453
           W+ ++FA  EDIY  + ++ F  P+ K  ++ E R  GK+ ELALGY G     K M A+
Sbjct: 402 WRQESFAKNEDIYCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGAT 461

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
           + GL                             D+ P                 + WR  
Sbjct: 462 NLGL---------------------------TDDELPPLV--------------QMWRNA 480

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
              ++Q W D+ +      +E       +  +  + + R     + + L S R L Y   
Sbjct: 481 SPHIVQFWWDVDKA----AKECIKTHLPQTTHGMKFIYRSGC--MFLRLRSGRYLCYPQP 534

Query: 574 KGDCSYLNTATSQLM---------RERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           K   +   + +   M         R  TYG KL ENIVQA SRD+L   M+     G  +
Sbjct: 535 KIGINRFGSESITFMGNNTVKKWDRIETYGAKLVENIVQATSRDLLAGAMRRLETAGNPV 594

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V+ +HDE V + P     S+ T+  +MT+ P WA GL L A G+    Y+K
Sbjct: 595 VMHIHDEAVIDAPTDR--SLDTIVKIMTEVPDWADGLILNAAGFVGGFYKK 643


>gi|227530261|ref|ZP_03960310.1| DNA-directed DNA polymerase [Lactobacillus vaginalis ATCC 49540]
 gi|227349815|gb|EEJ40106.1| DNA-directed DNA polymerase [Lactobacillus vaginalis ATCC 49540]
          Length = 644

 Score =  273 bits (699), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 215/711 (30%), Positives = 333/711 (46%), Gaps = 104/711 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M ++ IDIET S   L + GV+ YA+     + L  YA D  PVK+ D T+  ++P  ++
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSKDFELLLFGYAIDFGPVKVIDLTQGESIPPQVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D T++  A N+ FER+   + +   +    W C+ V + T GLP SL++    L  
Sbjct: 61  KALDDPTIIKSAFNAQFERVCLSRFVSHRLKPAGWHCSRVWSATLGLPLSLRDVGSVLGL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
                K+  GK L+  FC       P   T+AN  +           WQ F +Y +RDVE
Sbjct: 121 PRQ--KITAGKELVRYFCT------PCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDED 223
              E+ ++L   P+   E + + +DQ INDRG RID  LV   +K Q +   +  +  ++
Sbjct: 173 VEMEITQKLECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKE 232

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  L +           L+ +L     I    +S+ ++  +L  +  T + + L L +L 
Sbjct: 233 LTGLAN-----PNSPLQLKDWL-QQQDIKTNSLSKASVAQLLQTTTGT-VHQVLALRQLL 285

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ-----ERSEE 338
           S  S+I K   + +A+  DGR+ G LQFYGA+RTGRW+G + Q QNLPR      E + E
Sbjct: 286 SK-SSIKKYQAMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARE 344

Query: 339 ILTQ-TIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           ++ Q  + AL    +++ D L   S  +R+  I S      VAD + +EARV+AW++ E 
Sbjct: 345 LVKQGNVPALAMLYDSVPDVL---SQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEK 401

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTM-AS 453
           W+ ++FA  EDIY  + ++ F  P+ K  ++ E R  GK+ ELALGY G     K M A+
Sbjct: 402 WRQESFAKNEDIYCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGAT 461

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
           + GL                             D+ P                 + WR  
Sbjct: 462 NLGL---------------------------TDDELPPLV--------------QMWRNA 480

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
              ++Q W D+ +      +E       +  +  + + R     + + L S R L Y   
Sbjct: 481 SPHIVQFWWDVDKA----AKECIKTHLPQTTHGMKFIYRSGC--MFLRLRSGRYLCYPQP 534

Query: 574 KGDCSYLNTATSQLM---------RERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           K   +   + +   M         R  TYG KL ENIVQA SRD+L E M+        +
Sbjct: 535 KIGINRFGSESITFMGNNTVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEATENTV 594

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V+ +HDE V + P     S+ T+  LMT+ P WA GL L A G+ +  Y+K
Sbjct: 595 VMHIHDEAVIDAPSNR--SLDTMVQLMTEVPDWANGLILNAAGFVSDFYKK 643


>gi|313896425|ref|ZP_07829976.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312974849|gb|EFR40313.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 650

 Score =  273 bits (697), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 219/719 (30%), Positives = 337/719 (46%), Gaps = 114/719 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L ID+ETRS   + K GV+ YAE     I L  Y+ D   V++ D      +P ++L
Sbjct: 1   MESLSIDLETRSSVDIGKSGVYRYAEAEDFAILLFGYSVDGGAVQVIDIANGEQIPQEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKK---TLGIDI-----------------PSKRWICTSV 98
             L DE+V+  A N+ FER+   +    LGI +                     W CT V
Sbjct: 61  DALTDESVIKWAFNANFERVCLSRYLSDLGIALDPFHDNHPLSTECARFLSPHSWRCTMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPY-DCTRANHVQAWQ 157
            +   GLP SL      L   E   KM EGKALI  F      +PP+ + T A     W 
Sbjct: 121 WSAYMGLPLSLAGVGRVLGLEEQ--KMNEGKALIRYF-----STPPFHEPTGAK----WD 169

Query: 158 LFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQ 215
           LF  Y +RDVE    + KRL   P+     + ++LDQ INDRG R+D+ LV    ++  +
Sbjct: 170 LFKSYNRRDVEVEMAIQKRLSKYPVPQSVWEEYVLDQEINDRGIRLDMPLVENAVQIDVR 229

Query: 216 ERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAK 275
            ++KL + +  LT   + +      ++ +L    G++   + + ++ ++L+  N+    K
Sbjct: 230 TKEKLTDRLKTLTS--LENPNSVTQMKAWL-KEQGVETESLDKKSVTALLA--NVPDPLK 284

Query: 276 DLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ-- 333
           +++  R   + S++ K   +   V SDGR RG  QFYGA+RTGR+SG   Q QNLP+   
Sbjct: 285 EVLELRQQLAKSSVKKYQAMQNTVCSDGRARGMFQFYGANRTGRFSGRHIQLQNLPQNHL 344

Query: 334 ---ERSEEILTQ-TIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARV 388
              E +  ++ Q +  AL    E++ D L   S  +R+  I+  G+K +VAD + IEARV
Sbjct: 345 ADLEYARSLVRQGSFAALELLYESVPDVL---SQLIRTAFISKEGRKFIVADFSAIEARV 401

Query: 389 LAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAK 446
           L+W+A E W++  FAN  DIY  T  + F+  + K  +    R  GK+ EL+ GY G   
Sbjct: 402 LSWLAKERWRMDVFANDGDIYCATAGRMFHCNVVKHGENGHLRQYGKLAELSSGYGGSVG 461

Query: 447 VFKTMAS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACEL 505
             K   +   G+  ++ +  V                                       
Sbjct: 462 ALKAFGALESGMKEEELNPLV--------------------------------------- 482

Query: 506 VKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSS 565
              AWRA +  ++  W  +       ++E     + +V +  R + +     + I LP  
Sbjct: 483 --DAWRAANPNIVDFWWAVDRATKDCIKE----RSTKVTHGIRFIYQGSM--MFIELPCG 534

Query: 566 RRLVYSDVK-GDCSYLNTATSQL--------MRERTYGGKLTENIVQAISRDILCEGMKN 616
           RRL Y   + G+  +   + + +         R  +YG KL EN+ QAISRDILC  M+ 
Sbjct: 535 RRLAYVKPRIGENQFGGESVTYMGLNLSKKWARIESYGPKLVENVTQAISRDILCYAMQ- 593

Query: 617 ATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            T    DIV  VHDE++ E  +    S+  +C  M + P WA GLPL+A+G+E + Y+K
Sbjct: 594 -TLRTMDIVAHVHDELIIECDER--VSLSAICEQMARTPPWADGLPLRADGFECQFYQK 649


>gi|300909419|ref|ZP_07126880.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
 gi|300893284|gb|EFK86643.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
          Length = 644

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 211/710 (29%), Positives = 326/710 (45%), Gaps = 102/710 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +L IDIET S   L + G + YA+     + L  YA D  PVK+ D T+   +PS ++
Sbjct: 1   MKQLSIDIETYSSTNLNQTGGYRYADSDDFELLLFGYAVDFGPVKVVDLTQGEKIPSQII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           Q L D  ++  A N+ FER+   + +G  +    W C+ V + T GLP SL++    L  
Sbjct: 61  QALDDPAIIKSAFNAQFERVCLSRFVGHRLKPAGWHCSRVWSATLGLPLSLRDVGTVLGL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
                K+  GK L+  FC           T+AN  +           WQ F +Y +RDVE
Sbjct: 121 PRQ--KITAGKELVRYFCTSC------KPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDED 223
              E+ ++    P+   E + + +DQ INDRG RID  LV   +K Q+    +  +  + 
Sbjct: 173 VEMEITQKFSRFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQKEFHAQYLQTSQQ 232

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  L +           L+ +L    G++   +++ ++  +L  +  T + + L L +L 
Sbjct: 233 LTGLAN-----PNSPLQLKNWLHQ-QGVETDSLAKASVAQLLQTTTGT-VHQVLALRQLL 285

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
           S  S++ K   + +A+  DG + G LQFYGA+RTGRW+G + Q QNLPR    +  L + 
Sbjct: 286 SK-SSVKKYQAMQKAMCKDGCVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPD--LEEA 342

Query: 344 IQALNRGETIADPL------GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
              + +G T A  +       + S  +R+  I S G    VAD + +EARV+AW++GE+W
Sbjct: 343 RALVKQGNTTALAMLYESVPDVLSQLIRTAFIPSKGHHFYVADFSAVEARVIAWLSGEEW 402

Query: 398 KIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTM-ASH 454
           +  AFA  EDIY  + ++ F  P+ K  ++ E R  GK+ ELALGY G     K M A+ 
Sbjct: 403 RQAAFAKNEDIYCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGATK 462

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            GL                             D+ P                 + WR   
Sbjct: 463 LGL---------------------------TDDELPPLV--------------QMWRNAS 481

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
             ++Q W D+ +      +E       +  +  + + R     + + L S R L Y   K
Sbjct: 482 PHIVQFWWDVDKA----AKECIKTHLPQTTHGMKFIYR--SGCMFLRLRSGRYLCYPQPK 535

Query: 575 GDCSYLNTATSQLM---------RERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIV 625
              +   + +   M         R  TYG KL ENIVQA SRD+L   M+     G  +V
Sbjct: 536 IGINRFGSESITFMGNNTVKKWDRIETYGAKLVENIVQATSRDLLAGAMRRLETAGNPVV 595

Query: 626 LTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           + +HDE V + P     S+ T+  +MT+ P WA GL L A G+    Y+K
Sbjct: 596 MHIHDEAVIDAPTDR--SLDTIVKIMTEVPDWADGLILNAAGFVGGFYKK 643


>gi|42779458|ref|NP_976705.1| DNA polymerase I [Bacillus cereus ATCC 10987]
 gi|42735374|gb|AAS39313.1| DNA polymerase I [Bacillus cereus ATCC 10987]
          Length = 644

 Score =  271 bits (693), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 222/712 (31%), Positives = 326/712 (45%), Gaps = 106/712 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M+ + IDIET S   L K GV+ YAE     I L  Y+ D   V++ D      +P +++
Sbjct: 1   MNSISIDIETFSGANLQKSGVYRYAESDDFEILLFGYSVDGGEVQVVDLACGEEIPDEII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D++V   A N++FER+   K L +   +    W C+ + +   GLP SL+     L
Sbjct: 61  NALLDDSVTKWAFNAMFERVCLSKWLNLTEYLDPASWKCSMIWSAYMGLPLSLEGVGAVL 120

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRD 166
              +   K+ EGK LI  FC       P   T++N           +  W+ F  Y  RD
Sbjct: 121 GLEKQ--KLTEGKDLIKYFCT------PCSPTKSNGGRVRNLPEHDMDKWERFKAYNLRD 172

Query: 167 VEATRELFKR----LIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
           VEA   + +R    L+P +  E   + LDQ INDRG  ID+  V   Q ++  E  +  E
Sbjct: 173 VEAEMSIQQRFSKFLVPENIWEE--YHLDQEINDRGIAIDMTFVK--QAVVMDEHSR--E 226

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLI-TGIDLVDMSEGTLKSILSHSNITQLAKDLILNR 281
            ++ L   I          +M  +L   G++   + +  +  +L  +    L   L L R
Sbjct: 227 KLMALMQDITNLENPNSVQQMKDWLADNGLETDTLGKKAVAEMLKTAP-EPLGTVLEL-R 284

Query: 282 LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILT 341
              + S++ K   +  AV +DGR RG  QFYGA+RTGR+SG + Q QNLP+    +  L 
Sbjct: 285 QQLAKSSVKKYTAMENAVCNDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPD--LE 342

Query: 342 QTIQALNRGETIADPL------GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGE 395
           Q    +  G   A  L       + S+ +R+  I   G K +VAD + IEARV+AW+AGE
Sbjct: 343 QARALVRSGNFDALTLLYDSIPEVLSELIRTAFIPREGMKFIVADFSAIEARVIAWLAGE 402

Query: 396 DWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            W+I  F NG DIY  + ++ FN P++K  V+   R  GK+ ELALGY G     K+M +
Sbjct: 403 KWRIDVFQNGGDIYCASASQMFNVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKSMGA 462

Query: 454 -HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G++ ++    V                                          AWR 
Sbjct: 463 LEMGIEEEELQPLV-----------------------------------------TAWRQ 481

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
            +  + +LW D+       V++        +  + +  M      + I LPS RRL Y  
Sbjct: 482 SNPNITKLWWDVDRAVKTCVKQKTPTETHGIKFIYQSGM------LFIALPSGRRLAYVK 535

Query: 573 VK-GDCSYLNTA--------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYD 623
            + G+  +   +        T +  R  +YG K  ENIVQAISRDILC  M+  T     
Sbjct: 536 PRMGENMFGGESVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILCHAMQ--TLKNCS 593

Query: 624 IVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           IV  VHDEI+ E       S+  +C  M K P+WA GL L A+GYE + Y+K
Sbjct: 594 IVAHVHDEIIIEADMGT--SLSAICEQMAKMPTWANGLLLSADGYECQFYQK 643


>gi|302876795|ref|YP_003845428.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|307687477|ref|ZP_07629923.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|302579652|gb|ADL53664.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
          Length = 663

 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 213/722 (29%), Positives = 333/722 (46%), Gaps = 110/722 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           +  L IDIET S   L K GV+ Y+E +   + L AY+ D   V + D     ++P ++L
Sbjct: 4   IGTLSIDIETYSSIDLAKCGVYKYSESSDSEVLLFAYSVDGGSVIVIDVANGESIPDEIL 63

Query: 59  QYLRDETVMCVAHNSLFERILF------------------KKTLGIDIPSKRWICTSVLA 100
           Q L D++V+  A N+ FER+                    + ++G  +    W C+ + +
Sbjct: 64  QALVDDSVIKWAFNAAFERVFLSIWLKRNYPELFCSYSIPEDSVGNYLDPSAWRCSMIWS 123

Query: 101 RTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN--------- 151
              GLP SL+     L   E   K++EGK LI  FCK      P   T+ N         
Sbjct: 124 AYMGLPLSLEGVGAVLGLEEQ--KLKEGKDLIRYFCK------PCAATKVNGGRTRNLPE 175

Query: 152 HV-QAWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLK 208
           H    W+LF  Y KRDVE    + K+L   P+ +   + + LDQ INDRG  +D+D+V  
Sbjct: 176 HAPDKWELFKAYNKRDVEVEMNIQKKLSHYPVPEFVWEEYHLDQEINDRGIALDMDVVEN 235

Query: 209 LQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS 268
              + A  +  L   +  LTD  + +      ++ +L    G+D   + +  +  +L   
Sbjct: 236 AIRIDAISKATLMATMQDLTD--LENPNSVAQMKGWL-AAKGVDTDSLDKKAVIELLK-- 290

Query: 269 NITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQ 328
            +     D++  R   + S++ K   +  AV  DGR RG  QFYGA+R+GRW+G + Q Q
Sbjct: 291 TVPTDVADVLTLRQQLAKSSVKKYQAMQNAVCDDGRARGMFQFYGANRSGRWAGRIIQLQ 350

Query: 329 NLPRQERSEEILTQTIQALNRGETIA----DPLGLASDCVRSCIIASNGKKLVVADLAGI 384
           NLP+    +  + + I      E +     +  G+ S+ +R+  I   G K  VAD + I
Sbjct: 351 NLPQNHMEDLDVARDIVKSGDYEILNMFYDNVPGVLSELIRTAFIPREGYKFAVADFSAI 410

Query: 385 EARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQ 442
           EARV+A +A E W++K FA+  DIY  + +  F  P++K  +    R  GK+ ELALGY 
Sbjct: 411 EARVIAHLAKERWRMKVFADNGDIYCASASAMFGVPVEKHGQNAHLRQKGKIAELALGYG 470

Query: 443 GGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTA 502
           G      +M +   LD+    + ++                                   
Sbjct: 471 GSVGALTSMGA---LDMGLAEEELQP---------------------------------- 493

Query: 503 CELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVL 562
              +  AWRA +  ++Q W D+       ++E  +     +  + +  M      + IVL
Sbjct: 494 ---LVDAWRAANPNIVQFWWDVDNAVKRAIKERTATKTHGIRFIYKSAM------LFIVL 544

Query: 563 PSSRRLVY-------SDVKGD-CSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEG 613
           PS RRL Y       +   G+  +Y    T+ +  R  +YG K  ENIVQAISRDILC  
Sbjct: 545 PSGRRLAYVKPRIGENKFGGESVTYEGVGTNKKWERIESYGPKFVENIVQAISRDILCYA 604

Query: 614 MKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           ++  T +   IV  VHDE++ E       S+  +C  M + P W +GL L+A+GYE + Y
Sbjct: 605 LR--TLSHCFIVGHVHDEVIIECRQDA--SLEAICEQMGRVPEWIEGLLLRADGYETQFY 660

Query: 674 RK 675
           +K
Sbjct: 661 KK 662


>gi|297583086|ref|YP_003698866.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
 gi|297141543|gb|ADH98300.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
          Length = 644

 Score =  270 bits (691), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 217/707 (30%), Positives = 326/707 (46%), Gaps = 96/707 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIE+ S   L K GV+ YAE     I L AY+ D  PV + D  +   +P  + 
Sbjct: 1   MKTLNIDIESYSRTDLAKSGVYRYAEAPDFDILLFAYSVDAGPVHVVDLAQGETIPDVVR 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           Q L D+ V+  A N+ FER    + L   I    W C+ V +   GLP SL+ A +    
Sbjct: 61  QALTDDGVIKWAFNAQFERTCLSRYLNTPIHPTSWRCSMVWSAYLGLPLSLEGAAIVTGA 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVE 168
            +   K++EGK LI  FCK      P   T+ N            + W  F  Y +RDVE
Sbjct: 121 DK--KKLQEGKDLIRYFCK------PCKPTQVNGGRERNFPHHDPEKWVAFKRYNQRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             + +  ++   P+ + E   ++LDQ INDRG  +D   V          R+ L   +  
Sbjct: 173 TEQAIQDKISRYPVPEQEWGHYVLDQIINDRGILLDPVFVEAAIACDTATREALMNRLRT 232

Query: 227 LTDGIIRSSRQTYALRMYLFLI-TGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASS 285
           LT    +       ++M  +L   G++   + +  +  +L  +         I  +LA S
Sbjct: 233 LT----KLENPNSVMQMKDWLAEQGVETGALDKAAVHELLKSAQGDVAEVLTIRQKLAKS 288

Query: 286 GSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR------QERSEEI 339
             ++ K   + +    D R RG +QFYGA+R+GR++G + Q QNLP+      +E  + +
Sbjct: 289 --SVKKYTAMKQVAGKDDRARGLIQFYGANRSGRYAGRLIQVQNLPQNHVPDLKEARDLV 346

Query: 340 LTQTIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
               ++AL+    ++ D   L S+ +R+  I     + +VAD + IEARV+AW+AGE W+
Sbjct: 347 RASNLEALDMLYPSVPD---LLSELIRTAFIPKEHHQFIVADFSAIEARVIAWLAGEAWR 403

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMASHCG 456
            + FA    IY  + ++ FN P++++ K    R  GK+ ELALGY G     + M +   
Sbjct: 404 NEVFATHGKIYEASASQMFNVPLEEIDKGSPLRQKGKISELALGYGGSVGALRAMGA--- 460

Query: 457 LDLQQFSQNVKSTSTFEDWEQAES---HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
           LD+    + +K     + W QA        W  DQ  + AVK +   +            
Sbjct: 461 LDMGVEEEELK--PLVQAWRQANPKIVQFWWAVDQAAQKAVKQRTTTS------------ 506

Query: 514 HQGVLQLWKDLTEGFACVVQEG----GSISARRVANV-PRLVMRRHKRDVHIVLPSSRRL 568
                      T G +   Q G    G  S R ++ V P +V+    R+           
Sbjct: 507 -----------THGISFTYQSGLLLVGLPSGRHLSYVKPTIVLNDFGRE----------- 544

Query: 569 VYSDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTV 628
                 G C     AT +  R  TYG KL ENIVQA+SRD+L   M+   + GY IV+ V
Sbjct: 545 ------GLCFEGIGATKKWERIDTYGPKLVENIVQAVSRDLLAHAMQRIEQEGYAIVMHV 598

Query: 629 HDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           HDE+V E     + +V  +C+LMT  P W+ GL LKAEGY    Y+K
Sbjct: 599 HDEVVVEAKQ--HVTVSDICALMTDQPDWSSGLNLKAEGYACMFYQK 643


>gi|317501098|ref|ZP_07959304.1| DNA-dependent DNA polymerase, family A [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|316897485|gb|EFV19550.1| DNA-dependent DNA polymerase, family A [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 662

 Score =  270 bits (690), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 223/727 (30%), Positives = 330/727 (45%), Gaps = 118/727 (16%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ YAE     I L  Y+ D   V + D  +   +P  ++
Sbjct: 1   MQTLSIDIETYSDVNLSKCGVYKYAESPDFEILLFGYSADGSEVTVIDLAQGEHLPQKII 60

Query: 59  QYLRDETVMCVAHNSLFERIL---FKKTLGIDIPS-----------------KRWICTSV 98
             L D+TV+  A N+ FER+    + + LG+ +                   + W C+ V
Sbjct: 61  DALTDDTVIKWAFNANFERVCLSRYLRDLGVSLDPFHDNHPLSTECARFLNPESWRCSMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDC----TRANHVQ 154
            A T GLP SL+     L   +   K+ EGK LI  F   S+   P       TR +   
Sbjct: 121 WAATMGLPLSLEGVGAVLGLEKQ--KLTEGKDLIKYF---SVPCAPTKANGGRTRNHPFH 175

Query: 155 A---WQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKL 209
           A   W+ F +Y  RDVE    +  RL   P+ +   D + +DQ INDRG R+D+DLV + 
Sbjct: 176 APDKWEAFKKYNIRDVETEIGIKDRLAKFPVPEAVWDEYHIDQEINDRGVRLDMDLVKEA 235

Query: 210 QELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSN 269
            E+  + R +L   +  +T   + +      ++ +L    G++   + +  +  ++  + 
Sbjct: 236 IEMDTRSRSELTAAMKDMT--ALDNPNSVQQMKQWLS-DNGLETDSLGKKVVAELIKTAP 292

Query: 270 ITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQN 329
             +L   L L R   + S++ K  T+  AV  DGR RG   FYG +RTGRW+G + Q QN
Sbjct: 293 -PELQTVLEL-RQQLAKSSVKKYQTMERAVCDDGRARGMFAFYGVNRTGRWAGRLIQLQN 350

Query: 330 LPRQERSEEILTQTIQALNRG---------ETIADPLGLASDCVRSCIIASNGKKLVVAD 380
           LP+    +  L      +  G         E + D L   S  +R+  I  +G +  V+D
Sbjct: 351 LPQNHLPD--LADARALVKSGNFDAVKLLYEDVPDTL---SQLIRTAFIPKDGTQFYVSD 405

Query: 381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELA 438
            + IEARV+AW AGE W+ K F  G DIY  + ++ F+ P++K  ++   R  GK+ ELA
Sbjct: 406 FSAIEARVIAWYAGETWRQKVFETGGDIYCASASQMFHVPVEKHGINGHLRQKGKIAELA 465

Query: 439 LGYQGGAKVFKTM-ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDK 497
           LGY G     K M A   GL                            +D+ P       
Sbjct: 466 LGYGGSVGALKAMGAIEMGLS---------------------------EDELPPLV---- 494

Query: 498 LIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRD 557
                      AWR  +  +++ W D+       V+   + S+  +    R  M      
Sbjct: 495 ----------DAWRQTNPNIVKFWWDVDRSVMEAVKYKHTTSSYGLTFSCRSGM------ 538

Query: 558 VHIVLPSSRRLVYSDVK-------GDC-SYLNTATSQLMRE-RTYGGKLTENIVQAISRD 608
           + I LPS R L Y   K       G+C +Y    +++   +  +YG K  ENIVQA SRD
Sbjct: 539 LFITLPSGRNLAYVKPKIGTNKFGGECVTYEGIGSTKKWEQLDSYGPKFVENIVQATSRD 598

Query: 609 ILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGY 668
           ILC  MK  T     IV+ +HDE+V E    P+ S+  LC  M + P WAKGL L+A+GY
Sbjct: 599 ILCYAMK--TLRCCSIVMHIHDELVIEA--DPHMSLDVLCEQMGRTPPWAKGLKLRADGY 654

Query: 669 EAKRYRK 675
               Y+K
Sbjct: 655 VTPFYKK 661


>gi|288799805|ref|ZP_06405264.1| hypothetical protein HMPREF0669_00204 [Prevotella sp. oral taxon
           299 str. F0039]
 gi|288333053|gb|EFC71532.1| hypothetical protein HMPREF0669_00204 [Prevotella sp. oral taxon
           299 str. F0039]
          Length = 726

 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 210/697 (30%), Positives = 324/697 (46%), Gaps = 79/697 (11%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L IDIET S   +   GV  Y +     I L AY+ D   V+L D  +   +P+ +L  L
Sbjct: 83  LSIDIETYSDNEITN-GVHNYVDTPNFEILLFAYSCDGGSVQLVDLAQGEEIPAKILDAL 141

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEH 121
            D  ++  A N+ FER+   K LG+ +   +W CT + A   GLP+SL++    L     
Sbjct: 142 TDSNIIKTAFNASFERVCIGKHLGLTLDPSQWHCTQIRALMLGLPASLQSCGEVLKLKHK 201

Query: 122 LTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEATRELFKR- 176
             K+ EG  LI  F   CK +  +         H    W  F  YC RDVE  + + ++ 
Sbjct: 202 --KLREGAELIKYFSIPCKPTKSNGGRTRNLPEHAPDKWAQFKRYCIRDVEVEKAIQRKV 259

Query: 177 ----LIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
               L P++  ER L++ DQT+ND+G  ID +L      +  + + +L  ++ ++T+  +
Sbjct: 260 CNNTLNPVTPFERALYIFDQTMNDKGVCIDSELANNAIRMNDEAQDELFAEMQEITN--L 317

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G  +  +++   K + + +  ++  K ++  R  SS +++ K 
Sbjct: 318 ENPNSPVQLKQWLSSKLGRPIQSLAKEDAKELATGA--SEDVKRVLYLRSMSSKTSVKKY 375

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE- 351
             ++ A  SD +L   LQFYGA +TGRW+G + Q  NLPR    +  L + +   N  E 
Sbjct: 376 EAMTLAKCSDNKLHDLLQFYGA-KTGRWAGRIVQVHNLPRNSSKDLALARELVKKNDFEL 434

Query: 352 ---TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
              T  +   + S  +R+  IA     L V D + IEARV+AW+AGE+W++K F     I
Sbjct: 435 LELTFGNVCDILSQLIRTAFIAKENYTLCVCDFSAIEARVIAWLAGEEWRLKVFRGSGRI 494

Query: 409 YVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + A+ F      ++ +   R  GK+ ELALGY+GGA   K M    G D    S   
Sbjct: 495 YEASAARMFGVDEKTITHDSPLRQKGKIAELALGYEGGANALKIM----GADKMGLSD-- 548

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                  PE A            +   WR     +++LW+D+  
Sbjct: 549 -----------------------PEIAQ-----------IVSGWRNSSPNIVKLWRDVER 574

Query: 527 GFACVVQEGGSISARRVANVPR--LVMRRHKRDVHIVLPSSRRLVYSDVK---GDCSYL- 580
                     +I + R+  + +  L+ R+    + I LPS R L Y   K       Y+ 
Sbjct: 575 A------AKEAILSDRIIKLKQGGLIFRKTSNILQIKLPSGRLLSYPLAKIVDNKICYMS 628

Query: 581 -NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP-D 638
            N  T Q +   TYGGKL ENIVQAI+RD L E +    K GY+I   VHDEI++E P D
Sbjct: 629 QNQTTRQWVDTETYGGKLVENIVQAIARDCLGETILRVDKKGYNICFHVHDEIIAEVPTD 688

Query: 639 TPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
               ++  + ++     ++A  LPLK EGY    Y K
Sbjct: 689 ESAKALQDIKNIFATPITFAPDLPLKGEGYITPYYLK 725


>gi|253581725|ref|ZP_04858949.1| DNA polymerase [Fusobacterium varium ATCC 27725]
 gi|251836074|gb|EES64611.1| DNA polymerase [Fusobacterium varium ATCC 27725]
          Length = 657

 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 209/711 (29%), Positives = 325/711 (45%), Gaps = 91/711 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K G++ YA  +   I L AY+ D   VK+ D  +   +P  ++
Sbjct: 1   MKHLSIDIETYSSVDIKKAGMYKYALSDDFQILLFAYSIDFGEVKIIDLAKGEILPEVII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D+ ++  A+N+ FE     +  G     ++W  T       G  + L     A+  
Sbjct: 61  EALNDKNIIKHAYNAPFEWWCLNQA-GYKTSIEQWRDTMFHGLYCGYTAGLGATGAAIGL 119

Query: 119 SEHLTKMEEGKALIARFC---------KGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
            +   K   GKALI  FC          G + + P+     +  + W+LF  YC +DV  
Sbjct: 120 PQDKKKDTTGKALIKLFCVPCKPTKKNGGRLRNLPH-----HEPEKWELFKNYCIQDVVT 174

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDEDI 224
             E++KRL   P+   E++LW+LDQ IN  G +ID +LV   L + +++  E   L E+ 
Sbjct: 175 ETEIYKRLSNFPVPQEEQELWVLDQKINAYGVKIDTELVKGALSINDIVTAE---LTEEA 231

Query: 225 VKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
           +++T   + +      L  +L   TG D+ ++ +GT+  ++      +  + L + R   
Sbjct: 232 IQVTG--LDNPNSAAQLGKWLKEKTGQDIENLQKGTVSELIGSLEDKEAVRVLEI-RQEL 288

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTI 344
           + ++I K   + EA+  DGR+RG LQFYGA+RTGRW+G + Q QNLPR         + I
Sbjct: 289 AKTSIKKYVAMEEAICPDGRIRGLLQFYGANRTGRWAGRLVQVQNLPRNYLETLDYAREI 348

Query: 345 QALNRGETIADPLGLASDC----VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                 + +    G  SD     +R+  + S G K VVAD + IEARV+AW+AGE W+ +
Sbjct: 349 VKSQDADFLKLVYGNVSDTLSQLIRTAFVPSEGHKFVVADFSAIEARVIAWLAGEQWRQE 408

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSKEQ-----RAIGKVMELALGYQGGAKVFKTMAS-H 454
            FA    IY  + ++ F  PI+ + K       R  GKV ELALGY G +     M +  
Sbjct: 409 VFATHGKIYEASASQMFGVPIELIKKGNPEYALRQKGKVAELALGYGGSSGALIAMGALD 468

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            GL+ ++    V+                                          WR  +
Sbjct: 469 MGLEEKELPDVVRR-----------------------------------------WRNAN 487

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
           + +  LW  +      +++ G +   + +     + +   +  + I LPS R+L Y    
Sbjct: 488 KRITDLWYGIENAVIKLMETGETQGLKGIIFSREIDLIYDQDFLTIKLPSGRKLYYPKPH 547

Query: 575 --------GDCSY--LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
                       Y  +N  T +   + TYGGKL ENIVQAISRD L   +K     G   
Sbjct: 548 LKENRFGSNALHYFGVNQTTKKWEVQETYGGKLVENIVQAISRDCLAVTLKRLETEGLQT 607

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V+ +HDE V +    P   +  +C LM +   WA GL LKA G+E+  Y K
Sbjct: 608 VMHIHDEAVIDA--DPNVDLNKVCELMGQPIEWAPGLLLKAAGFESGYYMK 656


>gi|322382461|ref|ZP_08056356.1| hypothetical protein PL1_2400 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153574|gb|EFX45963.1| hypothetical protein PL1_2400 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 662

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 214/713 (30%), Positives = 332/713 (46%), Gaps = 98/713 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L ID+ET S   L   GV+ Y E     + L AYA+DD+PV++ D T    +P  ++
Sbjct: 9   MKILQIDLETYSSVDLKDCGVYRYVESPDFEVLLFAYAYDDDPVQVIDLTAFEDLPDQVV 68

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V+  A N+ FER   KK  GI     +W CT+V A   GLP  L+     L  
Sbjct: 69  HDLTDPNVLKTAFNAAFERTCIKKHFGIKCNPSQWRCTAVWALALGLPGYLEGVAEVLKL 128

Query: 119 SEHLTKMEEGKALIARF---CKGSI-------DSPPYDCTRANHVQAWQLFGEYCKRDVE 168
                K   GK LI  F   CK +        + PP+     + ++ W+ +  Y  +DV 
Sbjct: 129 EAQ--KDTRGKNLIKYFSVPCKPTKANGGRTRNHPPH-----HDMEKWEQYKAYNIQDVV 181

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             RE+ ++L   P+   E DLW LDQ INDRG ++D  L  +  +   Q +  L ++   
Sbjct: 182 VEREVRRKLERFPVPQHEWDLWALDQRINDRGIQLDPTLFNQAIDCADQYKTGLLQEAKD 241

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVD-MSEGTLKSILSHSNITQLAKDLILNRLASS 285
           +T   + +      L+ +L    G++  D + +  + ++L  +      + L + R    
Sbjct: 242 ITQ--LENPNSLTKLKEWL-AEQGLETPDGLGKEHMPTLLVQAPDEDTRRVLQI-RQELG 297

Query: 286 GSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQ 345
            +++ K N ++ ++ +DGR RG LQF GA+RTGRW+G + Q QNLP+ + +   L    +
Sbjct: 298 KTSVDKYNAMARSICADGRARGILQFCGANRTGRWAGRIIQVQNLPQNKLNA--LWMARE 355

Query: 346 ALNRG-----ETIADPL-GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            L  G     E +   L  + S  +R+  I S G + +V+D + IEAR++AW+A E W +
Sbjct: 356 VLKSGDFDLLEMLYGALPSVLSQLIRTVFIPSPGCRFIVSDFSAIEARIIAWLADEHWVL 415

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSK-----EQRAIGKVMELALGYQGGAKVFKTMASH 454
             F +   IY    ++ F  P++ + K     E RA GKV  LA GYQGG      M + 
Sbjct: 416 NVFQDHGKIYEAAASQMFKVPMETIVKGHPNYELRAKGKVATLACGYQGGPPALIKMGA- 474

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
                                         ++   PE    ++L G     + K WR  +
Sbjct: 475 ------------------------------LKSGIPE----EELPG-----IVKRWRKAN 495

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIV-LPSSRRLVYSD- 572
             +++LW    E     V+E      +R   +   V  R+K       LPS R L Y + 
Sbjct: 496 PRIVKLWYAAEEAALTAVRE------KRTVPLAHGVKYRYKSGTLFADLPSGRSLAYVNP 549

Query: 573 -VKGDCSY---------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGY 622
            +K D ++         ++    + M  RTYGG+L EN+VQAI+RD L E +       Y
Sbjct: 550 RIKPDPNFGKDGLVFDGMDQIKKKWMSHRTYGGRLVENLVQAIARDCLAESLMRLDAAEY 609

Query: 623 DIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             V+ VHDE+V + P     SV  +  +M++   WA GLPL A G+E + Y+K
Sbjct: 610 RTVMHVHDEVVLDVP-IGTGSVDHVTGIMSQPIDWAPGLPLSAAGFECEFYQK 661


>gi|266623807|ref|ZP_06116742.1| prophage LambdaSa04, DNA polymerase [Clostridium hathewayi DSM
           13479]
 gi|288864379|gb|EFC96677.1| prophage LambdaSa04, DNA polymerase [Clostridium hathewayi DSM
           13479]
          Length = 656

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 218/714 (30%), Positives = 320/714 (44%), Gaps = 98/714 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIETRS   + K G + YA+     I L AY W+++PVK+ D      +P  L+
Sbjct: 1   MHHLSIDIETRSSIDIGKAGAYKYAQSPDFEILLFAYQWNNDPVKVIDLKNGEELPCWLM 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           Q L D  V+  A+N+ FE        G + P ++W CT       G  + L     A+  
Sbjct: 61  QALADPNVIKHAYNAAFEWYCLN-CAGYETPIEQWRCTMAHGLYCGYTAGLDATGKAIGL 119

Query: 119 SEHLTKMEEGKALIARFC--------KGS--IDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +   K+  GKALI  FC         GS   + P +D  +      W+LF EYC +DV 
Sbjct: 120 PQDKQKLTTGKALIRYFCVPCKPTKTNGSRTWNQPWHDTDK------WELFKEYCLQDVV 173

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
             RE+ KRL   P+ + E  LW +D  +N  G R+D DL+     +     ++L ++ + 
Sbjct: 174 TEREILKRLDLFPMPEEEEHLWQMDVLMNAYGVRVDTDLIEGALYIDQISTQRLTDEAIS 233

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           LT   +++      L  +L    G +  ++ + T+  +L   N  ++ + L + R     
Sbjct: 234 LTG--LQNPNSAAQLLQWL-RDNGTEADNLQKATVAELLGGINPNKVRRMLEI-RQQLGK 289

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE-RSEEILTQTIQ 345
           ++I K   +  A     R+RG  Q+YGA+RTGRW+G + Q QNLPR   ++ +     ++
Sbjct: 290 TSIKKYVAMDTARGEGDRVRGLTQYYGANRTGRWAGRLVQMQNLPRNYLKTLDYARNLVK 349

Query: 346 ALNRGE------TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
           A N          + D L   S  +R+  I S G K VVAD + IEARV+AW+AGE W  
Sbjct: 350 AKNYDGVRILYGNVPDTL---SQLIRTAFIPSAGHKFVVADFSAIEARVIAWLAGEQWVN 406

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ-----RAIGKVMELALGYQGGAKVFKTMAS- 453
           + FA    IY  T ++ F  P+++++K       R  GKV  LALGYQGG      M + 
Sbjct: 407 EVFATHGKIYEATASQMFGVPVERIAKGNPEYSLRQKGKVATLALGYQGGTSALIAMGAL 466

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESH--HLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
             GL  ++    V+       W QA      LW   +    AV +               
Sbjct: 467 QMGLTEEELPDIVQR------WRQANPRIKGLWYAIENAALAVMET-------------- 506

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
           A+ QG+  L             EG  I  +    V               LPS R+L Y 
Sbjct: 507 AQPQGINGL---------IFALEGDIIYGQSFLTV--------------RLPSGRKLFYP 543

Query: 572 DV--------KGDCSYLNTA--TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNG 621
                     K    Y      T +     TYGGK+ ENIVQAI+RD L   ++     G
Sbjct: 544 KPFLKENRFEKMAVHYYTVGQQTRKWEVTSTYGGKMVENIVQAIARDCLAVTLERIASKG 603

Query: 622 YDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             +V  VHDE++ + P     +V  +C LM +   WA GL LK  G+E+  Y K
Sbjct: 604 LQVVFHVHDEVIIDAPMET--TVEEICDLMAEPIPWAPGLVLKGAGFESSYYMK 655


>gi|283469578|emb|CAQ48789.1| DNA polymerase [Staphylococcus aureus subsp. aureus ST398]
 gi|283470753|emb|CAQ49964.1| DNA polymerase [Staphylococcus aureus subsp. aureus ST398]
          Length = 653

 Score =  267 bits (682), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 218/717 (30%), Positives = 324/717 (45%), Gaps = 107/717 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D  P+   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYC 163
             L       K + GK LI  F      S P   T+ N           ++ WQ F +YC
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYF------SIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYC 172

Query: 164 KRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLD 221
            RDVE    +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L 
Sbjct: 173 IRDVEVEMAIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELL 232

Query: 222 EDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNR 281
           +    +T   + +      L  +L    G+D+ ++ + T++  L  S  T  AK ++  R
Sbjct: 233 KQAKHITG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKES--TGKAKKMLEIR 288

Query: 282 LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILT 341
           L  S +++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L 
Sbjct: 289 LQMSKTSVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL- 346

Query: 342 QTIQALNRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
           +  + L + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A
Sbjct: 347 EIARDLIKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYA 406

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTM 451
            E W++  F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M
Sbjct: 407 KEQWRLDVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAM 466

Query: 452 AS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
            +   G++  +    V S                                         W
Sbjct: 467 GALEMGIEENELQGLVDS-----------------------------------------W 485

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
           R  +  ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y
Sbjct: 486 RNANPNIVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAY 539

Query: 571 SDVK-GDCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
                G+ S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +    
Sbjct: 540 PKASVGENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLE 596

Query: 619 KNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +G+ IV  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 597 ASGFKIVGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|258455585|ref|ZP_05703542.1| DNA-directed DNA polymerase [Staphylococcus aureus A5937]
 gi|257862273|gb|EEV85044.1| DNA-directed DNA polymerase [Staphylococcus aureus A5937]
          Length = 653

 Score =  266 bits (681), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 218/717 (30%), Positives = 325/717 (45%), Gaps = 107/717 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K GV+ Y  AE   I + AY+ D  P+   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYC 163
             L       K + GK LI  F      S P   T+ N           ++ WQ F +YC
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYF------SIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYC 172

Query: 164 KRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLD 221
            RDVE    +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L 
Sbjct: 173 IRDVEVEMTIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELL 232

Query: 222 EDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNR 281
           +    +T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  R
Sbjct: 233 KQAKHITG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKEA--TGKAKKMLEIR 288

Query: 282 LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILT 341
           L  S +++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L 
Sbjct: 289 LQMSKTSVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL- 346

Query: 342 QTIQALNRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
           +  + L + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A
Sbjct: 347 EIARDLIKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYA 406

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTM 451
            E W++  F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M
Sbjct: 407 KEQWRLDVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAM 466

Query: 452 AS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
            +   G++  +    V S                                         W
Sbjct: 467 GALEMGIEENELQGLVDS-----------------------------------------W 485

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
           R  +  ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y
Sbjct: 486 RNANPNIVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAY 539

Query: 571 SDVK-GDCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
                G+ S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +    
Sbjct: 540 PKASVGENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLE 596

Query: 619 KNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +G+ IV  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 597 ASGFKIVGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|298253796|ref|ZP_06977385.1| DNA polymerase I [Gardnerella vaginalis 5-1]
 gi|297532132|gb|EFH71105.1| DNA polymerase I [Gardnerella vaginalis 5-1]
          Length = 674

 Score =  266 bits (680), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 230/724 (31%), Positives = 339/724 (46%), Gaps = 116/724 (16%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           +  L +D+ET S   L K GV+ YAE     I L  Y+ D   V++ D  +   +P  +L
Sbjct: 17  LENLSVDLETFSSVNLGKCGVYKYAESEDFEILLFGYSVDGSEVQVVDLAQGETIPEVVL 76

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL---GIDI--------------PSKRWICTSVLAR 101
             L DETV   A N+ FERI   + L   GI++              PS  W CT + + 
Sbjct: 77  SALTDETVTKWAFNAQFERICLSRYLRDKGINVNPGQTGKSEGLFLNPSS-WHCTMIWSA 135

Query: 102 TNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN---------- 151
           T GLP SL+N  + L   +   K+ EGK LI  FC       P + T+ N          
Sbjct: 136 TLGLPMSLENVGIVLGLDKQ--KLTEGKNLIKYFCL------PCNPTKVNGGRTRNKYFH 187

Query: 152 HVQAWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKL 209
             + W+ F  Y KRDVE    + ++L   P+ D     + LDQ INDRG  ID   V   
Sbjct: 188 DKEKWEQFKSYNKRDVEVEMSIQEKLSRFPVPDFLWQEFYLDQEINDRGIGIDSLFVESA 247

Query: 210 QELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSN 269
            +L  + +  L  ++ ++T   + +      +R +L    G+++  + +  +   L    
Sbjct: 248 IKLDLEVKTHLMSELKRVTG--LENPNSVLQMRSWL-KKHGLEMESLGKKEVAKELKTVG 304

Query: 270 ITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQN 329
             +LA+ L L R   + S++ K   +  A   D R RG  +FYGA+RTGR++G + Q QN
Sbjct: 305 -KELAEVLRL-RQQLAKSSVKKYTAMKNAACMDYRERGMFRFYGANRTGRFAGRLVQLQN 362

Query: 330 LPRQ------ERSEEILTQTIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLA 382
           LP+       E    +    ++AL    E I D L   S  +R+  I   G K +VAD +
Sbjct: 363 LPQNHLPDLAEARSLVKQGNVEALEMLYEDIPDTL---SQLIRTAFIPRTGLKFIVADFS 419

Query: 383 GIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALG 440
            IEARVLAW+AGE W+++ FA G+DIY ++ ++ F+ P++K  V+   R  GK+ ELALG
Sbjct: 420 AIEARVLAWLAGEKWRMRVFAEGKDIYCSSASQMFSVPVEKHGVNGHLRQKGKIAELALG 479

Query: 441 YQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIG 500
           Y G     K M +   LD+                                   +D+L  
Sbjct: 480 YGGSVGALKAMGA---LDMG--------------------------------LTEDEL-- 502

Query: 501 TACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHI 560
              + +  AWR+ +  V  LW D+       V E  S+   R  N+   V       + I
Sbjct: 503 ---QPLVDAWRSSNPMVTTLWWDVDRAVKQCVHEHVSV---RTHNI---VFTYKSGFLII 553

Query: 561 VLPSSRRLVYSDVKGD--------CSYLNT-ATSQLMRERTYGGKLTENIVQAISRDILC 611
            LPS R L Y   + +         +Y    +T +  R  +YG K  ENI QAI+RDIL 
Sbjct: 554 KLPSKRCLYYVKPRVEENKYGGESVTYEGVGSTKKWERLESYGPKFVENITQAIARDILI 613

Query: 612 EGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAK 671
             M+  T   Y IV  VHDE + ET  +   SV ++C LM + P WA+GL L+A+GYE +
Sbjct: 614 YAMQ--TLKEYRIVAHVHDEAIIETDKS--VSVQSVCELMGRTPPWAEGLLLRADGYECE 669

Query: 672 RYRK 675
            Y+K
Sbjct: 670 FYKK 673


>gi|262049890|ref|ZP_06022752.1| putative DNA polymerase [Staphylococcus aureus D30]
 gi|259162039|gb|EEW46619.1| putative DNA polymerase [Staphylococcus aureus D30]
          Length = 653

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 216/711 (30%), Positives = 327/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K GV+ Y  AE   I + AY+ D  P+   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKADNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKVA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD-VKG 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y   + G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ I
Sbjct: 546 ENSWGSQVIEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|291556513|emb|CBL33630.1| DNA polymerase I-3'-5' exonuclease and polymerase domains
           [Eubacterium siraeum V10Sc8a]
          Length = 660

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 216/727 (29%), Positives = 328/727 (45%), Gaps = 120/727 (16%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y E     I L  Y+ D  PV++ D      +P +++
Sbjct: 1   MKTLSIDIETYSSVDLAKCGVYKYTEATDFDILLFGYSTDGGPVQVVDLACGETIPQEVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKK------------------TLGIDIPSKRWICTSVLA 100
             L ++ V   A N+ FERI   +                  T+G  +    W CT + +
Sbjct: 61  AALTNDNVTKWAFNAQFERICLSRWLRDHGGFDNACYSIPEDTVGNYLDPASWKCTMIWS 120

Query: 101 RTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----- 155
              GLP SL+     L   +   K+ EGK LI  FC+      P   T+AN  +      
Sbjct: 121 AYMGLPLSLEGVGAVLGLGKQ--KLTEGKELIKYFCQ------PCAPTKANSGRTRNLPE 172

Query: 156 -----WQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLK 208
                W  F  Y  RDVE    + ++L   P+ D   + + LDQ INDRG  +D+DLV +
Sbjct: 173 NAPDKWASFKRYNARDVEVEMSIQEKLAKFPVPDVVWEQYHLDQEINDRGVALDMDLVRQ 232

Query: 209 LQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS 268
             ++  + R +L   + KLT   + +      ++ +L    G+++  + +  +  +L  +
Sbjct: 233 AIDMDTRSRAELTAAMKKLT--ALDNPNSVQQMKQWLS-DNGLNVDSLGKKEVAEMLKTA 289

Query: 269 NITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQ 328
                   L+  +LA S  ++ K   + +AV +DGR RG  QFYGA+RTGRW+G + Q Q
Sbjct: 290 PAELQQVLLLRQQLAKS--SVKKYQAMEKAVCADGRARGMFQFYGANRTGRWAGRIIQMQ 347

Query: 329 NLPRQERSEEILTQTIQALNRG---------ETIADPLGLASDCVRSCIIASNGKKLVVA 379
           NLP+    +  L +    +  G         E + D L   S  +R+  +   G K +V+
Sbjct: 348 NLPQNHLPD--LAEARALVRCGDFDGVELLYEDVPDTL---SQLIRTAFVPRPGYKFIVS 402

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMEL 437
           D + IEARVLAW AGE W+ + F  G DIY  + ++ F  P++K  V+   R  GK+ EL
Sbjct: 403 DFSAIEARVLAWFAGETWRQEVFEKGGDIYCASASQMFKVPVEKHGVNGHLRQKGKIAEL 462

Query: 438 ALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDK 497
           ALGY G     K M                                         A++  
Sbjct: 463 ALGYGGSVGALKAMG----------------------------------------ALEMG 482

Query: 498 LIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRD 557
           L     + +  AWR  +Q +++ W D+            ++     + +  +        
Sbjct: 483 LSEGELQPLVTAWRNSNQNIVKFWWDIDRAAM------NAVKYHMDSEICGIKFSYKSGM 536

Query: 558 VHIVLPSSRRLVYSDVK-------GDC-SYLNT-ATSQLMRERTYGGKLTENIVQAISRD 608
           + I LPS RRL Y   K       G+C +Y     T +  R  TYG KL ENIVQA SRD
Sbjct: 537 LFITLPSGRRLSYVKPKLGTNQFGGECITYEGIGGTKKWERLDTYGPKLVENIVQATSRD 596

Query: 609 ILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGY 668
           ILC  M+  T +   I + +HDE+V E   +   ++ ++C  M + P+WA GL L+A+GY
Sbjct: 597 ILCYAMR--TLSHCFITMHIHDELVIEA--SLGVNLKSICEQMGRTPTWANGLKLRADGY 652

Query: 669 EAKRYRK 675
           E   Y+K
Sbjct: 653 ETMFYKK 659


>gi|282919245|ref|ZP_06326980.1| DNA polymerase bacteriophage-type [Staphylococcus aureus subsp.
           aureus C427]
 gi|282317055|gb|EFB47429.1| DNA polymerase bacteriophage-type [Staphylococcus aureus subsp.
           aureus C427]
          Length = 653

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 216/711 (30%), Positives = 327/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K GV+ Y  AE   I + AY+ D  P+   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKVA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD-VKG 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y   + G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|297590990|ref|ZP_06949628.1| prophage LambdaSa04 DNA-directed DNA polymerase [Staphylococcus
           aureus subsp. aureus MN8]
 gi|297575876|gb|EFH94592.1| prophage LambdaSa04 DNA-directed DNA polymerase [Staphylococcus
           aureus subsp. aureus MN8]
          Length = 653

 Score =  263 bits (673), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 214/711 (30%), Positives = 324/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE+  I + AY+ D   +   D T+    P  +D
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEEFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLNNDQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y     G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|66395454|ref|YP_239831.1| ORF004 [Staphylococcus phage 2638A]
 gi|62635881|gb|AAX90992.1| ORF004 [Staphylococcus phage 2638A]
          Length = 653

 Score =  263 bits (673), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 211/713 (29%), Positives = 311/713 (43%), Gaps = 99/713 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D  PV   D T+    P  +D
Sbjct: 1   MKYMNIDIETYSSNDISKCGAYKYVEAEDFEILIIAYSIDGGPVSAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER+   +    ++P + W CT V     GLP+SL    
Sbjct: 61  YETFKIALFDPEVRKYAFNANFERVCLAQHFNKEMPPEEWTCTMVNVTRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYC 163
             LN      K + GK LI  F      S P   T+ N            + WQ F +YC
Sbjct: 121 EVLNLQNQ--KDKAGKNLIRYF------SVPCKPTKVNGGRTRNLPQHDPKKWQQFIDYC 172

Query: 164 KRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLD 221
            RDVE    +  ++   P++  E+  W LDQ INDRG ++   L+L   EL    + +L 
Sbjct: 173 VRDVEVEMSIATKIKDFPVTKEEQKYWSLDQHINDRGIKLSKSLMLGANELDKISKAELL 232

Query: 222 EDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNR 281
           +   K+T   + +      L  +L    G+D+ ++ + T++  L ++  T  AK ++  R
Sbjct: 233 KQATKITG--LENPNSPSQLLKWLNEEQGLDIPNLQKKTVQEYLKYA--TGKAKQMLEIR 288

Query: 282 LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSE---- 337
           L  S +++ K N + + +  D R+RG  QFYGA  TGRW+G   Q QNL +   S+    
Sbjct: 289 LQMSKTSVKKYNKMHDMMCGDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELN 347

Query: 338 ---EILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
              + + +             P  L S  VR+   A  G  L V+D + IEARV+AW A 
Sbjct: 348 IARDFIKEQRFDDLDLLLDIHPQDLLSQLVRTTFTAEEGYALAVSDFSAIEARVIAWYAK 407

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMA 452
           E W++  F     IY  + A+ F  P+D + K    R  GKV ELALGYQGG    K M 
Sbjct: 408 EQWRLDVFNTHGKIYEASAAQMFGVPVDSIKKGDPLRQKGKVSELALGYQGGPGALKAMG 467

Query: 453 S-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
           +   G+D  +    V S                                         WR
Sbjct: 468 ALDMGIDESELQGLVDS-----------------------------------------WR 486

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
             +  ++  WK       C      ++  R+      L     K  + I LPS R L Y 
Sbjct: 487 KANPNIVAFWK------GCQDAAIETVRTRQTHLTHGLRFYMKKGFLMIELPSGRSLAYP 540

Query: 572 DVKGDCSYLNTATSQLM---------RERTYGGKLTENIVQAISRDILCEGMKNATKNGY 622
             +   +   +   + M         + +TYGGKL ENIVQA +RD+L   M      G+
Sbjct: 541 KARVGENSWGSPVVEFMGLDLNRKWTKLKTYGGKLVENIVQATARDLLAISMYRIEHAGF 600

Query: 623 DIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            IV  VHDE++ E PD     +  + ++M+K   WA+GL L ++G+ +  Y K
Sbjct: 601 SIVGHVHDEVIVEIPDGS-GGLKAIENIMSKPVKWAEGLKLNSDGFTSPFYMK 652


>gi|49483719|ref|YP_040943.1| DNA polymerase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49241848|emb|CAG40540.1| putative DNA polymerase [Staphylococcus aureus subsp. aureus
           MRSA252]
          Length = 653

 Score =  263 bits (673), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 214/711 (30%), Positives = 324/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE+  I + AY+ D   +   D T+    P  +D
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEEFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKNDQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y     G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|66395591|ref|YP_239981.1| ORF003 [Staphylococcus phage 3A]
 gi|62635937|gb|AAX91048.1| ORF003 [Staphylococcus phage 3A]
          Length = 650

 Score =  263 bits (671), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 215/706 (30%), Positives = 324/706 (45%), Gaps = 95/706 (13%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SDLLQY- 60
           IDIET S   + K GV+ Y  AE   I + AY+ D  P+   D T+    P  +D   + 
Sbjct: 3   IDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHADYETFK 62

Query: 61  --LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE    + 
Sbjct: 123 QNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +T   +
Sbjct: 181 NKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG--L 238

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +++ K 
Sbjct: 239 ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKVA--TGKAKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L + + 
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDLIKEQR 354

Query: 353 IAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F  
Sbjct: 355 FDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNT 414

Query: 405 GEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCGLDLQQ 461
              IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G++  +
Sbjct: 415 HGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENE 474

Query: 462 FSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLW 521
               V S                                         WR  +  ++  W
Sbjct: 475 LQGLVDS-----------------------------------------WRNANPNIVNFW 493

Query: 522 KDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD-VKGDCSY- 579
           K      AC      ++ +R+  +   L     K  + I LPS R L Y   + G+ S+ 
Sbjct: 494 K------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVGENSWG 547

Query: 580 ----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                     LN   S+L   +TYGGKL ENIVQA +RD+L   +      G+ IV  VH
Sbjct: 548 SQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVH 604

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 605 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|329730633|gb|EGG67018.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           21193]
          Length = 653

 Score =  263 bits (671), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 214/711 (30%), Positives = 324/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIAHKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKEA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y     G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|209363571|ref|YP_002267989.1| DNA polymerase [Staphylococcus phage phi2958PVL]
 gi|208973072|dbj|BAG74388.1| DNA polymerase [Staphylococcus phage phi2958PVL]
          Length = 650

 Score =  263 bits (671), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 213/706 (30%), Positives = 321/706 (45%), Gaps = 95/706 (13%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SDLLQY- 60
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D   + 
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADFETFK 62

Query: 61  --LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE    + 
Sbjct: 123 QNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +T   +
Sbjct: 181 HKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG--L 238

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +++ K 
Sbjct: 239 ENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L + + 
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDLIKEQR 354

Query: 353 IAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F  
Sbjct: 355 FDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNT 414

Query: 405 GEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCGLDLQQ 461
              IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G++  +
Sbjct: 415 HGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENE 474

Query: 462 FSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLW 521
               V S                                         WR  +  ++  W
Sbjct: 475 LQGLVDS-----------------------------------------WRNANPNIVNFW 493

Query: 522 KDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-GDCSY- 579
           K      AC      ++ +R+  +   L     K  + I LPS R L Y     G+ S+ 
Sbjct: 494 K------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGENSWG 547

Query: 580 ----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                     LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 604

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 605 DEVIVEIPRGSN-GLKEIETIMNKPADWAKGLNLNSDGFTSPFYMK 649


>gi|49485814|ref|YP_043035.1| putative DNA polymerase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|49244257|emb|CAG42684.1| putative DNA polymerase [Staphylococcus aureus subsp. aureus
           MSSA476]
          Length = 653

 Score =  263 bits (671), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 215/717 (29%), Positives = 323/717 (45%), Gaps = 107/717 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYC 163
             L       K + GK LI  F      S P   T+ N           ++ WQ F +YC
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYF------SIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYC 172

Query: 164 KRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLD 221
            RDVE    +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L 
Sbjct: 173 IRDVEVEMTIANKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELL 232

Query: 222 EDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNR 281
           +    +T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  R
Sbjct: 233 KQAKHITG--LENPNSPTQLLAWLKAEQGLDIPNLQKKTVQDYLKRA--TGKAKKMLEIR 288

Query: 282 LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILT 341
           L  S +++ K N + + + +D R+RG  QFYGA  TGRW+G   Q QNL +   S+  L 
Sbjct: 289 LQMSKTSVKKYNKMHDMMCNDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL- 346

Query: 342 QTIQALNRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
           +  + L + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A
Sbjct: 347 EIARDLIKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYA 406

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTM 451
            E W++  F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M
Sbjct: 407 KEQWRLDVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAM 466

Query: 452 AS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
            +   G++  +    V S                                         W
Sbjct: 467 GALEMGIEENELQGLVDS-----------------------------------------W 485

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
           R  +  ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y
Sbjct: 486 RNANPNIVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAY 539

Query: 571 SDVK-GDCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
                G+ S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +    
Sbjct: 540 PKASVGENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLE 596

Query: 619 KNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +G+ IV  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 597 ASGFKIVGHVHDEVIVEIPKDSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|304436359|ref|ZP_07396335.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304370628|gb|EFM24277.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 641

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 212/710 (29%), Positives = 331/710 (46%), Gaps = 105/710 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L +D+ETRS   + + GV+ Y  AE   I L  Y+ D   V++ D      +P ++L
Sbjct: 1   MKSLSVDLETRSSVDIGQSGVYRYTEAEDFAILLFGYSVDGGAVQVIDLVRGERIPQEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKK---TLGIDIPSKR--------WICTSVLARTNGLPS 107
             L D++V+  A N+ FER+   +    LG+   ++R        W CT V +   GLP 
Sbjct: 61  DALADDSVIKWAFNANFERVCLSRYLSDLGMLHTTERAHFLSPRSWRCTMVWSAYMGLPL 120

Query: 108 SLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDV 167
           SL      L   E   KM EGKALI  F      +PP+        + W+LF  Y +RDV
Sbjct: 121 SLAVVARVLGLEEQ--KMTEGKALIRYF-----STPPFHEPTG---EKWELFKSYNRRDV 170

Query: 168 EA----TRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           E      + LFK  +P S  E   ++LDQ INDRG  +D+  V    ++ A  ++K+ + 
Sbjct: 171 EVEMAIQQRLFKYPVPQSVWEE--YVLDQEINDRGICLDMPFVENAVKIDAHTKEKMTDR 228

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  LT   + +      ++ +L    G++   + + T+ ++L+  N++ L K+++  R  
Sbjct: 229 LKTLTG--LENPNSVAQMKAWL-KEQGVETESLDKKTVAALLT--NVSALLKEVLELRQQ 283

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ-----ERSEE 338
            + S++ K   +   V +D R RG  QFYGA+RTGR+SG   Q QNLP+      E +  
Sbjct: 284 LAKSSVKKYQAMQNTVCADNRARGMFQFYGANRTGRFSGRHIQLQNLPQNHLANLEYARS 343

Query: 339 ILTQ-TIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           ++ Q    AL    E+++D L   S  +R+  I   G+K +VAD + IEARVL+W+A E 
Sbjct: 344 LVRQGNFAALELLYESVSDVL---SQLIRTAFIPKEGRKFIVADFSAIEARVLSWLAKER 400

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMASH 454
           W++  FAN  DIY  T  + F+  + K  +    R  GK  ELA GY G     K     
Sbjct: 401 WRMDVFANDGDIYCATAGRMFHCNVVKHGENGHLRQKGKQAELACGYGGSVGALKAFG-- 458

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
                                                 A++  +     + +  AWR  +
Sbjct: 459 --------------------------------------ALESGMKEDELKPLVDAWRTAN 480

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
             ++  W  +       ++E      R +     +        + I LPS RRL Y   +
Sbjct: 481 PNIVDFWWAVDRAAKDCIKE------RSITGTHGIKFIYQSGMMFIELPSGRRLAYVKPR 534

Query: 575 -GDCSYLNTATSQL--------MRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIV 625
            G+  +   + + +         R  +YG KL ENI QAISRD+LC  M+  T    DIV
Sbjct: 535 IGENQFGGESITYMGLDLSKKWARIESYGPKLVENITQAISRDLLCYAMQ--TLRSMDIV 592

Query: 626 LTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             VHDE++ E  +    S+ + C  M + P WA+GL L+A+G+E + Y+K
Sbjct: 593 AHVHDELIIECDER--VSLSSACEQMARTPLWAEGLLLRADGFECQFYQK 640


>gi|284024530|ref|ZP_06378928.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           132]
          Length = 653

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 217/717 (30%), Positives = 325/717 (45%), Gaps = 107/717 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K GV+ Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDTEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKYFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYC 163
             L       K + GK LI  F      S P   T+ N           ++ WQ F +YC
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYF------SIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYC 172

Query: 164 KRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLD 221
            RDVE    +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L 
Sbjct: 173 IRDVEVEMTIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELL 232

Query: 222 EDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNR 281
           +    +T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  R
Sbjct: 233 KQAKHITG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKVA--TGKAKKMLEIR 288

Query: 282 LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILT 341
           L  S +++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L 
Sbjct: 289 LQMSKTSVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL- 346

Query: 342 QTIQALNRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
           +  + L + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A
Sbjct: 347 EIARDLIKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYA 406

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTM 451
            E W++  F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M
Sbjct: 407 KEQWRLDVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAM 466

Query: 452 AS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
            +   G++  +    V S                                         W
Sbjct: 467 GALEMGIEENELQGLVDS-----------------------------------------W 485

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
           R  +  ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y
Sbjct: 486 RNANPNIVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAY 539

Query: 571 SD-VKGDCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
              + G+ S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +    
Sbjct: 540 PKALVGENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLE 596

Query: 619 KNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +G+ IV  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 597 ASGFKIVGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|148267473|ref|YP_001246416.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH9]
 gi|150393526|ref|YP_001316201.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH1]
 gi|147740542|gb|ABQ48840.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149945978|gb|ABR51914.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH1]
          Length = 653

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 216/717 (30%), Positives = 322/717 (44%), Gaps = 107/717 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYC 163
             L       K + GK LI  F      S P   T+ N           ++ WQ F +YC
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYF------SIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYC 172

Query: 164 KRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLD 221
            RDVE    +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L 
Sbjct: 173 IRDVEVEMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELL 232

Query: 222 EDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNR 281
                +T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  R
Sbjct: 233 NQAKHITG--LENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIR 288

Query: 282 LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILT 341
           L  S +++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L 
Sbjct: 289 LQMSKTSVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL- 346

Query: 342 QTIQALNRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
           +  + L + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A
Sbjct: 347 EIARDLIKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYA 406

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTM 451
            E W++  F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M
Sbjct: 407 KEQWRLDVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAM 466

Query: 452 AS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
            +   G++  +    V S                                         W
Sbjct: 467 GALEMGIEENELQGLVDS-----------------------------------------W 485

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
           R  +  ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y
Sbjct: 486 RNANPNIVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAY 539

Query: 571 SDVK-GDCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
                G+ S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +    
Sbjct: 540 PKASVGENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLE 596

Query: 619 KNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +G+ IV  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 597 ASGFKIVGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|257428253|ref|ZP_05604651.1| DNA polymerase [Staphylococcus aureus subsp. aureus 65-1322]
 gi|258419942|ref|ZP_05682901.1| DNA polymerase [Staphylococcus aureus A9719]
 gi|282905878|ref|ZP_06313733.1| DNA polymerase [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282928293|ref|ZP_06335897.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9765]
 gi|257275094|gb|EEV06581.1| DNA polymerase [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257844067|gb|EEV68457.1| DNA polymerase [Staphylococcus aureus A9719]
 gi|282331170|gb|EFB60684.1| DNA polymerase [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282591964|gb|EFB96997.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9765]
          Length = 653

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 214/711 (30%), Positives = 323/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y     G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|257432437|ref|ZP_05608800.1| DNA polymerase [Staphylococcus aureus subsp. aureus E1410]
 gi|257283316|gb|EEV13448.1| DNA polymerase [Staphylococcus aureus subsp. aureus E1410]
          Length = 653

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 214/711 (30%), Positives = 324/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKNDQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD-VKG 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y   + G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|215401125|ref|YP_002332380.1| putative DNA polymerase [Staphylococcus phage phiSauS-IPLA35]
 gi|215260476|gb|ACJ64606.1| gp17 [Staphylococcus phage phiSauS-IPLA35]
          Length = 650

 Score =  262 bits (669), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 215/712 (30%), Positives = 321/712 (45%), Gaps = 107/712 (15%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SDLLQY- 60
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D   + 
Sbjct: 3   IDIETYSNNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADYETFK 62

Query: 61  --LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPDVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVE 168
                K + GK LI  F      S P   T+ N           ++ WQ F +YC RDVE
Sbjct: 123 QNQ--KDKAGKNLIRYF------SIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVE 174

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
               +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    
Sbjct: 175 VEMTIANKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKH 234

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           +T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S 
Sbjct: 235 ITG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKEA--TGKAKKMLEIRLQMSK 290

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           +++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + 
Sbjct: 291 TSVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARD 348

Query: 347 LNRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
           L + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W+
Sbjct: 349 LIKDQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWR 408

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HC 455
           +  F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   
Sbjct: 409 LDVFNTHGKIYEASASQMFNVPVESITKGDSLRQKGKVSELALGYQGGAGALKAMGALEM 468

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
           G++  +    V S                                         WR  + 
Sbjct: 469 GIEENELQGLVDS-----------------------------------------WRNANP 487

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK- 574
            ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y     
Sbjct: 488 NIVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASV 541

Query: 575 GDCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYD 623
           G+ S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ 
Sbjct: 542 GENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFK 598

Query: 624 IVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           IV  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 599 IVGHVHDEVIVEIPKDSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|258448861|ref|ZP_05696971.1| DNA polymerase [Staphylococcus aureus A6224]
 gi|257857898|gb|EEV80789.1| DNA polymerase [Staphylococcus aureus A6224]
          Length = 653

 Score =  262 bits (669), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 213/711 (29%), Positives = 323/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT + +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMINSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y     G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|295407651|ref|ZP_06817440.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8819]
 gi|297246752|ref|ZP_06930567.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8796]
 gi|294967465|gb|EFG43505.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8819]
 gi|297176378|gb|EFH35651.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8796]
          Length = 650

 Score =  262 bits (669), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 213/706 (30%), Positives = 321/706 (45%), Gaps = 95/706 (13%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SDLLQY- 60
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D   + 
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADFETFK 62

Query: 61  --LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE    + 
Sbjct: 123 QNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +T   +
Sbjct: 181 HKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG--L 238

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +++ K 
Sbjct: 239 ENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L + + 
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDLIKEQR 354

Query: 353 IAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F  
Sbjct: 355 FDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNT 414

Query: 405 GEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCGLDLQQ 461
              IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G++  +
Sbjct: 415 HGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENE 474

Query: 462 FSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLW 521
               V S                                         WR  +  ++  W
Sbjct: 475 LQGLVDS-----------------------------------------WRNANPNIVNFW 493

Query: 522 KDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-GDCSY- 579
           K      AC      ++ +R+  +   L     K  + I LPS R L Y     G+ S+ 
Sbjct: 494 K------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGENSWG 547

Query: 580 ----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                     LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 604

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 605 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|262053228|ref|ZP_06025380.1| putative DNA polymerase [Staphylococcus aureus 930918-3]
 gi|259158878|gb|EEW43970.1| putative DNA polymerase [Staphylococcus aureus 930918-3]
          Length = 653

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 214/711 (30%), Positives = 323/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y     G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYIKKGFLMIELPSGRALAYPKASVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|290466795|gb|ADD25725.1| putative DNA polymerase [Lactococcus phage 1358]
          Length = 653

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 219/707 (30%), Positives = 326/707 (46%), Gaps = 94/707 (13%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L IDIET S   L   GV+ YA      I L +Y + DEPV   D  +   +PS +L+ L
Sbjct: 5   LHIDIETFSDVDLAGCGVYRYAASPAFYIQLFSYRFGDEPVTRLDLQQGDVIPSKVLRAL 64

Query: 62  RDETVMCVAHNSLFERILFKKTL-GIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           RD   + VAHN+ FER+     L G  +    W CT V     GLP SL     AL    
Sbjct: 65  RDPKRIKVAHNAQFERVCIGYELDGRPLDPTNWRCTMVWGSCLGLPQSLDGMGKALGLD- 123

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRAN---------HV-QAWQLFGEYCKRDVEAT 170
            + K +EGK LI  F K      P   T+AN         H  + W+ +G+Y + DVE  
Sbjct: 124 -VQKDKEGKRLIQYFSK------PCKPTKANGGRTQNLPEHAPEDWEHYGKYNEIDVEVE 176

Query: 171 RELFKRLIPLSDGERDLWL---LDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
             +  +L  + +   D W     DQ IND G  +D+  V +  +L  + +K+    + +L
Sbjct: 177 TGISDKLAAIYELPADEWRGYENDQRINDAGVPVDVPFVRQAIKLKDKLKKRSSMKLRRL 236

Query: 228 TDGIIRSSRQTYALRMYL----FLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           T   + S  +   L+ +     + +  +D     E  L     H +  ++ + + L + A
Sbjct: 237 TG--VESVTKVQQLKAWAAAQGYPVESLD-KQHCEDYLNDPELHQDFPEVYRMIELYQEA 293

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
             G+A+ K + +   +  DG ++G L+F GA  T RW+G   Q QNLPR     + L   
Sbjct: 294 G-GAAVAKYDKIMAQLMPDGTIKGQLRFCGAGATARWAGKGVQVQNLPRVYLKADKLEAA 352

Query: 344 IQALNRGETIA-----DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
            Q + +G+T+      +P+ + +  VR+ +      +  V+D + IEARV+AW AGE W 
Sbjct: 353 RQIVAKGKTVGLKKFGNPIDVITQLVRTSLKPPTDYEFGVSDYSAIEARVVAWFAGESWV 412

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS-HCGL 457
           +KAF +GEDIYV T +K ++   ++ ++  R  GK   LALGYQGGA     M +   G+
Sbjct: 413 LKAFEDGEDIYVATASKMYHVTGEE-AEAMRQKGKQATLALGYQGGANALIVMGALRAGI 471

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
                                       +++ PE                + WR  +  +
Sbjct: 472 P---------------------------EEELPELV--------------QLWRKANPNI 490

Query: 518 LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIV---LPSSRRLVYSDVK 574
           + LW  + +     +  GG  + R V    +LV+  +K D H++   LPS R+L Y D K
Sbjct: 491 VNLWHTVDKAARMAINNGG--AKRYVLADGKLVI-SYKGDEHVLQVQLPSGRKLNYFDCK 547

Query: 575 ---GDCSYLNTATSQLMR--ERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                 SYL        R    TYGGKLTEN+VQA SRD+L   +      G   V  VH
Sbjct: 548 IRDNKISYLKGVRGDGSRFYADTYGGKLTENLVQATSRDLLLAALMRIEAAGIQTVFHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKN-PSWAKGLPLKAEGYEAKRYRK 675
           DE ++  P+     +  + +LMT   P WA GLPL +EG   K YRK
Sbjct: 608 DETINIVPEGT--KIEEINNLMTSPAPEWADGLPLDSEGDVIKYYRK 652


>gi|282926447|ref|ZP_06334079.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A10102]
 gi|282591776|gb|EFB96847.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A10102]
          Length = 653

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 213/711 (29%), Positives = 323/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y     G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WA+GL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVEWAEGLNLNSDGFTSPFYMK 652


>gi|21283154|ref|NP_646242.1| DNA polymerase [Staphylococcus aureus subsp. aureus MW2]
 gi|300911890|ref|ZP_07129333.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|21204594|dbj|BAB95290.1| DNA polymerase [Staphylococcus aureus subsp. aureus MW2]
 gi|300886136|gb|EFK81338.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|315197712|gb|EFU28046.1| DNA polymerase [Staphylococcus aureus subsp. aureus CGS01]
          Length = 653

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 213/711 (29%), Positives = 323/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           ++  WK      AC      ++ +R+  +   +     K  + I LPS R L Y     G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGVRFYMKKGFLMIELPSGRALAYPKASVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|156603970|ref|YP_001429916.1| hypothetical protein SPTP3102_gp21 [Staphylococcus phage tp310-2]
 gi|154818056|gb|ABS87483.1| hypothetical protein [Staphylococcus phage tp310-2]
          Length = 650

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 214/706 (30%), Positives = 322/706 (45%), Gaps = 95/706 (13%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SDLLQY- 60
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D   + 
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADYETFK 62

Query: 61  --LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE    + 
Sbjct: 123 QSQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMAIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +T   +
Sbjct: 181 NKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG--L 238

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +++ K 
Sbjct: 239 ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L + + 
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDLIKEQR 354

Query: 353 IAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F  
Sbjct: 355 FDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNT 414

Query: 405 GEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCGLDLQQ 461
              IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G++  +
Sbjct: 415 HGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENE 474

Query: 462 FSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLW 521
               V S                                         WR  +  ++  W
Sbjct: 475 LQGLVDS-----------------------------------------WRNANPNIVNFW 493

Query: 522 KDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD-VKGDCSY- 579
           K      AC      ++ +R+  +   L     K  + I LPS R L Y   + G+ S+ 
Sbjct: 494 K------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVGENSWG 547

Query: 580 ----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                     LN   S+L   +TYGGKL ENIVQA +RD+L   +      GY IV  VH
Sbjct: 548 SQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEALGYKIVGHVH 604

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 605 DEVIVEIPRGSN-GLKEIETIMNKPVEWAKGLNLNSDGFTSPFYMK 649


>gi|284048474|ref|YP_003398813.1| DNA-directed DNA polymerase [Acidaminococcus fermentans DSM 20731]
 gi|283952695|gb|ADB47498.1| DNA-directed DNA polymerase [Acidaminococcus fermentans DSM 20731]
          Length = 662

 Score =  260 bits (665), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 224/735 (30%), Positives = 333/735 (45%), Gaps = 134/735 (18%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ YAE     I L  YA D  PV++ D  +  ++P ++L
Sbjct: 1   MKTLSIDIETYSDVNLAKCGVYKYAESPAFEILLFGYAVDGGPVQVVDLAQGESIPEEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL-----GID---------------IPSKRWICTSV 98
             L D+TV   A N+ FER+   + L      +D               +    W C+ V
Sbjct: 61  DALTDDTVTKWAFNANFERVCLSRHLTDLGRSLDPFHDQHPLSKKCARFLNPAGWKCSMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN------- 151
            +   GLP SL+     LN      KM+EG+ LI  FC       P   T+AN       
Sbjct: 121 WSAYLGLPLSLEGVGAVLNLDNQ--KMKEGRELIRYFCI------PCKETKANGGRTRNL 172

Query: 152 ---HVQAWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV 206
               +  W LF  Y KRDVE    + +RL   P+     + + LDQ INDRG  IDL+L 
Sbjct: 173 PQHALDKWNLFKSYNKRDVEVEMAIQQRLQKYPVPKQVWEEYHLDQEINDRGIAIDLELA 232

Query: 207 LKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILS 266
            +   L A+ R+ L           + + ++   L     +I  +D ++   G     L 
Sbjct: 233 KQAVALDAKSRESL-----------MAALKERTGLENPNSVIQMLDWLE-QHGLKTDSLG 280

Query: 267 HSNITQLAK-------DLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGR 319
             N+ +L K        ++L R   + S++ K   +      DGR RG  QFYGA+RTGR
Sbjct: 281 KKNVQELLKTAQEPLRSVLLLRQKLAKSSVKKYQAMEMTACKDGRARGMFQFYGANRTGR 340

Query: 320 WSGCVFQPQNLPRQ------ERSEEILTQTIQALNR-GETIADPLGLASDCVRSCIIASN 372
           ++G   Q QNLP+       E  E +     +AL+   ++I D L   S  +R+  +   
Sbjct: 341 FAGRHIQLQNLPQNHLPDLSEARELVRQGNYEALDLLYDSIPDVL---SQLIRTAFVPRA 397

Query: 373 GKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRA 430
           G K VV+D + IEARV++W+AGE WK + FA G+DIY +T ++ F  P+ K  ++   R 
Sbjct: 398 GMKFVVSDFSAIEARVISWLAGERWKSEDFAAGKDIYCSTASQMFGVPVVKHGINGNLRQ 457

Query: 431 IGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYP 490
            GK+ ELA GY G     K M +   LD+                               
Sbjct: 458 KGKIAELACGYGGSVGALKAMGA---LDM------------------------------- 483

Query: 491 EFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLV 550
              + ++ +G     + ++WR+ +  ++  W  +       +++   +    +    +  
Sbjct: 484 --GIPEEELGN----LVQSWRSANPHIVDFWWQVDGAVKTTIKQRIPVWVNNIRFFCQSG 537

Query: 551 MRRHKRDVHIVLPSSRRLVYSDVK-GDCSYLNT--------ATSQLMRERTYGGKLTENI 601
           M      + I LPS RRL Y   + G+  +           AT +  +  +YG K  ENI
Sbjct: 538 M------LFIELPSGRRLSYVKPRIGENRFGGESVTYEGIGATKKWEQLESYGPKFVENI 591

Query: 602 VQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP-DTPYFSVGTLCSLMTKNPSWAKG 660
           VQ ISRDILC  M+  T     IV  VHDE++ E P DT   SV  +C  M + P WA+G
Sbjct: 592 VQGISRDILCYAMQ--TLRCCAIVGHVHDELIIECPKDT---SVDAICEEMGRTPPWAEG 646

Query: 661 LPLKAEGYEAKRYRK 675
           L L+A+GY  + Y+K
Sbjct: 647 LVLRADGYACEFYQK 661


>gi|87161801|ref|YP_494120.1| phage related DNA polymerase family A [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|161509702|ref|YP_001575361.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|294848501|ref|ZP_06789247.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9754]
 gi|87127775|gb|ABD22289.1| phage related DNA polymerase, family A [Staphylococcus aureus
           subsp. aureus USA300_FPR3757]
 gi|160368511|gb|ABX29482.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|294824527|gb|EFG40950.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9754]
 gi|302333141|gb|ADL23334.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus JKD6159]
 gi|320140648|gb|EFW32502.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320142780|gb|EFW34583.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           MRSA177]
          Length = 650

 Score =  260 bits (665), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 212/706 (30%), Positives = 321/706 (45%), Gaps = 95/706 (13%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SDLLQY- 60
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D   + 
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADFETFK 62

Query: 61  --LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE    + 
Sbjct: 123 QNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +T   +
Sbjct: 181 HKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITG--L 238

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +++ K 
Sbjct: 239 ENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L + + 
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDLIKEQR 354

Query: 353 IAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F  
Sbjct: 355 FDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNT 414

Query: 405 GEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCGLDLQQ 461
              IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G++  +
Sbjct: 415 HGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENE 474

Query: 462 FSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLW 521
               V S                                         WR  +  ++  W
Sbjct: 475 LQGLVDS-----------------------------------------WRNANPNIVNFW 493

Query: 522 KDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-GDCSY- 579
           K      AC      ++ +R+  +   +     K  + I LPS R L Y     G+ S+ 
Sbjct: 494 K------ACQEAAINTVKSRKTHHTHGVRFYMKKGFLMIELPSGRALAYPKASVGENSWG 547

Query: 580 ----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                     LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 604

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 605 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|315128370|gb|EFT84381.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           CGS03]
          Length = 653

 Score =  260 bits (665), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 213/711 (29%), Positives = 324/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDDEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKEA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   +  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTSEEGNELAVSDFSAIEARVIAWYAKERWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y     G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     +G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|258646421|ref|ZP_05733890.1| prophage LambdaSa04, DNA polymerase [Dialister invisus DSM 15470]
 gi|260403824|gb|EEW97371.1| prophage LambdaSa04, DNA polymerase [Dialister invisus DSM 15470]
          Length = 656

 Score =  260 bits (664), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 213/714 (29%), Positives = 316/714 (44%), Gaps = 98/714 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K G++ Y E  V  + L AYA+D   V + D  +   +P  ++
Sbjct: 1   MKHLSIDIETFSDVDIKKSGLFKYCESPVFELLLFAYAYDFGDVHVVDLAQGEKIPDSVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L +  V+  A+N+ FE I      G     ++W CT +     G P+ L     AL  
Sbjct: 61  SDLNNPEVIKHAYNASFE-ITGLNRYGYATSPEQWRCTMLHGLYLGYPAGLAFLGAALGI 119

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVE 168
            E   K+  GKALI  FC       P   T+ N           +  W LF EY  +DV 
Sbjct: 120 PEDKRKLSTGKALIRYFCV------PCKPTKRNGGRTRNLPKHDIDKWHLFKEYNAQDVV 173

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
              E ++RL   P+    +D W++D  +N RG ++D+DLV     +  Q + +L E  ++
Sbjct: 174 TEMEDYRRLSAYPVPGWVQDDWVIDYELNRRGIQLDMDLVRGALAIDDQHKTELVEKAIQ 233

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS--NITQLAKDLILN---- 280
           +T     +SR          L+T I+  D S+  L+ +   +     Q+A+D +      
Sbjct: 234 ITGLTNPNSRNQ--------LLTWIN--DNSDLKLEKLTKETVAESLQIAEDQVAEVLHI 283

Query: 281 RLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEIL 340
           R A + S+I K  ++  AV +DGR+RG LQFYGA+RTGRW+G + Q QNLP        +
Sbjct: 284 RRALAKSSISKYESMKNAVCADGRIRGVLQFYGANRTGRWAGRLVQVQNLPHD--VPVAM 341

Query: 341 TQTIQALNRGETIADPLGLA------SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
              I+ +  G      L         S  +R+  +A  G  L V+D + IEARVL+W+A 
Sbjct: 342 DTAIRLVKNGNARGVKLMYGHISTSLSHLIRAAFVAPEGSLLCVSDFSAIEARVLSWLAD 401

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           E W+   FA G DIY  + +  F  P++K  ++   R  GKV ELALGYQGG     TM 
Sbjct: 402 EKWRQDVFAKGGDIYCASASSMFGVPVEKHGINGHLRQKGKVAELALGYQGGPPALITMG 461

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
           +            +K   T              +D+ P+   +              WR 
Sbjct: 462 A------------LKQGLT--------------EDELPDIVHR--------------WRG 481

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRD-VHIVLPSSRRLVYS 571
            +  +   W D+      V+ +   +       + R     +  D + I LPS R+L Y 
Sbjct: 482 ANPRICGFWYDVDGAALSVMSDARPVGLPHGILISRECNLLYGYDYLTIRLPSGRKLYYP 541

Query: 572 DV--------KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYD 623
                     K    Y   A  +     TYGGKL ENI QAI+RD L   +    K GY 
Sbjct: 542 QPYINENQFGKPALHYRVQAGIKWSHTSTYGGKLVENITQAIARDCLALAINRLVKAGYK 601

Query: 624 IVLTVHDEIVSETPDTPYF--SVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            ++ +HDE+V E P        +  +  +M     WA GL L A+G+ +  Y K
Sbjct: 602 PLMHIHDEVVLEVPKDKIHEDEIDRINQIMCAPIPWAPGLLLNADGFISPYYTK 655


>gi|66395659|ref|YP_240050.1| ORF003 [Staphylococcus phage 47]
 gi|282911107|ref|ZP_06318909.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|297207805|ref|ZP_06924239.1| bacteriophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|62636083|gb|AAX91194.1| ORF003 [Staphylococcus phage 47]
 gi|282324802|gb|EFB55112.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|296887521|gb|EFH26420.1| bacteriophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|312438063|gb|ADQ77134.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus TCH60]
 gi|329724432|gb|EGG60942.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           21189]
          Length = 653

 Score =  260 bits (664), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 214/711 (30%), Positives = 324/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQSQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMAIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD-VKG 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y   + G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +      G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEALGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|29028629|ref|NP_803318.1| DNA polymerase A domain [Staphylococcus phage phi 12]
 gi|88195276|ref|YP_500079.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|258428683|ref|ZP_05688217.1| phage encoded DNA polymerase I [Staphylococcus aureus A9299]
 gi|18920553|gb|AAL82293.1| DNA polymerase A domain [Staphylococcus phage phi 12]
 gi|87202834|gb|ABD30644.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|257849738|gb|EEV73702.1| phage encoded DNA polymerase I [Staphylococcus aureus A9299]
          Length = 650

 Score =  259 bits (663), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 213/706 (30%), Positives = 322/706 (45%), Gaps = 95/706 (13%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SDLLQY- 60
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D   + 
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADYETFK 62

Query: 61  --LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE    + 
Sbjct: 123 QSQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMAIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +T   +
Sbjct: 181 NKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITG--L 238

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +++ K 
Sbjct: 239 ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L + + 
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDLIKEQR 354

Query: 353 IAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F  
Sbjct: 355 FDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNT 414

Query: 405 GEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCGLDLQQ 461
              IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G++  +
Sbjct: 415 HGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENE 474

Query: 462 FSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLW 521
               V S                                         WR  +  ++  W
Sbjct: 475 LQGLVDS-----------------------------------------WRNANPNIVNFW 493

Query: 522 KDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD-VKGDCSY- 579
           K      AC      ++ +R+  +   L     K  + I LPS R L Y   + G+ S+ 
Sbjct: 494 K------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVGENSWG 547

Query: 580 ----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                     LN   S+L   +TYGGKL ENIVQA +RD+L   +      G+ IV  VH
Sbjct: 548 SQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVH 604

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 605 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|258445211|ref|ZP_05693406.1| DNA-directed DNA polymerase [Staphylococcus aureus A6300]
 gi|257855972|gb|EEV78892.1| DNA-directed DNA polymerase [Staphylococcus aureus A6300]
          Length = 653

 Score =  259 bits (662), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 212/711 (29%), Positives = 324/711 (45%), Gaps = 95/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK + ++         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRLQNQ--KDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S +
Sbjct: 239 TG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKEA--TGKAKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + L
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARDL 352

Query: 348 NRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
            + +   D        P  L S  VR+   +  G +L V+D + IEARV+AW A E W++
Sbjct: 353 IKEQRFDDLDLLLNVHPQDLLSQLVRTTFTSEEGNELAVSDFSAIEARVIAWYAKEQWRL 412

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCG 456
             F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   G
Sbjct: 413 DVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMG 472

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           ++  +    V S                                         WR  +  
Sbjct: 473 IEENELQGLVDS-----------------------------------------WRNANPN 491

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y     G
Sbjct: 492 IVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVG 545

Query: 576 DCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + S+           LN   S+L   +TYGGKL ENIVQA +R++L   +     +G+ I
Sbjct: 546 ENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARELLAISIARLEASGFKI 602

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 603 VGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|260161774|emb|CAZ39318.1| phage polymerase [Streptococcus suis]
 gi|313575356|emb|CBR26885.1| hypothetical protein [Streptococcus phage phi-SsUD.1]
          Length = 651

 Score =  259 bits (662), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 217/715 (30%), Positives = 326/715 (45%), Gaps = 107/715 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAW--DDEPVKLWDRTEQSAMPSDLL 58
           + +L IDIET     L K GV+ YAE     L  +A   D+ PV ++D  ++  +P D+L
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDDSFELLLFAVSVDNGPVTVYDFNKEK-LPQDIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPS---------KRWICTSVLARTNGLPSSL 109
           + L D+ V+  A N+ FERI     L    P            W C+ + +   GLP SL
Sbjct: 62  EALVDDRVIKWAFNASFERICLSNWLKKHHPELLLDGFLSPNSWRCSMIWSAYLGLPLSL 121

Query: 110 KNACLALNFSEHLTKMEEGKALIARFC---------KGSIDSPPYDCTRANHVQAWQLFG 160
           +     L   +   KM EG  LI  FC          G I + P+          W  F 
Sbjct: 122 EGVGTVLKLKD--KKMREGADLIRYFCVPCKPTKVNGGRIRNFPHHAP-----NKWSTFI 174

Query: 161 EYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           +Y +RDVE    + +RL   P+ D   D +  DQ INDRG  ID+D V    ++ ++ + 
Sbjct: 175 DYNRRDVEVELAIKERLKNFPVPDFVWDEYHQDQIINDRGIGIDIDFVKAAIKIDSESKA 234

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLIT-GIDLVDMSEGTLKSILSHSNITQLAKDL 277
           K+ E++  LT    R       L+M  +L   G+    + +  +K +L  ++ T  A+ L
Sbjct: 235 KIQEELKALT----RLENPNSVLQMIGWLREHGVTTDSLDKKVVKELLKTADETT-AQVL 289

Query: 278 ILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR----- 332
            L + A+  S++ K   +   V  DGR RG  QF+GA+RTGRW+G + Q QNLP+     
Sbjct: 290 KLRQQAAK-SSVSKYQAMMNCVCKDGRARGMFQFFGANRTGRWAGRLVQLQNLPQNHLPD 348

Query: 333 -QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
            +E  E   T  ++A    E + D     S  +R+  + S GKK +V D + IEARVL+ 
Sbjct: 349 LEEARELFGTGDLEAT---EFLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSH 405

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFK 449
           +AGE W+ K F  G+DIY  + ++ F  P++K  +  E R  GK+ ELA GY G     K
Sbjct: 406 LAGERWRSKVFEQGKDIYCISASQMFGVPVEKYGQNSELRQKGKIAELACGYGGSVGALK 465

Query: 450 TMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKA 509
            M +   LD+                                  +KDK +    +    +
Sbjct: 466 AMGA---LDM---------------------------------GLKDKELRPLVD----S 485

Query: 510 WRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLV 569
           WR  +  ++  W D+       +++        +          +K  + I LPS R+L 
Sbjct: 486 WRQANPNIVLFWWDVDRAVKTAIKQHIQTETHGIQ------FEVNKGMLSITLPSGRKLA 539

Query: 570 YSDVK--------GDCSYLNTATSQ-LMRERTYGGKLTENIVQAISRDILCEGMKNATKN 620
           Y   K           +Y  T T++   R  +YG K  ENIVQAISRDIL   MK   + 
Sbjct: 540 YVKPKIGENQFGGESITYEGTGTAKRWERLESYGPKFVENIVQAISRDILAFAMKQLQE- 598

Query: 621 GYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            ++IV  VHDE++ E       S+  +  LM   P W   + L+A+GYE   Y+K
Sbjct: 599 -FNIVGHVHDEVIIECGIDQ--SLDEIAYLMGIAPEWMTDIKLRADGYECSFYQK 650


>gi|153581904|emb|CAM34262.1| phage polymerase [Streptococcus pyogenes]
 gi|262113717|emb|CAR95384.1| hypothetical protein [Streptococcus phage phi-m46.1]
          Length = 651

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 222/717 (30%), Positives = 324/717 (45%), Gaps = 111/717 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAW--DDEPVKLWDRTEQSAMPSDLL 58
           + +L IDIET     L K GV+ YAE     L  +A   D+ PV ++D  ++  +P D+L
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDDSFELLLFAVSVDNGPVTVYDFNKEK-LPQDIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPS---------KRWICTSVLARTNGLPSSL 109
           + L D+ V+  A N+ FERI     L    P            W C+ + +   GLP SL
Sbjct: 62  EALVDDRVIKWAFNASFERICLSNWLKKHHPELLLDGFLSPNSWRCSMIWSAYLGLPLSL 121

Query: 110 KNACLALNFSEHLTKMEEGKALIARFC---------KGSIDSPPYDCTRANHVQAWQLFG 160
           +     L   +   KM EG  LI  FC          G I + P+          W  F 
Sbjct: 122 EGVGTVLKLKD--KKMREGADLIRYFCVPCKPTKVNGGRIRNFPHHAP-----DKWSAFI 174

Query: 161 EYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           +Y +RDVE    + +RL   P+ D   D +  DQ INDRG  ID+D V    ++  + + 
Sbjct: 175 DYNRRDVEVELAIKERLKNFPVPDFVWDEYHQDQIINDRGLGIDVDFVKAAIKIDRESKA 234

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLIT-GIDLVDMSEGTLKSILSHSNITQLAKDL 277
           K+ E++  LT G+         L+M  +L   G+    + +  +K +L    + +    +
Sbjct: 235 KIQEELKALT-GL---ENPNSVLQMIGWLREHGVTTDSLDKKAVKGLLK--TVDETTAQV 288

Query: 278 ILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR----- 332
           +  R  ++ S++ K   +   V  DGR RG  QFYGA+RTGRW+G + Q QNLP+     
Sbjct: 289 LKLRQQAAKSSVSKYQAMMNCVCKDGRARGMFQFYGANRTGRWAGRLVQLQNLPQNHLPD 348

Query: 333 -QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
            +E  E   T  ++A    E I D     S  +R+  + S GKK +V D + IEARVL+ 
Sbjct: 349 LEEARELFGTGDLEAT---ELIYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSH 405

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFK 449
           +AGE W+ K F  G+DIY  + ++ F  P++K  +  E R  GK+ ELA GY G     K
Sbjct: 406 LAGERWRSKVFEQGKDIYCMSASQMFGVPVEKHGQNSELRQKGKIAELACGYGGSVGALK 465

Query: 450 TMAS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKK 508
            M +   GL  ++    V S                                        
Sbjct: 466 AMGALDMGLTEEELQPLVNS---------------------------------------- 485

Query: 509 AWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVA-NVPRLVMRRHKRDVHIVLPSSRR 567
            WR  +  ++  W D+       V+E    S   +   V R ++        I LPS R+
Sbjct: 486 -WRLANPNIVLYWWDVDNAVKTAVKELIPTSTHGIQFEVKRGIL-------FITLPSGRK 537

Query: 568 LVYSDVK-GD-------CSYLNTATSQ-LMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
           L Y   + GD        +Y  T T++   R  +YG K  ENIVQAISRDIL   MK   
Sbjct: 538 LAYIKPRIGDNQFGGESVTYEGTGTAKRWERLESYGPKFVENIVQAISRDILAFSMKQ-L 596

Query: 619 KNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           KN + IV  VHDE++ E P      +  + SLM   P W   + L+A+GYE   Y+K
Sbjct: 597 KN-FKIVGHVHDEVIIECPIEQ--KLDEVASLMGIAPDWLSDINLRADGYECFFYQK 650


>gi|323440323|gb|EGA98037.1| phage related DNA polymerase family A [Staphylococcus aureus O11]
          Length = 650

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 214/712 (30%), Positives = 320/712 (44%), Gaps = 107/712 (15%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SDLLQY- 60
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D   + 
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPVHADYETFK 62

Query: 61  --LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVE 168
                K + GK LI  F      S P   T+ N            + WQ F +YC RDVE
Sbjct: 123 QSQ--KDKAGKNLIRYF------SMPCKPTKVNGGRTRNLPEHDPEKWQQFIDYCIRDVE 174

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
               +  ++   P+++ E+  W+ DQ INDRG ++   L+L    L  Q +++L +    
Sbjct: 175 VEMTIANKIKDFPVTEIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKH 234

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           +T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S 
Sbjct: 235 ITG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKEA--TGKAKKMLEIRLQMSK 290

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           +++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L +  + 
Sbjct: 291 TSVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL-EIARD 348

Query: 347 LNRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
           L + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A E W+
Sbjct: 349 LIKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWR 408

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HC 455
           +  F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M +   
Sbjct: 409 LDVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEM 468

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
           G++  +    V S                                         WR  + 
Sbjct: 469 GIEENELQGLVDS-----------------------------------------WRNANP 487

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK- 574
            ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y     
Sbjct: 488 NIVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASV 541

Query: 575 GDCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYD 623
           G+ S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +     + + 
Sbjct: 542 GENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASVFK 598

Query: 624 IVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           IV  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 599 IVGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|306826828|ref|ZP_07460129.1| DNA-directed DNA polymerase [Streptococcus pyogenes ATCC 10782]
 gi|304430991|gb|EFM33999.1| DNA-directed DNA polymerase [Streptococcus pyogenes ATCC 10782]
          Length = 643

 Score =  256 bits (653), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 222/724 (30%), Positives = 331/724 (45%), Gaps = 134/724 (18%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           ++ +D+ET S   + K GV+ YA  E   I   +Y+ +   V L D T++   P  L  +
Sbjct: 2   RIDLDLETYSSNDI-KNGVYKYADAEDFDILFMSYSINFGDVVLVDLTKEE-FPEFLKNH 59

Query: 61  LRDETVMCVAHNSLFERI----LFKK---TLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
           + +      A N++FERI     F+K   + G   P K W    V A+  GLP+SL+   
Sbjct: 60  ILNADATFWAWNTVFERICLSMYFQKKGWSKGYFDP-KNWKDIMVHAQELGLPASLERCA 118

Query: 114 LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYC 163
             L   E   K   GKALI  F      S P   T+AN            + W+ +GEY 
Sbjct: 119 SYLGLEEQ--KDTRGKALIRYF------SIPCKPTKANGGRTRNLPEHDPEKWEEYGEYN 170

Query: 164 KRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLD 221
            +DV     + ++L  +P+ D E D +  DQ INDRG  +D +LV         + + L 
Sbjct: 171 VQDVVTQMAIAEKLESVPVHDREWDHYACDQRINDRGVALDKELVASALYCKDVKMESLS 230

Query: 222 EDIVKLTDGIIRSSRQTYA--LRMYLFLITGIDLVDM------SEGTLKSILSHSNITQL 273
            ++  +T     +SR      L+ + +   G+   D+      +EG LK +L        
Sbjct: 231 GELKAITGLANPNSRAQLLPWLKEHGYSANGLTKADVEQELKTAEGELKRVLEL------ 284

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
                  +L ++ S++ K   +  A+ SDGR+ G LQFYGASRTGRW+G V Q QNL R 
Sbjct: 285 -------KLQTAMSSLKKYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARN 337

Query: 334 ------ERSEEILTQTIQALNRGETIADPLG-LASDCVRSCIIASNGKKLVVADLAGIEA 386
                 +    +  + I A+   E + D L       VR+ ++A +G    V+D + IEA
Sbjct: 338 YIKDLDDARGYVKKRDIDAV---EILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEA 394

Query: 387 RVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAK 446
           RV+AW AGE W++  F+    IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG  
Sbjct: 395 RVIAWFAGEQWRLDVFSTHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPG 454

Query: 447 VFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELV 506
             K M +         +  VK                           +++L G   +  
Sbjct: 455 ALKQMGA--------LNMGVK---------------------------EEELQGLVDD-- 477

Query: 507 KKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSR 566
              WR  ++ ++Q WKD+    A +     +I +R    + +L  R  K  + I LPS R
Sbjct: 478 ---WRRANKKIVQFWKDVQR--AAI----KAIKSRAPIKLGKLRFRYRKGFLFITLPSGR 528

Query: 567 RLVYSDVK---------------GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILC 611
            L Y+  K               GD +Y          + TYGGKL ENIVQA +RDIL 
Sbjct: 529 NLAYARAKVEPGDYGDKIIYEGQGDKAYFTA-------QETYGGKLVENIVQATARDILA 581

Query: 612 EGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAK 671
           E +      G+ +V  VHDE + E       ++  +  LM + P WA+GLPL +EGY  K
Sbjct: 582 EALLRIEAAGHGVVFHVHDEAIIEGSG---LTIEEVNDLMAQAPDWAEGLPLNSEGYVTK 638

Query: 672 RYRK 675
            Y K
Sbjct: 639 YYMK 642


>gi|154794286|gb|ABS86178.1| DNA polymerase [Glycaspis brimblecombei secondary endosymbiont
           phage 1]
          Length = 415

 Score =  254 bits (649), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 156/415 (37%), Positives = 225/415 (54%), Gaps = 16/415 (3%)

Query: 166 DVEATRELFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           D+ ATRE+++ L    ++  E  LW LDQ IN RG  +D++L       +  E+K+L   
Sbjct: 3   DILATREIYQHLPRWNMNVDETTLWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTV 62

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
             +LTD  ++++ Q  AL  ++    GI L DM   TL+  ++  +I    ++L+  RL 
Sbjct: 63  TQQLTDNAVQNATQRDALLQHITSAFGITLPDMQASTLQRRINDPDIPPALRELLSIRLQ 122

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
           S  ++  K   L +++S+DGRLRGT QF GASRTGRW+G +FQP NLPR       +   
Sbjct: 123 SCRTSTSKYKALLKSISADGRLRGTKQFCGASRTGRWAGRIFQPDNLPRPTLDPNTIDNG 182

Query: 344 IQALNRG--ETIADP-LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
           I+AL  G  E I D  + L S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+ 
Sbjct: 183 IEALKAGCAELICDDIMQLTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVN 242

Query: 401 AFA-----NGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHC 455
           AF+      G+D+Y   YA+AFN   + V+K QR IGKVMEL LGY GG   F T A   
Sbjct: 243 AFSEFDNGKGDDLYKLAYARAFNLLPENVTKAQRQIGKVMELGLGYGGGVAAFLTFALAY 302

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
            LDL + +             +A S +    +    + +  K+  T C+ +K+ WR  H 
Sbjct: 303 SLDLAELANAALPNIPLNVKREAISWYQKSVETDKTYGLSKKVFVT-CDSIKRMWRNAHT 361

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
             +  W D+ +     +Q  G     R     +L +RR K  + I LPS R L Y
Sbjct: 362 QTVSFWYDIEDAVKQAIQSPGVAFKCR-----KLSVRRDKSWLRICLPSGRSLCY 411


>gi|225405823|ref|ZP_03761012.1| hypothetical protein CLOSTASPAR_05044 [Clostridium asparagiforme
           DSM 15981]
 gi|225042637|gb|EEG52883.1| hypothetical protein CLOSTASPAR_05044 [Clostridium asparagiforme
           DSM 15981]
          Length = 668

 Score =  253 bits (645), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 209/715 (29%), Positives = 313/715 (43%), Gaps = 96/715 (13%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLLQ-Y 60
           L IDIETRS   + K G + YA+     I L AY WDD PV++ D T   + P ++ +  
Sbjct: 6   LSIDIETRSSVDISKAGAYRYAQSPDFEILLFAYQWDDGPVEVIDLTADESFPPEIWEEA 65

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRD  V+  A+N+ FE     +  G   P  +W CT       G  + L     A+   +
Sbjct: 66  LRDPDVIKHAYNAAFEWYCLNRA-GYATPLDQWRCTMAHGLYCGYTAGLDATGKAIGLPQ 124

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQ----------LFGEYCKRDVEAT 170
              K+  GKALI  FC       P   T++N  + W           LF EYC++DV   
Sbjct: 125 DKQKLAVGKALIRYFCV------PCKPTKSNGGRTWNQPRHDPDKWTLFKEYCRQDVVTE 178

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
            E+ +RL   P+ + E  LW LD  +N  G R+D  L+     +     +KL  + V+LT
Sbjct: 179 HEILRRLNFFPMPEDEERLWQLDVAMNAYGVRVDTKLIAGALYVDEVSTEKLTAEAVELT 238

Query: 229 DGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSIL-SHSNITQLAKDLILNRLA 283
                +S       +        D    L D+ + T++  L    N+ +    ++  R  
Sbjct: 239 GLDNPNSGAQLVPWINAHNKEHPDDPDLLADLRKETVEEALKDRDNLPEDVARMLEIRQQ 298

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE-RSEEILTQ 342
              +++ K   +  A     R+RG  Q+YGA+RTGRW+G + Q QNLPR   ++ +   +
Sbjct: 299 LGKTSVKKYVAMDVARGEGDRVRGLTQYYGANRTGRWAGRLVQLQNLPRNYLKTLDYARE 358

Query: 343 TIQALNRGE------TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
            ++A N          + D L   S  +R+  I S G K VVAD + IEAR +AW+AGE 
Sbjct: 359 LVKAKNYDGLRILYGNVPDTL---SQLIRTAFIPSEGHKFVVADFSAIEARAIAWLAGEQ 415

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ-----RAIGKVMELALGYQGGAKVFKTM 451
           W  + FA    IY  T A+ F  P+++++K       R  GKV  LALGYQG       M
Sbjct: 416 WVNEVFATHGKIYEATAAQMFGVPVERITKGNPEYSLRQKGKVATLALGYQGSTAALIAM 475

Query: 452 AS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
            +   GL                            +D+ P+   +              W
Sbjct: 476 GALKMGL---------------------------TEDELPDIVTR--------------W 494

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
           R  ++ +  LW  +      V+Q         +       +   +  + + LPS R+L Y
Sbjct: 495 RNANKRICGLWYAVENTALRVMQTAQPQGLNGLIFALEGDLIYGQSFLTVRLPSGRKLYY 554

Query: 571 ------SDVKGDCSYLNTATSQLMR----ERTYGGKLTENIVQAISRDILCEGMKNATKN 620
                  +  G  +    A  Q  R    + TYGGK+TENIVQAI+RD L   ++   + 
Sbjct: 555 PKPFLQENRFGKQAIHYYAVGQQTRKWEIDSTYGGKMTENIVQAIARDCLAVTLRRIAQK 614

Query: 621 GYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           G   V  VHDE++ + P     +V  +C LM +   WA GL LK  G+E+  Y K
Sbjct: 615 GLQTVFHVHDEVIIDAPMET--TVDEICDLMAEPIPWAPGLILKGAGFESSYYMK 667


>gi|312897720|ref|ZP_07757136.1| DNA-directed DNA polymerase [Megasphaera micronuciformis F0359]
 gi|310621104|gb|EFQ04648.1| DNA-directed DNA polymerase [Megasphaera micronuciformis F0359]
          Length = 654

 Score =  251 bits (641), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 210/705 (29%), Positives = 318/705 (45%), Gaps = 82/705 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET SP  +   GV+ Y+E  +  I L +YA+    V + D      +P D++
Sbjct: 1   MRHLNIDIETYSPNDI-SFGVYKYSESEEFEILLFSYAYAFGEVHVVDLASGETIPDDVV 59

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L+ + V+  A+N+ FE     +  G     ++W CT +     G P  L     AL  
Sbjct: 60  LDLKRDEVIKHAYNAQFEITCLNRA-GYQTFVEQWRCTMIHGAYLGYPMGLAKLGKALGL 118

Query: 119 SEHLTKMEEGKALIARF---CKGSIDS-------PPYDCTRANHVQAWQLFGEYCKRDVE 168
           ++   K + G ALI  F   CK +  +       P +D  +      W  +  Y K+DV 
Sbjct: 119 TQDKMKDKAGAALIRYFSVPCKPTKKNGGRTRNLPKHDPDK------WAAYIAYNKQDVV 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
              E ++RL   P+ +     W +D  +N  G  ID  LV     +  + +K L E+  +
Sbjct: 173 TEMECYRRLSAFPVPEEVEKQWQVDIRMNATGVGIDRQLVDGALTIDEENKKALLEEAYE 232

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           LT     +SR    L  +L   T ++L  +++ ++ + ++ ++   LAK ++  R   + 
Sbjct: 233 LTGLSNPNSRNQ--LLDWLNSNTNLELEKLTKDSVAAAMTDAD--DLAKKVLTIRKKLAK 288

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSE-EILTQTIQ 345
           S++ K   ++ A   DGRLRGTLQFYGA+RTGRW+G + Q QNLPR   +  +     ++
Sbjct: 289 SSVSKYEMMASATGQDGRLRGTLQFYGANRTGRWAGRLLQVQNLPRNYITNLDTARSLVK 348

Query: 346 ALNR---GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF 402
           A NR   G    D     S  +R+ IIA  G  L VAD + IEARV+AW++GE W+ K F
Sbjct: 349 ASNRVGLGLLFGDVSDTLSQLIRTAIIAKEGYTLCVADFSAIEARVIAWLSGETWRQKVF 408

Query: 403 ANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQ 460
           A G DIY  + +  F  P+ K  V+   R  GKV ELALGYQGG    K M +   LD+ 
Sbjct: 409 AEGGDIYCASASSMFGVPVVKHGVNGHLRQKGKVAELALGYQGGVNALKAMGA---LDMG 465

Query: 461 QFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQL 520
                                    +++ P       ++G         WR     +++ 
Sbjct: 466 -----------------------LTEEELP------NIVGL--------WRQASPNIVKF 488

Query: 521 WKDLTEGFACVVQEGGSISARRVANVPRLVMRRHK-RDVHIVLPSSRRLVYSDV------ 573
           W  + +     V  G  ++          V   +  R + I LPS R+L Y D       
Sbjct: 489 WYTVEKAAVYTVTTGNPMTLDHGITFRLEVDPFYGYRYMTIELPSGRKLFYPDPHIKLNN 548

Query: 574 --KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDE 631
             K    +     +  + E TYGGKL ENI QA++RD L   +   + NG   ++ +HDE
Sbjct: 549 FDKEAVHFKTQLNNAWVTESTYGGKLVENITQAVARDCLALTLMRLSGNGLPAIMHIHDE 608

Query: 632 IVSETPDTPYFSVGTLCSLMTKNP-SWAKGLPLKAEGYEAKRYRK 675
            V E P         +       P  WA+GL L A G+    Y K
Sbjct: 609 AVIEVPKDEADEYLDIVEKTFALPIPWAEGLALTAAGFTNDYYMK 653


>gi|319757792|gb|ADV69734.1| phage polymerase [Streptococcus suis JS14]
          Length = 651

 Score =  250 bits (639), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 217/716 (30%), Positives = 323/716 (45%), Gaps = 109/716 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           + +L IDIET     L K GV+ YAE     I L A + ++ PV ++D +++  +P D+L
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDDSFEILLFAVSVNNGPVTVYDLSKEK-LPQDIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPS---------KRWICTSVLARTNGLPSSL 109
           + L D+ V+  A N+ FER+     L    P            W C+ + +   GLP SL
Sbjct: 62  EALVDDRVIKWAFNASFERVCLSNWLKKYHPDLLLDRFLSPVSWRCSMIWSAYLGLPLSL 121

Query: 110 KNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN---------HV-QAWQLF 159
           +     L   +   KM EG  LI  FC       P   T+ N         H    W  F
Sbjct: 122 EGVGTVLKLKDQ--KMREGADLIRYFC------VPCKPTKINGGRTRNLPHHAPDQWATF 173

Query: 160 GEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            +Y +RDVE    + +RL   P+ D   D +L DQ INDRG  ID+D V    ++  + +
Sbjct: 174 IDYNRRDVEVELAIKERLKNFPVPDFVWDEYLQDQIINDRGIGIDVDFVKAAIKIDTESK 233

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLIT-GIDLVDMSEGTLKSILSHSNITQLAKD 276
            ++ E++  LT            L+M  +L   G+    + +  +K +L   +  + +K 
Sbjct: 234 AQIQEELKALTS----LENPNSVLQMIGWLREHGVTTDSLDKKAVKELLKTVD-DKTSKV 288

Query: 277 LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERS 336
           L L R  ++ S++ K   +   V  DGR RG  QFYGA+RTGRW+G + Q QNLP+    
Sbjct: 289 LKL-RQQAAKSSVSKYQAMMNCVCKDGRARGMFQFYGANRTGRWAGRLVQLQNLPQNHLP 347

Query: 337 EEILTQTIQALNRG-----ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
           +  L +  +    G     E + D     S  +R+  + S GKK +V D + IEARVL+ 
Sbjct: 348 D--LEEARKLFKTGDLEATELLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSH 405

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFK 449
           +AGE W+ K F  G+DIY  + ++ F  P++K  +    R  GK+ ELA GY G     K
Sbjct: 406 LAGEKWRSKVFELGKDIYCMSASQMFGVPVEKHGQNSKLRQKGKIAELACGYGGSVGALK 465

Query: 450 TM-ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKK 508
            M A   GL  ++    V S                                        
Sbjct: 466 AMGALDMGLSEEELQPLVNS---------------------------------------- 485

Query: 509 AWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRL 568
            WR  +  ++ LW D+       V+E    S   +    R  +      + I LPS R+L
Sbjct: 486 -WRQANPNIVLLWWDVDNAVKTAVKEQIPTSTHGIQFEVRSGI------LFITLPSGRKL 538

Query: 569 VY-------SDVKGD-CSYLNTATSQ-LMRERTYGGKLTENIVQAISRDILCEGMKNATK 619
            Y       +   G+  +Y  T T++   R  +YG K  ENIVQAISRDIL   +K   +
Sbjct: 539 AYIKPRIGENQFGGESVTYEGTGTAKRWERLESYGPKFVENIVQAISRDILAYSLKQLKE 598

Query: 620 NGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             + IV  VHDE++ E P      +  + SLM   P W   + L+A+GYE   Y+K
Sbjct: 599 --FKIVGHVHDEVIIECPMEQ--KIDKIASLMGIAPDWMSDINLRADGYECLFYQK 650


>gi|77412069|ref|ZP_00788395.1| DNA polymerase, putative [Streptococcus agalactiae CJB111]
 gi|77161874|gb|EAO72859.1| DNA polymerase, putative [Streptococcus agalactiae CJB111]
          Length = 651

 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 216/717 (30%), Positives = 327/717 (45%), Gaps = 111/717 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           + +L ID+ET     L K GV++YAE     I L A + D+ PV ++D T+++ +P  +L
Sbjct: 3   IKELSIDLETYCEVDLRKSGVYSYAEDDSFEILLLAVSVDNGPVTVYDLTKEN-LPDQIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPS---------KRWICTSVLARTNGLPSSL 109
           Q L +++++  A N+ FERI     L    P            W C+ V +   GLP SL
Sbjct: 62  QALVNDSIIKWAFNASFERICLSNWLKKHHPKLLSEGFLSPNSWRCSIVWSAYLGLPLSL 121

Query: 110 KNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN---------HV-QAWQLF 159
           +     L   E   K++EG  +I  FC       PY  T+ N         H    W  F
Sbjct: 122 EGVGTVLKLKEQ--KLKEGGDVIRYFCL------PYKPTKINGGRKRNFPHHAPDKWAAF 173

Query: 160 GEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
             Y KRDVE    +  +L   P+ D   + +  DQ IND G  ID+D V     +  + +
Sbjct: 174 INYNKRDVEVELAIKNKLRNHPVPDFLWEEYHQDQNINDSGIGIDVDFVKAAITIDEESK 233

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLIT-GIDLVDMSEGTLKSILSHSNITQLAKD 276
            K+ E++ +LT G+         L+M  +L   G+    + +  +K +L   +  +  K 
Sbjct: 234 SKIQEELKELT-GL---ENPNSVLQMIGWLREHGVTTNSLDKKAVKELLKVVD-AKTTKV 288

Query: 277 LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR---- 332
           L L R  ++ S++ K   +   V  DGR RG  QFYGA+RTGRW+G + Q QNLP+    
Sbjct: 289 LKL-RQQAAKSSVSKYQAMVNCVCLDGRARGMFQFYGANRTGRWAGRLVQLQNLPQNHLP 347

Query: 333 --QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
             +E  +   T  ++A +      D L   S  +R+  + S+GKK +V D + IEARVL+
Sbjct: 348 DLKEARDLFKTGDLEATDLLYGTQDTL---SQLIRTAFVPSDGKKFIVCDFSAIEARVLS 404

Query: 391 WIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVF 448
            +AGE W+   F  G+DIY  + ++ F  P++K  +  + R  GK+ ELA GY G     
Sbjct: 405 HLAGEKWRSMVFEQGKDIYCMSASQMFGVPVEKHGRNADLRQKGKIAELACGYGGAVGAL 464

Query: 449 KTM-ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVK 507
           K M A   GLD Q+    V S                                       
Sbjct: 465 KAMGAIDMGLDEQELQPLVDS--------------------------------------- 485

Query: 508 KAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRR 567
             WR  +  ++  W D+ +          +I  ++      +  +  K  + I LPS R+
Sbjct: 486 --WRQANPNIVLFWWDVDKAVKT------AIKYQKQTETHGIQFKVRKGMLFITLPSGRK 537

Query: 568 LVYSDVK--------GDCSYLNTATSQ-LMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
           L Y   K           +Y  T T++   R  +YG K  ENI+QAISRDIL   MK   
Sbjct: 538 LAYVKPKMGENQFGGESVTYEGTGTAKRWERLESYGPKFVENIIQAISRDILAYSMKQLK 597

Query: 619 KNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
              + IV  VHDEI+ E   +   ++  + +LM K P W   + L+A+GYE   Y+K
Sbjct: 598 D--FRIVGHVHDEIIIECDQSQ--NLEQIATLMGKAPYWMPDINLRADGYECLFYQK 650


>gi|76786923|ref|YP_329353.1| prophage LambdaSa04, DNA polymerase [Streptococcus agalactiae A909]
 gi|76561980|gb|ABA44564.1| prophage LambdaSa04, DNA polymerase [Streptococcus agalactiae A909]
          Length = 651

 Score =  248 bits (633), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 213/711 (29%), Positives = 325/711 (45%), Gaps = 99/711 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           + +L ID+ET     L K GV++YAE     I L A + D+ PV ++D T+++ +P  +L
Sbjct: 3   IKELSIDLETYCEVDLRKSGVYSYAEDDSFEILLLAVSVDNGPVTVYDLTKEN-LPDQIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPS---------KRWICTSVLARTNGLPSSL 109
           Q L +++++  A N+ FERI     L    P            W C+ V +   GLP SL
Sbjct: 62  QALVNDSIIKWAFNASFERICLSNWLKKHHPKLLSEGFLSPNSWRCSMVWSAYLGLPLSL 121

Query: 110 KNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQ----AWQLFGEYCKR 165
           +     L   E   K++EG  +I  FC     +      + N        W  F  Y KR
Sbjct: 122 EGVGTVLKLKEQ--KLKEGGDVIRYFCLPCKPTKINGGRKRNFPHHAPDKWAAFINYNKR 179

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE    +  +L   P+ D   + +  DQ INDRG  ID+D V     +  + + K+ E+
Sbjct: 180 DVEVELAIKNKLRNHPVPDFLWEEYHQDQNINDRGIGIDVDFVKAAITIDEESKSKIQEE 239

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLIT-GIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
           + +LT G+         L+M  +L   G+    + +  +K +L   +  +  K L L R 
Sbjct: 240 LKELT-GL---ENPNSVLQMIGWLREHGVTTNSLDKKAVKELLKVVD-AKTTKVLKL-RQ 293

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR------QERS 336
            ++ S++ K   +   V  DGR RG  QFYGA+RTGRW+G + Q QNLP+      +E  
Sbjct: 294 QAAKSSVSKYQAMVNCVCLDGRARGMFQFYGANRTGRWAGRLVQLQNLPQNHLPDLKEAR 353

Query: 337 EEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           +   T  ++A +      D L   S  +R+  + S+GKK +V D + IEARVL+ +AGE 
Sbjct: 354 DLFKTGDLEATDLLYGTQDTL---SQLIRTAFVPSDGKKFIVCDFSAIEARVLSHLAGEK 410

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTM-AS 453
           W+   F  G+DIY  + ++ F  P++K  +  + R  GK+ ELA GY G     K M A 
Sbjct: 411 WRSMVFEQGKDIYCMSASQMFGVPVEKHGRNADLRQKGKIAELACGYGGAVGALKAMGAI 470

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             GLD Q+    V S                                         WR  
Sbjct: 471 DMGLDEQELQPLVDS-----------------------------------------WRQA 489

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           +  ++  W D+ +          +I  ++      +  +  K  + I LPS R+L Y   
Sbjct: 490 NPNIVLFWWDVDKAVKT------AIKYQKQTETHGIQFKVRKGMLFITLPSGRKLAYVKP 543

Query: 574 K--------GDCSYLNTATSQ-LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           K           +Y  T T++   R  +YG K  ENI+QAISRDIL   MK      + I
Sbjct: 544 KMGENQFGGESVTYEGTGTAKRWERLESYGPKFVENIIQAISRDILAYSMKQLKD--FRI 601

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDEI+ E   +   ++  + +LM K P W   + L+A+GYE   Y+K
Sbjct: 602 VGHVHDEIIIECDQSQ--NLEQIATLMGKAPYWMPDINLRADGYECLFYQK 650


>gi|50914501|ref|YP_060473.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
 gi|40218547|gb|AAR83201.1| phage polymerase [Streptococcus pyogenes]
 gi|50261592|gb|AAT72360.1| DNA polymerase [Streptococcus pyogenes]
 gi|50903575|gb|AAT87290.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
          Length = 651

 Score =  247 bits (630), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 210/716 (29%), Positives = 321/716 (44%), Gaps = 109/716 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           + +L IDIET     L K GV+ YAE     + L A + D+ PV ++D  ++  +P D+L
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDDSFELLLIAVSVDNGPVTVYDFNKEK-LPQDIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPS---------KRWICTSVLARTNGLPSSL 109
           + L ++ V+  A N+ FERI     L    P            W C+ + +   GLP SL
Sbjct: 62  EALVEDRVIKWAFNASFERICLSNWLKKHHPEFLSDGFLSPVSWRCSMIWSAYLGLPLSL 121

Query: 110 KNACLALNFSEHLTKMEEGKALIARFC---------KGSIDSPPYDCTRANHVQAWQLFG 160
           +     L   +   KM EG  LI  FC          G I + P+          W  F 
Sbjct: 122 EGVGTVLKLKDQ--KMREGADLIRYFCLPCKPTKVNGGRIRNFPHHAP-----NKWSTFI 174

Query: 161 EYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           +Y +RDVE    + +R+   P+     + +  DQ INDRG  ID+D V    ++  + + 
Sbjct: 175 DYNRRDVEVELAIKERVKNFPVPSFVWNEYHQDQIINDRGIGIDVDFVKAALKIDGESKA 234

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLIT-GIDLVDMSEGTLKSILSHSNITQLAKDL 277
           K+  ++  LT G+    +    L+M  +L   G+    + +  +K +L    + +    +
Sbjct: 235 KIQAELKTLT-GL---EKPNSVLQMISWLREHGVATDSLDKKAVKELLK--TVDETTAQV 288

Query: 278 ILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR----- 332
           +  R  ++ S++ K   +   V  DGR RG  QF+GA+RTGRW+G + Q QNLP+     
Sbjct: 289 LKLRQQAAKSSVSKYQAMMNCVCKDGRARGMFQFFGANRTGRWAGRLVQLQNLPQNHLPD 348

Query: 333 -QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
            +E  E   T  +++    E + D     S  +R+  + S GKK +V D + IEARVL+ 
Sbjct: 349 LKEARELFRTGDLEST---ELLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSH 405

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFK 449
           +AGE W+ K F  G+DIY  + ++ F  P++K  +  E R  GK+ ELA GY G     K
Sbjct: 406 LAGERWRSKVFEQGKDIYCMSASQMFGVPVEKHGQNSELRQKGKIAELACGYGGSVGALK 465

Query: 450 TMAS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKK 508
            M +   GL  ++    V S                                        
Sbjct: 466 AMGALDMGLSEEELQPLVNS---------------------------------------- 485

Query: 509 AWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRL 568
            WR  +  ++  W D+       V+E    S + +              + I LPS R+L
Sbjct: 486 -WRQANPNIVLYWWDVDNAVKTAVKELLPTSTQNIQ------FEVKSGILFITLPSGRKL 538

Query: 569 VY-------SDVKGD-CSYLNTATSQ-LMRERTYGGKLTENIVQAISRDILCEGMKNATK 619
            Y       +   G+  +Y  T T++   R  +YG K  ENIVQAISRDIL   MK    
Sbjct: 539 AYIKPRIGENQFGGESVTYEGTGTAKRWERLESYGPKFVENIVQAISRDILAFSMKQL-- 596

Query: 620 NGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           N + IV  VHDE++ E P      +  + SLM   P W   + L+A+GYE   Y+K
Sbjct: 597 NDFKIVGHVHDEVIIECPIEQ--KLDEVASLMGIAPYWLSDINLRADGYECFFYQK 650


>gi|227498331|ref|ZP_03928481.1| DNA polymerase I [Acidaminococcus sp. D21]
 gi|226903793|gb|EEH89711.1| DNA polymerase I [Acidaminococcus sp. D21]
          Length = 662

 Score =  246 bits (629), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 222/728 (30%), Positives = 325/728 (44%), Gaps = 120/728 (16%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + IDIET S   L K GV+ YAE     I L  YA D   V++ D      +P D+L
Sbjct: 1   MKTISIDIETFSDVNLAKCGVYKYAESPAFEILLFGYAIDGGKVQVVDLARGERIPDDIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL-----GIDI-----PSKR----------WICTSV 98
             L DE+V   A N+ FER+   + L      +D      P  R          W C+ +
Sbjct: 61  DALTDESVTKWAFNASFERVCLSRYLRDLRISLDPFHDHHPLSRDCARFLNPAGWKCSMI 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA--- 155
            +   GLP SL+ A   L       KM+EGK LI  FC       P   T+ N  +    
Sbjct: 121 WSAYMGLPLSLEGAGAVLKLDSQ--KMKEGKDLIRYFCV------PCKETKLNGGRTRNL 172

Query: 156 -------WQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV 206
                  W LF  Y KRDVE    + +RL   P+ +   D + LDQ INDRG  ID  L 
Sbjct: 173 PRHAPDKWTLFKSYNKRDVEVEMVIQERLKKYPVPEPIWDEYHLDQEINDRGIAIDRTLA 232

Query: 207 LKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLIT-GIDLVDMSEGTLKSIL 265
                + A+ R  L    + +  G          ++M  +L   G+    + +  ++ +L
Sbjct: 233 ENAIVIDARSRDSL----MAVLKGKTGLENPNSVIQMIGWLEQHGMKTDSLGKKQVQELL 288

Query: 266 SHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVF 325
             +   +  + ++L R   + S++ K   +      D R RG  QFYGA+RTGR++G   
Sbjct: 289 KTAE--EPLRSVLLLRQKLAKSSVKKYQAMEMTACEDSRARGMFQFYGANRTGRFAGRHI 346

Query: 326 QPQNLPRQ------ERSEEILTQTIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVV 378
           Q QNLP+       E  E +     +AL    ++I D L   S  +R+  +   G K VV
Sbjct: 347 QLQNLPQNHLPDLAEARELVRQGNYEALELLYDSIPDVL---SQLIRTAFVPRKGMKFVV 403

Query: 379 ADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVME 436
           +D + IEARVL+W+AGE W++  FA   DIY  + +  F  P++K  V+   R  GK+ E
Sbjct: 404 SDFSAIEARVLSWLAGETWRLDVFARNGDIYCASASSMFGVPVEKHGVNGHLRQKGKIAE 463

Query: 437 LALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKD 496
           LALGY G     K M +   LD+   ++N                     + YP      
Sbjct: 464 LALGYGGSTGALKAMGA---LDM-GLTEN---------------------ELYP------ 492

Query: 497 KLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKR 556
                    + ++WR+ +  ++  W  +       ++E   + A  +  + +  M     
Sbjct: 493 ---------LVQSWRSANPHIVDFWWQVDATVKTAIKEQIPMRAGCIRFLCQSGM----- 538

Query: 557 DVHIVLPSSRRLVYSDVK-GDCSYLNT--------ATSQLMRERTYGGKLTENIVQAISR 607
            + I LPS RRL Y   + G+  +           AT +  R  +YG K  ENIVQ ISR
Sbjct: 539 -LFIQLPSGRRLSYVKPRIGENRFGGESVTYEGIGATKKWERLESYGPKFVENIVQGISR 597

Query: 608 DILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEG 667
           DILC  M+  T     IV  VHDE++ E       SV  +C  M + P WA+GL L+A+G
Sbjct: 598 DILCYAMQ--TLRCCAIVGHVHDELIIECSRDA--SVDAICEQMGRTPPWAEGLLLRADG 653

Query: 668 YEAKRYRK 675
           YE + Y+K
Sbjct: 654 YECEFYQK 661


>gi|167746061|ref|ZP_02418188.1| hypothetical protein ANACAC_00756 [Anaerostipes caccae DSM 14662]
 gi|167654576|gb|EDR98705.1| hypothetical protein ANACAC_00756 [Anaerostipes caccae DSM 14662]
          Length = 663

 Score =  246 bits (629), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 201/720 (27%), Positives = 327/720 (45%), Gaps = 116/720 (16%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           IDIET S   L K GV+ Y  ++   I L  Y+ D   V + D  +   +P +++  L D
Sbjct: 9   IDIETYSDVDLQKCGVYKYVQSDSFEILLFGYSVDGGEVSVVDLKQGEKIPMEIIMALTD 68

Query: 64  ETVMCVAHNSLFERILF---------KKTLGIDIPS---------KRWICTSVLARTNGL 105
           E +   A N+ FER+           KK +   IP            W C+ V +   GL
Sbjct: 69  ENITKWAFNANFERVCLSEYLRRFYPKKFVSYSIPEDSVGNYLDPSSWKCSMVWSAYMGL 128

Query: 106 PSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQA 155
           P  L  A   L   E   K+ EGK LI  FC       P   T+ N           +  
Sbjct: 129 PLLLAGAGAVLGLEEQ--KLTEGKELIRYFCV------PCKPTKVNGGRTRNLPQHDMIK 180

Query: 156 WQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELI 213
           W++F +Y KRDVE    +  +L   P+ +   + + LDQ INDRG  +D+D+V       
Sbjct: 181 WEMFKKYNKRDVEVEMSIQDKLRHFPVPNFVWEEYHLDQEINDRGITLDMDVVTNAIAFD 240

Query: 214 AQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQL 273
            + +  L + + ++T   + +      ++ +L    G+++  + +  + ++L+ +   + 
Sbjct: 241 EKSKAVLADKMQEMTG--LENPNSVQQMKQWLS-CNGLEMDSLGKKEVAAVLNTA--PEP 295

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
            K ++  R   + S++ K   ++ AV SDGR RG   FYGA+R+GRW+G + Q QNLP+ 
Sbjct: 296 LKTVLTLRQQLAKSSVKKYQAMANAVCSDGRARGMFMFYGANRSGRWAGRLIQLQNLPQN 355

Query: 334 -----ERSEEILTQ-TIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEA 386
                E +  ++ Q   +A+N   + + D L   S  +R+  +   G + +V+D + IEA
Sbjct: 356 HMSDLEEARSLVKQGNYEAMNMLYDDVPDTL---SQLIRTAFVPRKGMEFIVSDFSAIEA 412

Query: 387 RVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGG 444
           RVL+ +AGE W+   FA+G DIY  + ++ F  P++K  V+   R  GK+ ELALGY G 
Sbjct: 413 RVLSHLAGEKWRTDVFASGGDIYCASASQMFKVPVEKHGVNGHLRQKGKIAELALGYGGS 472

Query: 445 AKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACE 504
               K+M +   LD+      +K                                     
Sbjct: 473 VGALKSMGA---LDMGLEEDELKP------------------------------------ 493

Query: 505 LVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPS 564
            +   WR  +  +++LW D+       V++      R  +++  +        + I LPS
Sbjct: 494 -LVDMWREANPNIVKLWWDVDRAVKKAVKQ------REPSSIGSITFSYKSGMLFIGLPS 546

Query: 565 SRRLVYSDVKGDCSYLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMK 615
            R L Y   K   +   +          T +  R  +YG K  ENIVQAISRDIL   ++
Sbjct: 547 GRCLSYVKPKMGINQFGSESVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILMYAIR 606

Query: 616 NATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             T +   I   VHDE++ E   +   S+  +C  M + P W +G+ L+A+GYE + Y+K
Sbjct: 607 --TLSHCFICGHVHDELIIECSKS--VSLDVICEQMGRTPPWIEGILLRADGYETEFYKK 662


>gi|296277208|ref|ZP_06859715.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           MR1]
          Length = 631

 Score =  246 bits (628), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 205/679 (30%), Positives = 304/679 (44%), Gaps = 106/679 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYC 163
             L       K + GK LI  F      S P   T+ N           ++ WQ F +YC
Sbjct: 121 EVLRLQSQ--KDKAGKNLIRYF------SIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYC 172

Query: 164 KRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLD 221
            RDVE    +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L 
Sbjct: 173 IRDVEVEMAIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELL 232

Query: 222 EDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNR 281
           +    +T   + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  R
Sbjct: 233 KQAKHITG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQEYLKEA--TGKAKKMLEIR 288

Query: 282 LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILT 341
           L  S +++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L 
Sbjct: 289 LQMSKTSVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL- 346

Query: 342 QTIQALNRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
           +  + L + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW A
Sbjct: 347 EIARDLIKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYA 406

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTM 451
            E W++  F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M
Sbjct: 407 KEQWRLDVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAM 466

Query: 452 AS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
            +   G++  +    V S                                         W
Sbjct: 467 GALEMGIEENELQGLVDS-----------------------------------------W 485

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
           R  +  ++  WK      AC      ++ +R+  +   L     K  + I LPS R L Y
Sbjct: 486 RNANPNIVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAY 539

Query: 571 SD-VKGDCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
              + G+ S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +    
Sbjct: 540 PKALVGENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARLE 596

Query: 619 KNGYDIVLTVHDEIVSETP 637
             G+ IV  VHDE++ E P
Sbjct: 597 ALGFKIVGHVHDEVIVEIP 615


>gi|197303496|ref|ZP_03168535.1| hypothetical protein RUMLAC_02218 [Ruminococcus lactaris ATCC
           29176]
 gi|197297494|gb|EDY32055.1| hypothetical protein RUMLAC_02218 [Ruminococcus lactaris ATCC
           29176]
          Length = 661

 Score =  244 bits (624), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 212/730 (29%), Positives = 320/730 (43%), Gaps = 126/730 (17%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +L ID+ET S   + K G + YAE     I L   + D+ PV ++D      +P+++L
Sbjct: 2   MKELSIDLETYSDIDISKCGAYKYAESNNFEILLFGVSVDNGPVVVYDLASGDEIPAEIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPS------------------KRWICTSVLA 100
             L DE ++  A N+ FER+     L    P                     W CT + +
Sbjct: 62  AALSDENIIKWAFNASFERVCLSNWLRKHHPEYFKTYNTQGDPVQNFLDPASWKCTMIWS 121

Query: 101 RTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN--------- 151
              GLP SL+     L   +   KM+EGK LI  FC       P   T+ N         
Sbjct: 122 AYMGLPLSLEGVGAVLKLQDQ--KMKEGKDLIKYFCS------PCKPTKVNGGRTRNLPE 173

Query: 152 HV-QAWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLK 208
           H    W+ F  Y +RDVE    + +RL   P+ D     + +DQ IND G  +D+D+V  
Sbjct: 174 HAPDKWETFKTYNRRDVEVELAIKQRLSKFPVPDSVWHEYHIDQEINDSGIMLDMDVV-- 231

Query: 209 LQELIA-QERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLI-TGIDLVDMSEGTLKSILS 266
            +  IA  ER K    ++     I         ++M  +L   G++   + +  +  ++ 
Sbjct: 232 -ENAIAFDERSK--SALITAMKNITNLDNPNSVVQMKQWLSDNGVETESLGKKEVAGLIK 288

Query: 267 HSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQ 326
            ++   ++K L L RL  + S++ K   +  AV  DGR  G  QFYGA+R+GRW+G + Q
Sbjct: 289 ETD-GDISKALKL-RLQLAKSSVKKYQAMQNAVCKDGRAHGMFQFYGANRSGRWAGRLIQ 346

Query: 327 PQNLPRQERSEEILTQTIQALNRGE---------TIADPLGLASDCVRSCIIASNGKKLV 377
            QNLP+   S+  LT+  + +  G+          I D L   S  +R+  IA  G K +
Sbjct: 347 LQNLPQNHMSD--LTEARELVRTGDYDTLDMLYDDIPDTL---SQLIRTAFIARPGYKFI 401

Query: 378 VADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVM 435
           V+D + IEARVLA +AGE W+ K FA G+DIY  + ++ F  P+ K  ++   R  GK+ 
Sbjct: 402 VSDYSAIEARVLAHLAGETWRSKVFAEGKDIYCASASQMFGVPVKKHGINSHLRQKGKIA 461

Query: 436 ELALGYQGGAKVFKTMAS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAV 494
           ELALGY G     K+M +   GL  ++    V S                          
Sbjct: 462 ELALGYGGSVGALKSMGALEMGLTEEELQPLVDS-------------------------- 495

Query: 495 KDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRH 554
                          WR+ +  +   W ++       ++         +    +  M   
Sbjct: 496 ---------------WRSSNPMITAFWWNVDNAIKTAIKMHIPTEVNGIHFCYKSGMLLI 540

Query: 555 KRDVHIVLPSSRRLVYSDVK-GDCSYLNT--------ATSQLMRERTYGGKLTENIVQAI 605
           KR      PS R L Y   K G+  +           +T +  R  +YG K  ENIVQA+
Sbjct: 541 KR------PSGRVLSYVKPKIGENRFGGESVTYEGIGSTKKWERIESYGPKFVENIVQAV 594

Query: 606 SRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKA 665
           SRDILC  MK  T     IV  VHDE++ E   +    +  +C  M ++  W  G+ L+A
Sbjct: 595 SRDILCNAMK--TLRHCFIVGHVHDELIIEC--SSGVDLNEICKQMGRSLDWMPGILLRA 650

Query: 666 EGYEAKRYRK 675
           +GYE   Y+K
Sbjct: 651 DGYETNFYKK 660


>gi|159146203|gb|ABW90565.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 370

 Score =  243 bits (619), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 205/361 (56%), Gaps = 9/361 (2%)

Query: 184 ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRM 243
           E +LW LDQ IN RG  +D++L       +  E+K+L     +LTD  ++++ Q  AL  
Sbjct: 3   ETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRDALLQ 62

Query: 244 YLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDG 303
           ++    GI L DM   TL+  ++  +I    ++L+  RL S  ++  K   L ++VS+DG
Sbjct: 63  HIASAFGITLPDMQASTLQRRINDPDIPPDLRELLSVRLQSCTTSTSKYKALLKSVSADG 122

Query: 304 RLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP-LGLA 360
           RLRGT QF GASRTGRW+G VFQP NLPR       +   I+AL  G  E I D  + L 
Sbjct: 123 RLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICDDIMQLT 182

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVTTYAK 415
           S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+KAF+      G+D+Y   YA+
Sbjct: 183 SSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLYKLAYAR 242

Query: 416 AFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDW 475
           AFN   + V+K+QR IGKVMEL LGY GG   F T A   GLDL + ++           
Sbjct: 243 AFNLLPEDVTKDQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPHIPPGVK 302

Query: 476 EQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEG 535
            +A S +    ++   + + +K+  T C+ +K+ WR  H   +  W D+ +     +Q  
Sbjct: 303 REATSWYQKSVEKDKTYGLSEKIFVT-CDSLKRMWRNAHPQTVSFWYDIEDAVKQAIQSP 361

Query: 536 G 536
           G
Sbjct: 362 G 362


>gi|269975277|gb|ACZ55501.1| DNA polymerase I [Staphylococcus phage SA1]
          Length = 645

 Score =  242 bits (618), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 191/665 (28%), Positives = 297/665 (44%), Gaps = 84/665 (12%)

Query: 53  MPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNA 112
           +P +L + L D  V   A N+ FER++ ++ LGI  P K W CT  LA   G    L   
Sbjct: 22  LPGELREALEDPDVEKWAFNAQFERVMTRRVLGIKTPYKAWRCTMALAYMLGFAGDLLAV 81

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGS--IDSPPYDC-TRANHVQAWQLFGEYCKRDVEA 169
              +   E   K  EGK LI  F K        P++    A   + W  F +Y  RDVE 
Sbjct: 82  GTQIGLPEDKLKDPEGKRLIDLFSKPQRVTKKNPFEWRNEATDPEDWWHFCKYNIRDVET 141

Query: 170 TRELFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  RL+  P+ D E D++ LDQ IND G  ID +       L    + ++ E++  +
Sbjct: 142 ELAIKARLMRYPVLDAEWDMYALDQFINDTGVMIDREFAYSALALAEARKPQIIEEMADI 201

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSN---ITQLAKDLILNRLAS 284
           T   + +      L  +L    G    D+   T+  ++  ++   +   A  ++  RL S
Sbjct: 202 TG--LNNPNSPAQLTPWL-KERGYPFSDLRSDTVNKVIREADENGVDPEAIRVLQMRLNS 258

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILT--- 341
           + +++ K  T+ +A   DGR R +LQF GASRT RW+G   Q QNLPR  +  E +T   
Sbjct: 259 AKNSLSKYQTMIDAAGEDGRFRFSLQFAGASRTNRWAGRRIQTQNLPRTPKLIEDVTDLS 318

Query: 342 --------QTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                   + + AL     + +P+     C+RS  I + G K +VADL+ IE+ V+ W+ 
Sbjct: 319 IVNKMIHQRDLDALTL--YVGEPMDALVGCIRSAFIPTPGHKFIVADLSSIESVVIGWLT 376

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
              W +   A   D+Y +  A   + P ++ +K  R+  K   L  GY+ G         
Sbjct: 377 DCKWFMNTLAAKHDLYRSFAAHWLHLPYEE-TKPHRSKAKPATLGAGYRLGGGHMDENGK 435

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             GL                 W  AE+  + M  +  E +V             +A+R  
Sbjct: 436 KTGL-----------------WGYAENMGVHMTQKEAEESV-------------QAFRDL 465

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY--- 570
              +++ W DL      V++       R+      L++   K  + I LPS R++ Y   
Sbjct: 466 CPEIVRAWYDLENAVFKVIR------TRQAVVWGCLIIEYTKPFLTIRLPSGRKMYYFRP 519

Query: 571 -----------------SDVKGDCSY---LNTATSQLMRERTYGGKLTENIVQAISRDIL 610
                               K +  Y   +  + ++  +  ++GGKL ENIVQA++RD+L
Sbjct: 520 RLVERQMTVQKGPKKGEKYTKTNFQYEGKVEGSGTKWGKIYSHGGKLVENIVQALARDVL 579

Query: 611 CEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEA 670
            EG+K A + G+ IV+ +HDEIV+E P+    +V  L S M     WA+GLPL A G+E 
Sbjct: 580 AEGLKKAHRMGFRIVMHIHDEIVTEVPEDSPLTVDDLISCMAAELPWAEGLPLGAAGWEG 639

Query: 671 KRYRK 675
             YRK
Sbjct: 640 YFYRK 644


>gi|134288571|ref|YP_001110810.1| DNA polymerase [Salmonella phage SETP3]
 gi|125631936|gb|ABN47339.1| DNA polymerase [Salmonella phage SETP3]
 gi|126015336|gb|ABN70699.1| DNA polymerase [Salmonella phage SETP5]
 gi|126015338|gb|ABN70700.1| DNA polymerase [Salmonella phage SETP12]
          Length = 1032

 Score =  240 bits (613), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 162/453 (35%), Positives = 237/453 (52%), Gaps = 25/453 (5%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M+ L++D ET S   L KVG +AYAE     I +C YA+D+ PV++WD T+ S MP DL 
Sbjct: 1   MNLLYLDTETFSEADLKKVGSYAYAEHPTTEIVICTYAFDEGPVQVWDATDGSDMPRDLR 60

Query: 59  QYL-----RDETVMCVAHNSL-FERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNA 112
           + +      D  +  V  N L F+R++ K   G ++  +  I T ++A  + LP SL + 
Sbjct: 61  RAMLKLQKPDSNLKLVGQNFLMFDRLVIKHCWGFELLVENIIDTMIVAFRHALPGSLASL 120

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTR---ANHVQAWQLFGEYCKRDVEA 169
           C  LN    + K + GKALI RF K +  +  Y   R   A H + W  F  Y K D+ +
Sbjct: 121 CEVLNIDASMAKDKRGKALIQRFSKPTPKN--YKIRRYTAATHPKEWAEFIAYAKSDITS 178

Query: 170 TRELFKRLIPLSDGE---RDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
            RE++K++    + E   R LWL DQ INDRG+++D+ L     E + + +++L E+  +
Sbjct: 179 MREVYKKMPKWGNSEFEDRVLWL-DQVINDRGFKVDVALAEAAIEAVTRHKEELQEEAQR 237

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
              G +        L +   L     + +  + TL  +L+  ++   A+ +I  RL ++ 
Sbjct: 238 KYGGSLTGKD---FLPILQELAPAHRIHNAQKSTLNDLLADEDLPDDARTIIEMRLGAAS 294

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           +A  K   L    SSD R RG LQ+ GA RT RW+G  FQPQNL R    ++ L + I A
Sbjct: 295 TASTKYAPLLLGRSSDDRRRGCLQYGGAKRTLRWAGKGFQPQNLARGYYHDDELDRGIAA 354

Query: 347 LNRGETIA--DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
           L +G      D   L +  VRSCII   G+K VVAD + +E R LAW+AGE+  +  F  
Sbjct: 355 LLKGRAHRRFDVAKLTASTVRSCIIPEAGRKFVVADYSNVEGRGLAWLAGEETALDTFRA 414

Query: 405 GEDIYVTTYAKAFNTPIDKVSKEQ---RAIGKV 434
           G DIY  T  K F    D + KE+   R IGK 
Sbjct: 415 GLDIYCVTAGKMFGMDPDDIKKERKDLRQIGKA 447



 Score =  141 bits (355), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 130/286 (45%), Gaps = 47/286 (16%)

Query: 436  ELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWM---------- 485
            EL LGY+GG   F T A + GLDL + ++ +  T     W      + W           
Sbjct: 748  ELGLGYEGGVGAFVTFAKNLGLDLIEMAKTMDGTFPDHIWAATARGYEWARIQEAKRPPH 807

Query: 486  ---QDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGG-----S 537
               +D  P + + DK +   C+ +K+ WR  H   +  W+DL +G    V+  G      
Sbjct: 808  PGEKDDRPSY-ILDKKVWRTCDAIKRMWRESHPETVAFWRDLKDGILAAVRNPGREFWAG 866

Query: 538  ISARRVANVPRLVMRRHKRD----------VHIVLPSSRRLVYSDV-------KGDCSYL 580
               RR       + R  + D          + + LPS R L Y  +         +   +
Sbjct: 867  AHLRRNGERAIRIWRTVEFDSSGRKVPGWWLCMELPSGRILSYPGIGVSVTKETDEDGRI 926

Query: 581  NT-------ATSQLMRE----RTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
            NT         +QL R+     T+GGK  ENIVQA+ RD+L   M N    GY IVL+VH
Sbjct: 927  NTNVRIKYQGENQLTRQWTTLYTHGGKACENIVQALCRDLLAYAMLNVEAGGYPIVLSVH 986

Query: 630  DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            DE+V ETPDTP ++V  L  LM   P WA G PL AEG E KRY K
Sbjct: 987  DELVCETPDTPDYTVAELEKLMCALPGWADGFPLVAEGAELKRYAK 1032


>gi|159146201|gb|ABW90564.1| DNA polymerase [Bacteriophage APSE-2]
 gi|159146213|gb|ABW90570.1| DNA polymerase [Bacteriophage APSE-2]
 gi|159146218|gb|ABW90572.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 370

 Score =  240 bits (613), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 141/361 (39%), Positives = 203/361 (56%), Gaps = 9/361 (2%)

Query: 184 ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRM 243
           E +LW LDQ IN RG  +D++L       +  E+K+L     +LTD  ++++ Q  AL  
Sbjct: 3   ETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRDALLQ 62

Query: 244 YLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDG 303
           ++    GI L DM   TL+  ++  +I    ++L+  RL S  ++  K   L ++VS+DG
Sbjct: 63  HIASAFGITLPDMQASTLQRRINDPDIPPDLRELLSVRLQSCTTSTSKYKALLKSVSADG 122

Query: 304 RLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP-LGLA 360
           RLRGT QF GASRTGRW+G VFQP NLPR       +   I+AL  G  E I D  + L 
Sbjct: 123 RLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICDDIMQLT 182

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVTTYAK 415
           S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+KAF+      G+D+Y   YA+
Sbjct: 183 SSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLYKLAYAR 242

Query: 416 AFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDW 475
           AFN   + V+K+QR IGKVMEL LGY GG   F T A   GLDL + ++           
Sbjct: 243 AFNLLPEDVTKDQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPHIPPGVK 302

Query: 476 EQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEG 535
            +A S +    +    + + +K+    C+ +K+ WR  H   +  W D+ +     +Q  
Sbjct: 303 REATSWYQKSVETDKTYGLSEKIF-VNCDSLKRMWRNAHPQTVSFWYDIEDAVKQAIQSP 361

Query: 536 G 536
           G
Sbjct: 362 G 362


>gi|159146211|gb|ABW90569.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 370

 Score =  240 bits (612), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 140/361 (38%), Positives = 201/361 (55%), Gaps = 9/361 (2%)

Query: 184 ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRM 243
           E +LW LDQ IN RG  +D++L       +  E+ +L     +LTD  ++++ Q  AL  
Sbjct: 3   ETELWQLDQKINRRGMCMDVELAKSALTAVENEQNRLSTVTQQLTDNAVQNATQRDALLQ 62

Query: 244 YLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDG 303
           ++    GI L DM   TL+  ++  +I    ++L+  RL S  ++  K   L ++VS+DG
Sbjct: 63  HIASAFGITLPDMQASTLQRRINDPDIPPALRELLSVRLQSCTTSTSKYKALLKSVSADG 122

Query: 304 RLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP-LGLA 360
           RLRGT QF GASRTGRW+G VFQP NLPR       +   I+AL  G  E I D  + L 
Sbjct: 123 RLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICDDIMQLT 182

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVTTYAK 415
           S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+ AF+      G+D+Y   YA+
Sbjct: 183 SSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKLAYAR 242

Query: 416 AFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDW 475
           AFN   + V+KEQR IGKVMEL LGY GG   F T A   GLDL + ++           
Sbjct: 243 AFNLLPEDVTKEQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPNIPLGVK 302

Query: 476 EQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEG 535
            +A   +    +    + + +K+  T C+ +K+ WR  H   +  W D+ +     +Q  
Sbjct: 303 REAMRWYQKSVETDKTYGLSEKIFVT-CDSLKRMWRNAHPQTVSFWYDIEDAVKQAIQSP 361

Query: 536 G 536
           G
Sbjct: 362 G 362


>gi|211731846|gb|ACJ10149.1| DNA polymerase [Bacteriophage APSE-5]
          Length = 773

 Score =  239 bits (611), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 150/393 (38%), Positives = 215/393 (54%), Gaps = 19/393 (4%)

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDL 277
           K+L     +LTD  ++++ Q  AL  ++    GI L DM   TL+  ++  +I    ++L
Sbjct: 2   KRLSTVTQQLTDNAVQNATQRDALLQHIASAFGITLPDMQASTLQRRINDPDIPPDLREL 61

Query: 278 ILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSE 337
           +  RL S  ++  K   L ++VS+DGRLRGT QF GASRTGRW+G VFQP NLPR     
Sbjct: 62  LSVRLQSCTTSTSKYKALLKSVSADGRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDP 121

Query: 338 EILTQTIQALNRG--ETIADP-LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
             +   I+AL  G  E I D  + L S  +R CIIA  GKKLV++DL+ IE R+LAW+AG
Sbjct: 122 NTIDNGIEALKAGCAELICDDIMQLTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAG 181

Query: 395 EDWKIKAFA-----NGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFK 449
           E+WK+KAF+      G+D+Y   YA+AFN   + V+K+QR IGKVMEL LGY GG   F 
Sbjct: 182 ENWKVKAFSEFDNGKGDDLYKLAYARAFNLLPEDVTKDQRQIGKVMELGLGYGGGVAAFL 241

Query: 450 TMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKA 509
           T A   GLDL + ++            +A S +    +    + + +K+    C+ +K+ 
Sbjct: 242 TFALAYGLDLDELAEAALPHIPPGVKREATSWYQKSVETDKTYGLSEKIF-VNCDSLKRM 300

Query: 510 WRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLV 569
           WR  H   +  W D+ +     +Q  G     R     +L +RR K  + I LPS R L 
Sbjct: 301 WRNAHPQTVSFWYDIEDAVKQAIQSPGIAFKCR-----KLSVRRDKGWLRICLPSGRSLC 355

Query: 570 YSDVK---GDCSYL--NTATSQLMRERTYGGKL 597
           Y   +   G  +Y+  N  + +  R +TYGGKL
Sbjct: 356 YPSARIENGQITYMGTNPYSRKWERLKTYGGKL 388



 Score = 89.7 bits (221), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/77 (55%), Positives = 51/77 (66%)

Query: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658
           ENI Q+ +RD+L   M    K GY+IVLTVHDEI+SE PDTP FS   L  L++ N  WA
Sbjct: 696 ENICQSAARDVLAYSMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKLLSFNSHWA 755

Query: 659 KGLPLKAEGYEAKRYRK 675
             LPL A G+E  RYRK
Sbjct: 756 WDLPLSANGFETYRYRK 772


>gi|217965857|ref|YP_002351535.1| DNA polymerase [Listeria monocytogenes HCC23]
 gi|217335127|gb|ACK40921.1| DNA polymerase [Listeria monocytogenes HCC23]
          Length = 545

 Score =  239 bits (611), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 180/599 (30%), Positives = 277/599 (46%), Gaps = 89/599 (14%)

Query: 104 GLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN---------HV- 153
           GLP+SL     AL  ++   K  EGKALI  FC       P   T+AN         H  
Sbjct: 8   GLPASLDMMSKALRLAQE--KDNEGKALIRYFCM------PCKPTKANGGRTRNYPEHAS 59

Query: 154 QAWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQE 211
           + W  F EYC++DV   R + K++   P  + E+  W LDQ I D+G RID+DLV     
Sbjct: 60  EKWAKFIEYCRQDVVVERSIAKKIAKFPFPEDEQRNWELDQRIADKGVRIDVDLVK--HA 117

Query: 212 LIAQERKKLDEDIVKLTDGI--IRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSN 269
           +  QER +    + K   G+  + +      L+ +L  + G  +  +++ ++  +L+  +
Sbjct: 118 IACQERYQ--ASLSKKAKGLTGLENPNSVQQLKDWLADM-GYPVSSLNKDSVSELLADED 174

Query: 270 ITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQN 329
           + +  ++++L R   S ++I K   +  A   DGR+RG LQF GA+RTGRW+G + Q QN
Sbjct: 175 LDEDVREMLLLRQEMSKTSIKKYEKMQHARCHDGRVRGLLQFNGANRTGRWAGRLVQVQN 234

Query: 330 LPRQERSEEILTQTIQALNRGETIADPL------GLASDCVRSCIIASNGKKLVVADLAG 383
           LPR    +  + +  + L  G+  A  +       + S  +R+  IA +G    + D + 
Sbjct: 235 LPRNYIKD--IAEVRKDLKAGDYEAFEMMYSNVPDVLSQLIRTAFIAEDGYTFDITDFSA 292

Query: 384 IEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQG 443
           IEARV+AW+AGE W++  F +   IY  + ++ F+ PI++V K  R  GKV ELALGY G
Sbjct: 293 IEARVIAWLAGEQWRLDVFNSHGKIYEASASQMFHIPIEEVDKNLRQKGKVSELALGYNG 352

Query: 444 GAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTAC 503
           G      M                                         A++  L     
Sbjct: 353 GVNALIAMG----------------------------------------ALEMGLKENEL 372

Query: 504 ELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLP 563
           + +  AWR     +  LW+ + +          +IS R+      L        + I LP
Sbjct: 373 QGIVDAWRKASPAITSLWRGVEKHAKL------AISTRKSQKYKGLTFYYEAGILFIKLP 426

Query: 564 SSRRLVYSDVK-------GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKN 616
           S R L Y   K           Y         ++ TYGGKL ENIVQAI+RD L   ++ 
Sbjct: 427 SGRNLAYFRAKLVPGKYGPQICYEGVTDKGWRKQYTYGGKLVENIVQAIARDCLAISLRR 486

Query: 617 ATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
               G D V+ VHDE ++E  ++   SV  L +++ +  SWA GLPL+ +G+ +  Y K
Sbjct: 487 IEDTGIDTVMHVHDEAITEVQESES-SVDKLNAILAEPISWAPGLPLQGDGFSSDFYMK 544


>gi|159146215|gb|ABW90571.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 370

 Score =  239 bits (611), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 140/361 (38%), Positives = 202/361 (55%), Gaps = 9/361 (2%)

Query: 184 ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRM 243
           E +LW LDQ IN RG  +D++L       +  E+K+L     +LTD  ++++ Q  AL  
Sbjct: 3   ETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRDALLQ 62

Query: 244 YLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDG 303
           ++    GI L DM   TL+  ++  +I    ++L+  RL S  ++  K   L ++VS+DG
Sbjct: 63  HIASAFGITLPDMQASTLQRRINDPDIPPALRELLSVRLQSCTTSTSKYKALLKSVSADG 122

Query: 304 RLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP-LGLA 360
           RLRGT QF GASRTGRW+G VFQP NLPR       +   I+AL  G  E I D  + L 
Sbjct: 123 RLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICDDIMQLT 182

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVTTYAK 415
           S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+ AF+      G+D+Y   YA+
Sbjct: 183 SSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKLAYAR 242

Query: 416 AFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDW 475
           AFN   + V+K+QR IGKVMEL LGY GG   F T A   GLDL + ++           
Sbjct: 243 AFNLLPEDVTKDQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPNIPPGVK 302

Query: 476 EQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEG 535
            +A   +    +    + + +K+  T C+ +K+ WR  H   +  W D+ +     +Q  
Sbjct: 303 REAMRWYQKSVETDKTYGLSEKIFVT-CDSLKRMWRNAHPQTVSFWYDIEDAVKQAIQSP 361

Query: 536 G 536
           G
Sbjct: 362 G 362


>gi|211731855|gb|ACJ10154.1| DNA polymerase [Bacteriophage APSE-4]
          Length = 773

 Score =  239 bits (610), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 148/385 (38%), Positives = 211/385 (54%), Gaps = 19/385 (4%)

Query: 226 KLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASS 285
           +LTD  ++++ Q  AL  ++    GI L DM   TL+  ++  +I    ++L+  RL S 
Sbjct: 10  QLTDNAVQNATQRDALLQHIASAFGITLPDMQASTLQRRINDPDIPPALRELLSVRLQSC 69

Query: 286 GSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQ 345
            ++  K   L ++VS+DGRLRGT QF GASRTGRW+G VFQP NLPR       +   I+
Sbjct: 70  TTSTSKYKALLKSVSADGRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIE 129

Query: 346 ALNRG--ETIADP-LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF 402
           AL  G  E I D  + L S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+ AF
Sbjct: 130 ALKAGCAELICDDIMQLTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAF 189

Query: 403 A-----NGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           +      G+D+Y   YA+AFN   + V+KEQR IGKVMEL LGY GG   F T A   GL
Sbjct: 190 SEFDNGKGDDLYKLAYARAFNLLPEDVTKEQRQIGKVMELGLGYGGGVAAFLTFALAYGL 249

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
           DL + ++            +A   +    +    + + +K+  T C+ +K+ WR  H   
Sbjct: 250 DLDELAEAALPNIPLGVKREAMRWYQKSVETDKTYGLSEKIFVT-CDSLKRMWRNAHPQT 308

Query: 518 LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK--- 574
           +  W D+ +     +Q  G     R     +L +RR K  + I LPS R L Y   +   
Sbjct: 309 VSFWYDIEDAVKQAIQSPGIAFKCR-----KLSVRRDKGWLRICLPSGRSLCYPSARIEN 363

Query: 575 GDCSYL--NTATSQLMRERTYGGKL 597
           G  +Y+  N  + +  R +TYGGKL
Sbjct: 364 GQITYMGTNPYSRKWERLKTYGGKL 388



 Score = 90.1 bits (222), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/77 (55%), Positives = 51/77 (66%)

Query: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658
           ENI Q+ +RD+L   M    K GY+IVLTVHDEI+SE PDTP FS   L  L++ N  WA
Sbjct: 696 ENICQSAARDVLAYSMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKLLSFNSDWA 755

Query: 659 KGLPLKAEGYEAKRYRK 675
             LPL A G+E  RYRK
Sbjct: 756 WDLPLSANGFETYRYRK 772


>gi|313813472|gb|EFS51186.1| DNA-directed DNA polymerase [Propionibacterium acnes HL025PA1]
 gi|315106933|gb|EFT78909.1| DNA-directed DNA polymerase [Propionibacterium acnes HL030PA1]
          Length = 538

 Score =  239 bits (610), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 176/575 (30%), Positives = 270/575 (46%), Gaps = 84/575 (14%)

Query: 128 GKALIARFCK----------GSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL 177
           GK LI +FC           G+ + P  D T      +W  F +Y +RDVE    +  RL
Sbjct: 20  GKRLIKQFCTPATPSVLNGGGTRNLPSSDPT------SWAQFIDYNQRDVEVELAIHDRL 73

Query: 178 --IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSS 235
              P+ + E D + LDQ IND G  +D  L      L  Q R        +LT   + + 
Sbjct: 74  SSFPIPEAEWDAYALDQRINDTGILLDHTLADAAVALDDQHRAATLARARELTG--LENP 131

Query: 236 RQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTL 295
                L+ +L    G ++  +++  +++ L  +  T   K+++  R   + S++ K   +
Sbjct: 132 NSPIQLKEWL-TTHGCEMSSLAKADVEAALESA--TGKVKEVLELRGDLAKSSVKKYQAM 188

Query: 296 SEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTI---QALNRGET 352
                +DGR RG +QFYGA RTGR++G + Q QNLPR    +    +T+   + L+  E 
Sbjct: 189 HNVTGTDGRARGLIQFYGAGRTGRFAGRLVQVQNLPRNYLPDLDQARTLTRQRNLDALEL 248

Query: 353 IADPL-GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
           + D +    S  +R+  I S G + +VAD + IEARV+AW+AGE   + AF +G+D+Y  
Sbjct: 249 LYDSVPDTLSQLIRTAFIPSAGCRFIVADYSAIEARVIAWLAGETSTLAAFRDGKDLYCE 308

Query: 412 TYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKST 469
           T ++ F  P++K  ++ E R  GK+  LA GY G     K M                  
Sbjct: 309 TASRMFGVPVEKHGINAELRQKGKIATLACGYNGSVGALKAMG----------------- 351

Query: 470 STFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFA 529
                                  A++  L     + +  AWRA +  +++LW D+ +   
Sbjct: 352 -----------------------ALRMGLAEHELKPIVDAWRAANPNIVRLWADVEQAAL 388

Query: 530 CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-GDCSYLNTATS--- 585
                  +I+ R+   +  L        + I LPS RRL Y   + G+  +  T+ +   
Sbjct: 389 ------DAITTRQAVRLRNLRFTAESGILFITLPSGRRLAYVKPQLGENRWGGTSITYSG 442

Query: 586 -----QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTP 640
                +  R  TYGGKL ENIVQA++RD+L   M    + G+ IV+ VHDEIV + P+  
Sbjct: 443 VTTGRKWGRLETYGGKLVENIVQAVARDLLVHAMTLVAQAGHKIVMHVHDEIVIDEPEDS 502

Query: 641 YFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            F++   C LMT  P WA GLPL A+GYE   YRK
Sbjct: 503 GFTIADACQLMTTPPDWAAGLPLDADGYECDYYRK 537


>gi|159146205|gb|ABW90566.1| DNA polymerase [Bacteriophage APSE-2]
 gi|159146207|gb|ABW90567.1| DNA polymerase [Bacteriophage APSE-2]
 gi|159146209|gb|ABW90568.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 370

 Score =  237 bits (605), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 140/361 (38%), Positives = 201/361 (55%), Gaps = 9/361 (2%)

Query: 184 ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRM 243
           E +LW LDQ IN RG  +D++L       +  E+ +L     +LTD  ++++ Q  AL  
Sbjct: 3   ETELWQLDQKINRRGMCMDVELAKSALTAVENEQNRLSTVTQQLTDNAVQNATQRDALLQ 62

Query: 244 YLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDG 303
           ++    GI L DM   TL+  ++  +I    ++L+  RL S  ++  K   L ++VS+DG
Sbjct: 63  HIASAFGITLPDMQASTLQRRINDPDIPPDLRELLSVRLQSCTTSTSKYKALLKSVSADG 122

Query: 304 RLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP-LGLA 360
           RLRGT QF GASRTGRW+G VFQP NLPR       +   I+AL  G  E I D  + L 
Sbjct: 123 RLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICDDIMQLT 182

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVTTYAK 415
           S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+ AF+      G+D+Y   YA+
Sbjct: 183 SSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKLAYAR 242

Query: 416 AFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDW 475
           AFN   + V+KEQR IGKVMEL LGY GG   F T A   GLDL + ++           
Sbjct: 243 AFNLLPEDVTKEQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPNILPGVK 302

Query: 476 EQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEG 535
            +A   +    +    + + +K+  T C+ +K+ WR  H   +  W D+ +     +Q  
Sbjct: 303 REAMRWYQKSVETDKTYGLSEKIFVT-CDALKRMWRNAHPQTVSFWYDIEDAVKQAIQSP 361

Query: 536 G 536
           G
Sbjct: 362 G 362


>gi|273810592|ref|YP_003344973.1| gp38 [Sodalis phage SO-1]
 gi|258619877|gb|ACV84130.1| gp38 [Sodalis phage SO-1]
          Length = 1062

 Score =  236 bits (603), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 163/471 (34%), Positives = 233/471 (49%), Gaps = 42/471 (8%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
             +LF+D ET S   L KVG +AYAE     I +C YA D+  V+ WD TE   MP +L 
Sbjct: 4   FERLFLDTETFSGVDLKKVGAYAYAEHPTTEIMICTYAIDEGRVQTWDCTESPKMPRELR 63

Query: 59  QYLRD----ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACL 114
           + LR     +  + +A+  LF+R++ ++  GID+P  +   T ++A  + LP SL   C 
Sbjct: 64  KALRQVSRKKAKIVMANGLLFDRLVIREKWGIDLPVSQIEDTMIMAFRHALPGSLDMQCQ 123

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDC---TRANHVQAWQLFGEYCKRDVEATR 171
            L       K + GKALI RFCK +  +  Y     TR  H + W  F  Y   D+ A R
Sbjct: 124 VLGVDAEHAKDKAGKALIKRFCKPTPKT--YKIRRYTRETHPEEWAKFLRYAALDIIAMR 181

Query: 172 ELFKRLIPLSD--GERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
           E++ R+    +   E ++ L+DQ INDRG+ +D+DL     + +   +++L E+  +   
Sbjct: 182 EVYWRIPDWGNTPKEDEILLIDQLINDRGFYVDVDLANAAIKAVQAHKEELKEEAWERFG 241

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAI 289
           G +  +     LR    +     + +  + TL  +L   +     K LI  RL +S +A 
Sbjct: 242 GKLTGNDFLPILRD---IAPAFTIHNAQKSTLNDLLEDPDFPDEGKALIEMRLGASSTAS 298

Query: 290 LKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEE----------- 338
            K N L   +S+DGR RG LQ+ GA RT RW+G  FQPQNL R E S++           
Sbjct: 299 TKYNPLVNGLSADGRRRGCLQYGGAKRTLRWAGKGFQPQNLARGEYSDDHEGKIKRREGE 358

Query: 339 ----------ILTQTIQALNRGET--IADPLGLASDCVRSCIIASNGKKLVVADLAGIEA 386
                     +LT  I +L RG      D   L +  VR CII + GKK VVAD + +E 
Sbjct: 359 SDVSFWVRSHMLTNGINSLLRGTAHWAYDISKLTASTVRGCIIPAKGKKFVVADYSNVEG 418

Query: 387 RVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVS---KEQRAIGKV 434
           R LAW+AGE   +  F  G DIY  T  K F    D +    K+ R IGK 
Sbjct: 419 RGLAWVAGEKTALMVFKAGRDIYCETAGKMFGLDPDYIKANRKDLRQIGKA 469



 Score =  134 bits (336), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 95/306 (31%), Positives = 136/306 (44%), Gaps = 55/306 (17%)

Query: 424  VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHL 483
             SK    +    EL LGY GG   F   A + GLDL   +  +K T     W  A+  + 
Sbjct: 758  ASKSGFLVAHNCELGLGYGGGVAAFLQFAKNLGLDLYTMADVMKGTFPDHIWAAAKRGYE 817

Query: 484  WM-------------QDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFAC 530
            +              +D+ P + +  K +   C+ +K+ WR  H   +  W +L +   C
Sbjct: 818  YARINEAKRPPKPGKKDERPTY-ILPKNVWLTCDAIKRMWREAHPKTVAFWAELEDAVLC 876

Query: 531  VVQEGGSI---------SARRVANVPRLVMRR-----HKRD--------VHIVLPSSRRL 568
             ++  G             R+   + R   +       +RD        + I LPS R +
Sbjct: 877  AIRNPGKAYWAGANVRPDGRKALKIVRTKAKHDPTFDEERDDPNAAGWWLKIELPSGRIM 936

Query: 569  VY--------SDVKGDCSYLNTAT-------SQLMR----ERTYGGKLTENIVQAISRDI 609
             Y        +++  D     T+T       +Q  R    + TYGGKLTENIVQA+ RDI
Sbjct: 937  SYPGIALSVTTEIDEDTGKKRTSTRIKYQGENQTTRQWGFQYTYGGKLTENIVQALCRDI 996

Query: 610  LCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYE 669
            L   M      GY+IVL+VHDE+++E PDT  ++   LC+LM   P WAKG PL AEG  
Sbjct: 997  LAWSMPGVEAAGYEIVLSVHDELITEVPDTDDYTTEELCALMCDLPIWAKGFPLAAEGDC 1056

Query: 670  AKRYRK 675
              RYRK
Sbjct: 1057 MYRYRK 1062


>gi|62327350|ref|YP_224063.1| hypothetical protein BPKS7gp41 [Salmonella phage SS3e]
 gi|57472384|gb|AAW51246.1| hypothetical protein [Salmonella phage SS3e]
          Length = 461

 Score =  233 bits (595), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 158/452 (34%), Positives = 233/452 (51%), Gaps = 23/452 (5%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M+ L++D ET S   L KVG +AYAE     I +C YA+D+ PV++WD T+ S MP DL 
Sbjct: 1   MNLLYLDTETFSEADLKKVGSYAYAEHPTTEIVICTYAFDEGPVQVWDATDGSDMPRDLR 60

Query: 59  QYL-----RDETVMCVAHNSL-FERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNA 112
           + +      D  +  V  N L F+R + K   G ++  +  I T ++A  + LP SL   
Sbjct: 61  RAMLKLQKPDSNLKLVGQNFLMFDRPVIKHCWGFELLVENIIDTMIVAFRHALPGSLAAL 120

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN---HVQAWQLFGEYCKRDVEA 169
           C  LN    + K + GKALI RF K +  +  Y   R     H + W  F  Y K D+ +
Sbjct: 121 CEVLNIDASMAKDKRGKALIQRFSKPTPKN--YKIRRYTADTHPKEWAEFIAYAKSDITS 178

Query: 170 TRELFKRLIPLSDGERD--LWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
            RE++K++    + E +  +  LDQ INDRG+++D+ L     E + + +++L E+  + 
Sbjct: 179 MREVYKKMPKWGNSEFEDRVLHLDQVINDRGFKVDVALAEAAIEAVTRHKEELQEEAQRK 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
             G +        L +   L     + +  + TL  +L+  ++   A+ +I  RL ++ +
Sbjct: 239 YGGSLTGKD---FLPILQELAPAHRIHNAQKSTLNDLLADEDLPDDARTIIEMRLGAAST 295

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           A  K   L    SSD R RG LQ+ GA RT RW+G  FQPQNL R    ++ L + I AL
Sbjct: 296 ASTKYAPLLLGRSSDDRRRGCLQYGGAKRTLRWAGKGFQPQNLARGYYHDDELDRGIAAL 355

Query: 348 NRGETIA--DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
            +G      D   L +  VRSCII   G+K VVAD + +E R LAW+AGE+  +  F  G
Sbjct: 356 LKGRAHRRFDVAKLTASTVRSCIIPEAGRKFVVADYSNVEGRGLAWLAGEETALDTFRAG 415

Query: 406 EDIYVTTYAKAFNTPIDKVSKEQ---RAIGKV 434
            DIY  T  K F    D + KE+   R IGK 
Sbjct: 416 LDIYCVTAGKMFGMDPDDIKKERKDLRQIGKA 447


>gi|297242717|ref|ZP_06926655.1| DNA polymerase I [Gardnerella vaginalis AMD]
 gi|296888928|gb|EFH27662.1| DNA polymerase I [Gardnerella vaginalis AMD]
          Length = 560

 Score =  233 bits (593), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 195/624 (31%), Positives = 292/624 (46%), Gaps = 96/624 (15%)

Query: 82  KTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSID 141
           K+ G+ +    W CT + + T GLP SL++    L   +   K+ EGK LI  FC     
Sbjct: 2   KSEGLFLNPCSWHCTMIWSATLGLPMSLESVGAVLGLDKQ--KLTEGKNLIKYFCL---- 55

Query: 142 SPPYDCTRAN----------HVQAWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWL 189
             P + T+ N            + W+LF  Y KRDVE    + ++L   P+ D     + 
Sbjct: 56  --PCNPTKVNGGRTRNKYFHDKEKWELFKSYNKRDVEVEMSIQEKLSLFPVPDFLWQEFY 113

Query: 190 LDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLIT 249
           LDQTINDRG  ID   V    +L  + +  L  ++  +T   + +      +R +L    
Sbjct: 114 LDQTINDRGIEIDSLFVESAIKLDQEVKTHLMSELKHVTG--LENPNSVLQMRSWL-KEH 170

Query: 250 GIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTL 309
           G+++  + +  +   L      +LA+ L L R   + S++ K   +  A   D R RG  
Sbjct: 171 GLEMESLGKKEVAKELKTVG-KELAEVLRL-RQQLAKSSVKKYTAMKNAACMDYRERGMF 228

Query: 310 QFYGASRTGRWSGCVFQPQNLPRQE-----RSEEILTQ-TIQALNR-GETIADPLGLASD 362
           +FYGA+RTGR++G + Q QNLP+        +  ++ Q  ++AL    E I D L   S 
Sbjct: 229 RFYGANRTGRFAGRLVQLQNLPQNHLPDLAEARSLVKQGNVEALEMLYEDIPDTL---SQ 285

Query: 363 CVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPID 422
            +R+  I   G K +VAD + IEARVLAW+AGE W+++ FA G+DIY ++ ++ F+ P++
Sbjct: 286 LIRTAFIPRTGFKFIVADFSAIEARVLAWLAGEKWRMRVFAEGKDIYCSSASQMFSVPVE 345

Query: 423 K--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           K  V+   R  GK+ ELALGY G     K M +   LD+    + ++             
Sbjct: 346 KHGVNGHLRQKGKIAELALGYGGSVGALKAMGA---LDMGLTEEELQP------------ 390

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
                                    +  AWR  +  V  LW D+       V E  S+  
Sbjct: 391 -------------------------LVDAWRKSNPMVTTLWWDVDRAVKQCVHEHISV-- 423

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD--------CSYLNT-ATSQLMRER 591
            R  N+   V       + I LPS R L Y   + +         +Y    +T +  R  
Sbjct: 424 -RTHNI---VFTYKSGFLIIKLPSKRCLYYVKPRVEENKYGGESVTYEGVGSTKKWERLE 479

Query: 592 TYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLM 651
           +YG K  ENI QAI+RDIL   M+  T   Y IV  VHDE + ET      SV ++C LM
Sbjct: 480 SYGPKFVENITQAIARDILLYAMQ--TLKEYRIVAHVHDEAIIETDKN--VSVQSVCELM 535

Query: 652 TKNPSWAKGLPLKAEGYEAKRYRK 675
            + P WA+GL L+A+GYE + Y+K
Sbjct: 536 GRTPPWAEGLVLRADGYECEFYKK 559


>gi|323173135|gb|EFZ58766.1| DNA-directed DNA polymerase [Escherichia coli LT-68]
          Length = 385

 Score =  225 bits (573), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 141/378 (37%), Positives = 204/378 (53%), Gaps = 8/378 (2%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + +  
Sbjct: 6   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAA 64

Query: 64  ETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +  
Sbjct: 65  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEILGVPQDK 124

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS 181
            K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL   +
Sbjct: 125 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 184

Query: 182 --DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG  +D+ L     E + QE+K+L +   ++TDG ++++ Q  
Sbjct: 185 YQGTELALWHRDQQINDRGVCMDIQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRD 244

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    G++L DM   TL+  ++  ++    K+L+  R  +S ++  K   L + V
Sbjct: 245 ALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRQQASTTSTSKYKALMKGV 304

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       + 
Sbjct: 305 SHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDNI 364

Query: 357 LGLASDCVRSCIIASNGK 374
           + L S  +R CIIA  GK
Sbjct: 365 MELTSSALRGCIIAPTGK 382


>gi|262043421|ref|ZP_06016546.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039247|gb|EEW40393.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 328

 Score =  220 bits (561), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 127/333 (38%), Positives = 180/333 (54%), Gaps = 16/333 (4%)

Query: 353 IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGED 407
           +A  + LAS  +R CI+A  GKKLVV+DL+ IE R+LAW+AGE WK+ AF       G D
Sbjct: 1   MASVMQLASSALRGCIMAPAGKKLVVSDLSNIEGRMLAWLAGEQWKLDAFRQYDEGTGPD 60

Query: 408 IYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVK 467
           +Y   YA+AFN   + V+K QR IGKVMEL LG+ GG   F T A   GLDL++ +    
Sbjct: 61  LYKLAYARAFNISHEDVTKYQRQIGKVMELGLGFGGGVAAFLTFALVYGLDLEELATAAL 120

Query: 468 STSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEG 527
                +   +A+  +     +   + + +++   AC+ +K+ WR  H      W  L   
Sbjct: 121 PNIPRDVQREAKGWYDESVKRKATYGLSERVF-IACDSLKRLWRRAHPETCDFWYQLERT 179

Query: 528 FACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NT 582
               +      +  +      L +RR    + I LPS R L Y      KG+ +Y+  N+
Sbjct: 180 VRTAIA-----TPAKTLYCGYLKVRRDGAWLRIQLPSGRALCYPSPTIEKGNITYMGINS 234

Query: 583 ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYF 642
            + +  R +TYGGKL EN+ QA +RD+L   M      GY IVLTVHDE++ E PDT  +
Sbjct: 235 YSRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIENAGYSIVLTVHDEVICEAPDTDDY 294

Query: 643 SVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +   L SL++ NP WA  +PL A G+EA  YRK
Sbjct: 295 TDAALSSLLSTNPEWAPDIPLNAGGFEAYHYRK 327


>gi|227544664|ref|ZP_03974713.1| DNA-directed DNA polymerase [Lactobacillus reuteri CF48-3A]
 gi|227185389|gb|EEI65460.1| DNA-directed DNA polymerase [Lactobacillus reuteri CF48-3A]
          Length = 449

 Score =  219 bits (557), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 151/466 (32%), Positives = 237/466 (50%), Gaps = 43/466 (9%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +L IDIET S   L + G + YA+     + L  YA D  PVK+ D T+   +PS ++
Sbjct: 1   MKQLSIDIETYSSTNLNQTGGYRYADSDDFELLLFGYAVDFGPVKVVDLTQGEKIPSQII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           Q L D  ++  A N+ FER+   + +G  +    W C+ V + T GLP SL++    L  
Sbjct: 61  QALDDPAIIKSAFNAQFERVCLSRFVGHRLKPAGWHCSRVWSATLGLPLSLRDVGTVLGL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
                K+  GK L+  FC           T+AN  +           WQ F +Y +RDVE
Sbjct: 121 PRQ--KITAGKELVRYFCTSC------KPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDED 223
              E+ ++    P+   E + + +DQ INDRG RID  LV   +K Q+    +  +  + 
Sbjct: 173 VEMEITQKFSRFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQKEFHAQYLQTSQQ 232

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  L +           L+ +L    G++   +++ ++  +L  +  T + + L L +L 
Sbjct: 233 LTGLAN-----PNSPLQLKNWLHQ-QGVETDSLAKASVAQLLQTTTGT-VHQVLALRQLL 285

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
           S  S++ K   + +A+  DG + G LQFYGA+RTGRW+G + Q QNLPR    +  L + 
Sbjct: 286 SK-SSVKKYQAMQKAMCKDGCVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPD--LEEA 342

Query: 344 IQALNRGETIADPL------GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
              + +G T A  +       + S  +R+  I S G    VAD + +EARV+AW++GE+W
Sbjct: 343 RALVKQGNTTALAMLYESVPDVLSQLIRTAFIPSKGHHFYVADFSAVEARVIAWLSGEEW 402

Query: 398 KIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGY 441
           +  AFA  EDIY  + ++ F  P+ K  ++ E R  GK+ ELALGY
Sbjct: 403 RQAAFAKNEDIYCASASQMFGVPVVKHGINGELRQKGKIAELALGY 448


>gi|227544275|ref|ZP_03974324.1| DNA-directed DNA polymerase [Lactobacillus reuteri CF48-3A]
 gi|227185735|gb|EEI65806.1| DNA-directed DNA polymerase [Lactobacillus reuteri CF48-3A]
          Length = 449

 Score =  218 bits (554), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 153/467 (32%), Positives = 242/467 (51%), Gaps = 45/467 (9%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M ++ IDIET S   L + GV+ YA+     + L  YA D  PVK+ D T+   +P  ++
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSDDFELLLFGYATDFGPVKVVDLTQGEKIPPQII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L +  ++  A N+ FER+   + +G  +    W C+ V + T GLP SL++    L  
Sbjct: 61  EVLDNPNIIKSAFNAQFERVCLSRFVGHRLKPTGWHCSRVWSATLGLPLSLRDIGSVLGL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEYCKRDVE 168
                K+  GK L+  FC       P   T+AN  +           WQ F +Y +RDVE
Sbjct: 121 PRQ--KITAGKELVRYFCT------PCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVE 172

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDED 223
              E+ ++L   P+   E + + +DQ INDRG RID  LV   +K Q +   +  +  ++
Sbjct: 173 VEMEITQKLECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKE 232

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  L +           L+ +L    GI    +S+ ++  +L  +  T + + L L +L 
Sbjct: 233 LTGLAN-----PNSPLQLKDWL-QQQGIKTNSLSKASVAQLLQTTTGT-VHQVLALRQLL 285

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ-----ERSEE 338
           S  S++ K   + +A+  DGR+ G LQFYGA+RTGRW+G + Q QNLPR      E + E
Sbjct: 286 SK-SSVKKYQAMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARE 344

Query: 339 ILTQ-TIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           ++ Q  + AL    +++ D L   S  +R+  I S      VAD + +EARV+AW++ E 
Sbjct: 345 LVKQGNVPALAMLYDSVPDVL---SQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEK 401

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGY 441
           W+ ++FA  EDIY  + ++ F  P+ K  ++ E R  GK+ ELALGY
Sbjct: 402 WRQESFAKNEDIYCASASQMFGVPVVKHGINGELRQKGKIAELALGY 448


>gi|320182116|gb|EFW57020.1| DNA polymerase, phage-associated [Shigella boydii ATCC 9905]
          Length = 533

 Score =  217 bits (553), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 146/419 (34%), Positives = 213/419 (50%), Gaps = 15/419 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + +  
Sbjct: 6   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAA 64

Query: 64  ETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +  
Sbjct: 65  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDK 124

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS 181
            K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++ RL   +
Sbjct: 125 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYNRLPKWN 184

Query: 182 --DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG  +D+ L     E + QE+K+L +   ++TDG ++++ Q  
Sbjct: 185 YQGTELALWHRDQQINDRGVCMDMQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRD 244

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    G++L DM   TL+  ++  ++    K+++  RL +S ++  K   L + V
Sbjct: 245 ALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKEMLAIRLQASTTSTSKYKALMKGV 304

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGL 359
           S DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+A N        L +
Sbjct: 305 SHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEAPNAAAKTLKCLQI 364

Query: 360 ASDCVRSCIIAS----NGKKLVVADLAGIEARVLAWIAGEDWK------IKAFANGEDI 408
           AS  V +    S    +  KL   D    EA     +    WK      +KAF  G  +
Sbjct: 365 ASGAVYTDDAGSWSELHDTKLQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHL 423


>gi|262043420|ref|ZP_06016545.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039246|gb|EEW40392.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 362

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 131/349 (37%), Positives = 195/349 (55%), Gaps = 5/349 (1%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L+ D+ET    P+   G  AYAE   + L A+A  DEPV +WD T    +PS L + + D
Sbjct: 6   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAIGDEPVSVWDLTAGEPIPSRLRKAIAD 64

Query: 64  ETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
              +   HNS F+R + +  +  +  P +RW  T V A  + LP +L   C  L   +  
Sbjct: 65  PDTLLYFHNSHFDRTVLRHAMPELAPPVERWRDTMVQALAHSLPGALAALCEVLGVPQDK 124

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP-- 179
            K +EGK+LI  FCK    +S     T   H   WQ F  Y   D+EA RE++KRL    
Sbjct: 125 AKDKEGKSLIQLFCKPRPKNSKLRRATSKTHPIEWQRFVAYAGLDIEAMREVYKRLPKWN 184

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
               E  LW  DQ INDRG+ +D+DLV      + + +K+L E  V++T+G ++++ Q  
Sbjct: 185 YQGTELALWHRDQQINDRGFCVDMDLVHGAIRAVDRAQKRLAEQTVEITNGEVQAATQRD 244

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           A+  ++    G++L DM + T++  ++  ++    K+L+  RL +S ++  K  TL ++V
Sbjct: 245 AMIKHIVESYGVELPDMQKSTIERRIADPDLPPAVKELLHIRLQASATSTSKYKTLLKSV 304

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           SSDGRLRGTLQF GASRTGRW+G +FQPQNL R+  S E +   I+ + 
Sbjct: 305 SSDGRLRGTLQFCGASRTGRWAGRLFQPQNLSRESLSREEIEFGIECMK 353


>gi|170729635|ref|YP_001775068.1| phage-related DNA polymerase [Xylella fastidiosa M12]
 gi|167964428|gb|ACA11438.1| phage-related DNA polymerase [Xylella fastidiosa M12]
          Length = 422

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 154/421 (36%), Positives = 205/421 (48%), Gaps = 60/421 (14%)

Query: 304 RLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG---ETIADPLGLA 360
           R R  +  Y    TGRW+G +FQP NLPR   S+ ++   I A+  G       D + L 
Sbjct: 12  RCRFPISLY----TGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDVVFDDVMALT 67

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN---------------- 404
           S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF +                
Sbjct: 68  SSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGDFDTCQGVDGTWHSGEA 127

Query: 405 ------------------------GEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
                                   G+DIY   YA +F      V+KEQR IGKV ELALG
Sbjct: 128 ITHGALRGAPITLQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKEQRQIGKVQELALG 187

Query: 441 YQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIG 500
           Y GG   F   A+   +DL+  ++           E  E+      +Q P F + D+   
Sbjct: 188 YGGGVGAFAAFAAMYHIDLEAMAEQAALPPLLLQ-EAVEALQWTKANQRPTFGLSDRAW- 245

Query: 501 TACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHI 560
            AC++ K+AWR  H  +   W+ L   FA     G   +A     +    ++  +  + +
Sbjct: 246 LACDVFKRAWRNAHPAIAAFWQALQ--FAATDAIGHPETAHTCCGI---TVQYSRAWLRL 300

Query: 561 VLPSSRRLVYS----DVKGDCSYLNTA--TSQLMRERTYGGKLTENIVQAISRDILCEGM 614
            LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L   M
Sbjct: 301 RLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSRDVLAACM 360

Query: 615 KNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYR 674
                 GY IVLTVHDE+++E  D   F+   L +LM   P WA+GLPL AEG++  RYR
Sbjct: 361 PAIEAAGYAIVLTVHDEMITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFQTHRYR 420

Query: 675 K 675
           K
Sbjct: 421 K 421


>gi|71275469|ref|ZP_00651755.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71900967|ref|ZP_00683080.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71163769|gb|EAO13485.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71729272|gb|EAO31390.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 422

 Score =  209 bits (533), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 154/421 (36%), Positives = 204/421 (48%), Gaps = 60/421 (14%)

Query: 304 RLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG---ETIADPLGLA 360
           R R  +  Y    TGRW+G +FQP NLPR   S+ ++   I A+  G       D + L 
Sbjct: 12  RCRFPISLY----TGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDLVFDDVMALT 67

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN---------------- 404
           S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF +                
Sbjct: 68  SSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFRDFDTCQGVDGTWHSGEA 127

Query: 405 ------------------------GEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
                                   G+DIY   YA +F      V+K+QR IGKV ELALG
Sbjct: 128 ITHGALRGAPITLQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKQQRQIGKVQELALG 187

Query: 441 YQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIG 500
           Y GG   F   A+   +DL+  ++           E  E+      +Q P F + D+   
Sbjct: 188 YGGGVGAFAAFAAMYHIDLEAMAEQAALPPLLLQ-EAVEALQWTKANQRPTFGLSDR-AW 245

Query: 501 TACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHI 560
            AC++ K+AWR  H  +   WK L   FA         +A     +    M+  +  + +
Sbjct: 246 LACDVFKRAWRNAHPAIAAFWKALQ--FAATDAIRHPETAHTCCGI---TMQYSRAWLRM 300

Query: 561 VLPSSRRLVYS----DVKGDCSYLNT--ATSQLMRERTYGGKLTENIVQAISRDILCEGM 614
            LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L   M
Sbjct: 301 HLPSGRVLYYAAPRVDEHGALSYMGTHPMTRKWTRITTYGGKLVENITQAVSRDVLAACM 360

Query: 615 KNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYR 674
                 GY IVLTVHDE+++E  D   F+   L +LM   P WA+GLPL AEG++  RYR
Sbjct: 361 PAIEAAGYAIVLTVHDEMITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFQTHRYR 420

Query: 675 K 675
           K
Sbjct: 421 K 421


>gi|28199207|ref|NP_779521.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182681937|ref|YP_001830097.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|28057313|gb|AAO29170.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182632047|gb|ACB92823.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|307578195|gb|ADN62164.1| DNA-directed DNA polymerase [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 377

 Score =  209 bits (532), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 127/329 (38%), Positives = 170/329 (51%), Gaps = 45/329 (13%)

Query: 156 WQLFGEYCKRDVEATRELFKRLIP--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELI 213
           W  F +Y +RDV A R++ KRL     +  E  LW LDQTINDRG  +D DL       +
Sbjct: 3   WAQFVDYARRDVAAMRDVVKRLPSHNYTGAELALWFLDQTINDRGVLVDTDLAQAAIGAV 62

Query: 214 AQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQL 273
            + ++ L E    LT G+++++ Q  AL  +L    G+ L DM + T++  L    + + 
Sbjct: 63  ERAKQALAERTSDLTAGVVQAATQRDALLHHLSTAHGVALPDMQQHTVERCLDDPLLPET 122

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
            ++L+  R  +S ++  K   L    S DGRLRGTLQF GASRTGRW+G +FQP NLPR 
Sbjct: 123 VRELLSIRRQASTTSTAKYQALLNCTSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRP 182

Query: 334 ERSEEILTQTIQALNRG---ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
             S+E +T  I A+  G       D + L S  +RSC+IA   KKLVVADL+ IE RVLA
Sbjct: 183 TLSQEAITVGIDAMKAGCVDLVFDDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLA 242

Query: 391 WIAGEDWKIKAFA----------------------------------------NGEDIYV 410
           W+AGE  K+ AF                                          G+DIY 
Sbjct: 243 WLAGETPKLHAFGEFDTCQGVDGTWHSGEAITHGALRGAPITLQWNAEHAPIRKGDDIYK 302

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
             YA +F      V+K+QR IGKV ELAL
Sbjct: 303 RAYAHSFGIAPQAVTKQQRQIGKVQELAL 331


>gi|34610177|ref|NP_919002.1| DNA polymerase I [Burkholderia phage BcepNazgul]
 gi|34304552|gb|AAQ63369.1| DNA polymerase I [Burkholderia phage BcepNazgul]
          Length = 693

 Score =  205 bits (522), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 195/733 (26%), Positives = 314/733 (42%), Gaps = 110/733 (15%)

Query: 6   IDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           +D E+RS + LP  G+  Y+  E   I + +++++   V+ W+       P+++ + L D
Sbjct: 7   LDYESRSEEDLPTCGLDIYSAHESTEILMASWSFNGGRVQQWE-IRDGKFPAEVREALED 65

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLT 123
             V+  A N+ FER++ ++ L I+ P K W CT   A       +L+     L   +   
Sbjct: 66  PNVIKRAWNAQFERVMTRRVLKINTPYKNWRCTMARAYMLSFAGNLEMVGGQLGLPQDKV 125

Query: 124 KMEEGKALIARFCKGSIDSPPYDCTRANHVQ---------AWQLFGEYCKRDVEATRELF 174
           K+  GK LI  F K      P   T+ N  +          W  F  Y ++DV A   + 
Sbjct: 126 KLATGKKLINLFSK------PQRITKKNPHKWLDWQTNPFEWDDFLIYNQQDVIAEAAID 179

Query: 175 KRLIPLS--DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           + L P    D E +L+ LDQ INDRG  +DLD       +  + + +L   +  +T   +
Sbjct: 180 EWLAPYPTLDEEWELYELDQLINDRGVPVDLDFCNSATAMADRRKLELVRQMRAITG--L 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSN----ITQLAKDLILNRLASSGSA 288
            +      L+ ++    G    D+ + T+K +L+       +T    +++  R+ S+ ++
Sbjct: 238 ENPNSPQQLKPWV-KARGYRFDDLGKDTVKKVLAEHKDEPVLTGRCDEVLKMRMQSARTS 296

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEE---------- 338
           + K       V    RLR  LQF GA RT RW+G   Q  NL R  ++ E          
Sbjct: 297 VGKYKKFVSLVGPGRRLRFPLQFGGAQRTQRWAGRGVQVHNLGRTPKALEPDGDNDWALC 356

Query: 339 ILTQTIQALNR---GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGE 395
            +T  I+A +    G  + +P+   + CVRS I A  G + V  DL+ IE  V+AW+A  
Sbjct: 357 TVTNAIRAGDYDLLGLMMKEPMDGLAGCVRSAIYAPEGYEFVTCDLSSIETVVIAWLADC 416

Query: 396 DWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHC 455
              +  F  G   Y     + +     +V+ + R + K   L  GY+ G           
Sbjct: 417 QPLLNVFREGRCAYREFATRLYGVEYPEVTSQMRTMSKPAVLGAGYRLGGGDLSHEGKRT 476

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
           GL                 W  AE+  + M  Q    +V             K +R  + 
Sbjct: 477 GL-----------------WGYAENMGIDMSRQEAHDSV-------------KMYREAYP 506

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKG 575
            V QLWKDL    A +++   +I  + V  V  +        +  +LPS RR+ Y   + 
Sbjct: 507 EVPQLWKDLE---AAIIR---TIKTKAVTRVRYVSFEIVGEFLVAILPSGRRMYYHRPRI 560

Query: 576 D-----------------------------CSYL--NTATSQLMRERTYGGKLTENIVQA 604
           +                              SY+  N    + +R+ ++GGK+TEN+VQA
Sbjct: 561 EKKKFQKKNWKTGELLWNEDGSPQTYEKIGFSYMGFNQDIKKWLRQDSHGGKMTENLVQA 620

Query: 605 ISRDILCEGMKNATKNGYDIVLTVHDEIVS--ETPDTPYFSVGTLCSLMTKNPSWAKGLP 662
           I+R+IL  G+ NA K G +IVL VHDEIV+  +  D     +  L   MT    W + +P
Sbjct: 621 IAREILKYGLFNAHKKGLNIVLHVHDEIVTLRKIGDASK-GLHVLKECMTAKRKWYEEMP 679

Query: 663 LKAEGYEAKRYRK 675
           + A G+ A  YRK
Sbjct: 680 VGAAGWSAAFYRK 692


>gi|295114046|emb|CBL32683.1| DNA polymerase I-3'-5' exonuclease and polymerase domains
           [Enterococcus sp. 7L76]
          Length = 545

 Score =  200 bits (508), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 148/476 (31%), Positives = 231/476 (48%), Gaps = 45/476 (9%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L +D+ET S   L K GV+ Y+E     I L AY+ D  PV++ D      +P+++L
Sbjct: 1   MKHLSLDLETYSSVDLSKCGVYKYSESPDFEILLFAYSVDGGPVEVVDLKMDETIPAEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L DETV+  A N+ FER+   + LG+D  +  + W CT V   T GLP SL      L
Sbjct: 61  TSLSDETVIKHAFNASFERVCLSRFLGLDGFLNPRGWQCTMVWGATLGLPLSLVGVGAVL 120

Query: 117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN---------HVQA-WQLFGEYCKRD 166
             ++   K+ EGK LI  FC       P + T+ N         H    W  F  Y  RD
Sbjct: 121 GLNKQ--KLTEGKDLIRYFC------VPCNPTKVNGGRTRNLPHHAPTKWSAFKTYNSRD 172

Query: 167 VEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           VE    +  +L   P+ D     + LDQ INDRG  ID D V    +L    +  L++ +
Sbjct: 173 VEVEIAIQGKLSNFPVLDSVWKEYWLDQEINDRGIEIDKDFVEAAVQLDELSKAGLNQQL 232

Query: 225 VKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
            +LT   + +      +R +L L  G++   + +  +  +L       L + L+L R   
Sbjct: 233 QELTG--LENPNSVLQMRGWL-LDHGLETESLGKKAVDELLEQPIDENLKQVLVL-RQQL 288

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTI 344
           + S++ K   +     SD R RG  QFYGA+RTGR++G     QNLP+   S+    +++
Sbjct: 289 AKSSVKKYQAMQNFACSDNRSRGLFQFYGANRTGRFAGRGIHLQNLPQNHMSDLSEARSL 348

Query: 345 QALNRGETIADPLG----LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
              +  E +    G    + S+ +R+  +   G K +V+D + IEARV+AW++GE W+ +
Sbjct: 349 VKQSNFEMLNILYGNVPNVLSELLRTAFVPREGMKFIVSDFSAIEARVIAWLSGEKWRQE 408

Query: 401 AFANGEDIYVTTYAKAFNTPIDKV-------------SKEQRAIGKVMELALGYQG 443
            F NG DIY  + ++ F  P++K              SK +    +++ +A+G QG
Sbjct: 409 VFKNGGDIYCASASQMFGVPVEKHGVNGLTGRLEELDSKLKELESEIISMAIGGQG 464


>gi|284048438|ref|YP_003398777.1| DNA-directed DNA polymerase [Acidaminococcus fermentans DSM 20731]
 gi|283952659|gb|ADB47462.1| DNA-directed DNA polymerase [Acidaminococcus fermentans DSM 20731]
          Length = 971

 Score =  194 bits (493), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 159/487 (32%), Positives = 234/487 (48%), Gaps = 61/487 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L +D+ET S   L K GV+ YAE     I L  YA D   V++ D  +   +P ++L
Sbjct: 1   MKTLSLDLETYSDVNLAKCGVYKYAESPAFEILLFGYAVDGGAVQVIDLAQGETIPEEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL-----GID---------------IPSKRWICTSV 98
             L D+TV   A N+ FER+   + L      +D               +    W C+ V
Sbjct: 61  DALTDDTVTKWAFNANFERVCLSRYLTDLGRSVDPFQDQHPLSQECARFLSPAGWKCSMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANH------ 152
            +   GLP SL+     LN      KM+EG+ LI  FC       P   TR N       
Sbjct: 121 WSAYMGLPLSLEGVGAVLNLDNQ--KMKEGRELIRYFCV------PCKETRTNGGRTRNL 172

Query: 153 ----VQAWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLV 206
               +  W  F  Y KRDVE    + +RL   P+ +   + + LDQ INDRG  IDL+L 
Sbjct: 173 PQHALDKWNQFKSYNKRDVEVEMAIQQRLQKYPVPEQVWEEYHLDQEINDRGIAIDLELA 232

Query: 207 LKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLIT-GIDLVDMSEGTLKSIL 265
            +   + A+ R+ L   + + T G+         L+M  +L   G+    + +  +K +L
Sbjct: 233 KQAVAMDAKSRESLMAALKEKT-GL---ENPNSVLQMLGWLEDHGLKTDSLGKKQVKELL 288

Query: 266 SHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVF 325
             +   +  + ++  R   + S++ K   +  AV  DGR RG  QFYGA+RTGR +G   
Sbjct: 289 KTAQ--EPLRSVLQLRQKLAKSSVKKYQAMENAVCEDGRARGMFQFYGANRTGRVAGRHI 346

Query: 326 QPQNLPRQ------ERSEEILTQTIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVV 378
           Q QNLP+       E  E +     +AL+   ++I D L   S  +R+  +   G K VV
Sbjct: 347 QLQNLPQNHLPDLSEARELVRQGNYEALDLLYDSIPDVL---SQLIRTAFVPRAGMKFVV 403

Query: 379 ADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVME 436
           +D + IEARV++W+AGE WK  AFA G+DIY +T ++ F  P+ K  V+ E R  GK+ E
Sbjct: 404 SDFSAIEARVISWMAGEKWKSAAFAAGKDIYCSTASQMFGVPVVKHGVNGELRQKGKIAE 463

Query: 437 LALGYQG 443
           LA   +G
Sbjct: 464 LACIAEG 470



 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 86/177 (48%), Gaps = 19/177 (10%)

Query: 508 KAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRR 567
           ++WR+ +  ++  W  +       +++   +    +  V +  M      + I LPS R+
Sbjct: 804 QSWRSANPHIVDFWWQVDGAVKTAIKQRIPVWVNNIRFVCQSGM------LFIELPSGRQ 857

Query: 568 LVYSDVK-GDCSYLNT--------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
           L Y   + G+  +           AT +  R  +YG K  ENIVQ  +RDILC  M+  T
Sbjct: 858 LSYVKPRIGENKFGGESVTYEGIGATKKWERLESYGPKFVENIVQGTARDILCYAMQ--T 915

Query: 619 KNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                IV  VHDE++ E   +   SV  +C  M++ P WA+GL L+A+GYE   Y+K
Sbjct: 916 LRCCAIVGHVHDELIIEC--SKEVSVDAICEQMSRTPPWAEGLVLRADGYECAFYQK 970


>gi|259502603|ref|ZP_05745505.1| prophage LambdaSa04 DNA-directed DNA polymerase [Lactobacillus
           antri DSM 16041]
 gi|259169418|gb|EEW53913.1| prophage LambdaSa04 DNA-directed DNA polymerase [Lactobacillus
           antri DSM 16041]
          Length = 470

 Score =  193 bits (491), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 156/532 (29%), Positives = 247/532 (46%), Gaps = 86/532 (16%)

Query: 167 VEATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLV---LKLQELIAQERKKLDED 223
           +E T++L     P+   E + + +DQ INDRG RID  LV   +K Q +   +  +  ++
Sbjct: 1   MEITQKL--ECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKE 58

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  L +           L+ +L    G     +S+ ++  +L  +   ++ + L L +L 
Sbjct: 59  LTGLAN-----PNSPLQLKDWL-QQQGAKTDSLSKASVAQLL-QTTTGKVHQILALRQLL 111

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ-----ERSEE 338
           S  S++ K   + +A+  DGR+ G LQFYGA+RTGRW+G + Q QNLPR      E + +
Sbjct: 112 SK-SSVKKYQAMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARK 170

Query: 339 ILTQ-TIQALNR-GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           ++ Q  + AL    +++ D L   S  +R+  I S      VAD + +EARV+AW++ E+
Sbjct: 171 LVKQGNVTALAMLYDSVPDVL---SQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEE 227

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           W+ +AFA  EDIY  + ++ F  P+ K  ++ E R  GK+ ELALGY G     K M + 
Sbjct: 228 WRQEAFAKNEDIYCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGA- 286

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACEL--VKKAWRA 512
                                                     KL+ T  EL  + + WR 
Sbjct: 287 -----------------------------------------TKLVLTDDELPPLVQMWRN 305

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
               ++Q W D+ +      +E       +  +  + + R     + + L S R L Y  
Sbjct: 306 ASPHIVQFWWDVDKA----AKECIKTHLPQTTHGMKFIYRSGC--MFLRLRSGRYLCYPK 359

Query: 573 VKGDCSYLNTATSQLM---------RERTYGGKLTENIVQAISRDILCEGMKNATKNGYD 623
            K   +   + +   M         R  TYG KL ENIVQA SRD+L E M+        
Sbjct: 360 PKIGTNRFGSESITFMGINTVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEATENT 419

Query: 624 IVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +V+ +HDE V + P     S+ T+  LMT+ P WA GL L A G+ +  Y+K
Sbjct: 420 VVMHIHDEAVIDAPSNR--SLDTMVQLMTEVPDWANGLILNAAGFVSDFYKK 469


>gi|324103777|gb|ADY17819.1| DNA polymerase [Spalangia cameroni secondary endosymbiont phage]
          Length = 234

 Score =  191 bits (484), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 102/218 (46%), Positives = 140/218 (64%), Gaps = 8/218 (3%)

Query: 255 DMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGA 314
           DM   TL+  ++  +I +  ++L+  RL S  ++  K   L ++VS+DGRLRGT QF GA
Sbjct: 1   DMQASTLQRRVNDPDIPRALRELLSVRLQSCTTSTSKXKALLKSVSADGRLRGTKQFCGA 60

Query: 315 SRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP-LGLASDCVRSCIIAS 371
           SRTGRW+G +FQP NLPR    ++ + + ++AL  G  E I D  + L S  +R CIIA 
Sbjct: 61  SRTGRWAGRIFQPDNLPRPTLDQKTIDEGVEALKAGCAELICDDIMQLTSSALRGCIIAP 120

Query: 372 NGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVTTYAKAFNTPIDKVSK 426
            GKKLV++DL+ IE R+LAW+AGE+WK+ AF+      G+D+Y   YA+AFN     V+K
Sbjct: 121 QGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKLAYARAFNLLPKNVTK 180

Query: 427 EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
            QR IGKVMEL LGY GG   F T A   GLDL + ++
Sbjct: 181 AQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAE 218


>gi|324103783|gb|ADY17822.1| DNA polymerase [Arsenophonus nasoniae]
 gi|324103785|gb|ADY17823.1| DNA polymerase [Eupelmus vesicularis secondary endosymbiont phage]
          Length = 234

 Score =  190 bits (483), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 102/218 (46%), Positives = 141/218 (64%), Gaps = 8/218 (3%)

Query: 255 DMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGA 314
           DM   TL+  ++  +I +  ++L+  RL S  ++  K   L ++VS+DGRLRGT QF GA
Sbjct: 1   DMQASTLQRRVNDPDIPRALRELLSVRLQSCTTSTSKYKALLKSVSADGRLRGTKQFCGA 60

Query: 315 SRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP-LGLASDCVRSCIIAS 371
           SRTGRW+G +FQP NLPR    ++ + + ++AL  G  E I D  + L S  +R CIIA 
Sbjct: 61  SRTGRWAGRIFQPDNLPRPTLDQKTIDEGVEALKAGCAELICDDIMQLTSSALRGCIIAP 120

Query: 372 NGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVTTYAKAFNTPIDKVSK 426
            GKKLV++DL+ IE R+LAW+AGE+WK+KAF+      G+D+Y   YA+AF    + V+K
Sbjct: 121 QGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLYKLAYARAFYLLPENVTK 180

Query: 427 EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
            QR IGKVMEL LGY GG   F T A   GLDL + ++
Sbjct: 181 AQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAE 218


>gi|15838881|ref|NP_299569.1| hypothetical protein XF2290 [Xylella fastidiosa 9a5c]
 gi|9107454|gb|AAF85089.1|AE004041_1 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 312

 Score =  190 bits (483), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 146/252 (57%), Gaps = 5/252 (1%)

Query: 156 WQLFGEYCKRDVEATRELFKRLIP--LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELI 213
           W  F EY +RDV A R++ KRL     +  E  LW LDQTINDRG  ID DLV      +
Sbjct: 3   WAQFVEYARRDVAAMRDVVKRLPSHNYAGAELALWFLDQTINDRGVLIDTDLVQAAIGAV 62

Query: 214 AQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQL 273
            + ++ L +    LT G ++++ Q  AL  +L    G+ L DM + T+   +    + + 
Sbjct: 63  ERAKQTLAQRTEALTGGAVQAATQRDALLQHLNTAHGVALPDMQQHTVARCVDDPALPET 122

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
            ++L+  R  +S ++  K   L    S DGRLRGTLQF GASRTGRW+G +FQP NLPR 
Sbjct: 123 VRELLSIRRQASSTSTAKYQALLHCTSPDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRP 182

Query: 334 ERSEEILTQTIQALNRG---ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
             S+E++   I A+  G       D + L S  +RSC+IA   KKLVVADL+ IE RVLA
Sbjct: 183 TLSQEVIAVGIDAMKAGCVDLVFDDVMALTSSALRSCLIAPTHKKLVVADLSIIEGRVLA 242

Query: 391 WIAGEDWKIKAF 402
           W+AGE  K+ AF
Sbjct: 243 WLAGETPKLHAF 254


>gi|324103779|gb|ADY17820.1| DNA polymerase [Eupelmus vesicularis secondary endosymbiont phage]
          Length = 234

 Score =  190 bits (482), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 102/218 (46%), Positives = 140/218 (64%), Gaps = 8/218 (3%)

Query: 255 DMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGA 314
           DM   TL+  ++  +I +  ++L+  RL S  ++  K   L ++VS DGRLRGT QF GA
Sbjct: 1   DMQASTLQRRVNDPDIPRALRELLSVRLQSCTTSTSKYKALLKSVSVDGRLRGTKQFCGA 60

Query: 315 SRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP-LGLASDCVRSCIIAS 371
           SRTGRW+G +FQP NLPR    ++ + + ++AL  G  E I D  + L S  +R CIIA 
Sbjct: 61  SRTGRWAGRIFQPDNLPRPTLDQKTIDEGVEALKAGCAELICDDIMQLTSSALRGCIIAP 120

Query: 372 NGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVTTYAKAFNTPIDKVSK 426
            GKKLV++DL+ IE R+LAW+AGE+WK+KAF+      G+D+Y   YA+AFN     V+K
Sbjct: 121 QGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLYKLAYARAFNLLPKNVTK 180

Query: 427 EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
            QR IGKVMEL LGY GG   F T A   GL+L + ++
Sbjct: 181 AQRQIGKVMELGLGYGGGVAAFLTFALAYGLNLDELAE 218


>gi|324103781|gb|ADY17821.1| DNA polymerase [Nasonia vitripennis secondary endosymbiont phage]
          Length = 234

 Score =  186 bits (471), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 139/218 (63%), Gaps = 8/218 (3%)

Query: 255 DMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGA 314
           DM   TL+  ++  +I +  ++L+  RL S  ++  K   L ++VS+DGRLRGT QF GA
Sbjct: 1   DMQASTLQRRVNDPDIPRALRELLSVRLQSCTTSTSKYKALLKSVSADGRLRGTKQFCGA 60

Query: 315 SRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP-LGLASDCVRSCIIAS 371
           SRTGRW+G +FQP NLPR    ++ + + ++AL  G  E I D  + L S  +R CIIA 
Sbjct: 61  SRTGRWAGRIFQPDNLPRPTLDQKTIDEGVEALKAGCAELICDDIMQLTSSALRGCIIAP 120

Query: 372 NGKKLVVADLAGIEARVLAWIAGEDWKIKAFA-----NGEDIYVTTYAKAFNTPIDKVSK 426
            GKKLV++DL+ IE R+LAW+AGE+WK+ AF+      G+D+Y   YA+AF      V+K
Sbjct: 121 XGKKLVISDLSNIEGRMLAWLAGENWKVXAFSEFDNGKGDDLYKLAYARAFYLLPXNVTK 180

Query: 427 EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
            QR IGKVMEL LGY GG   F T A   GLDL + ++
Sbjct: 181 AQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDEXAE 218


>gi|71902066|ref|ZP_00684106.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71728177|gb|EAO30368.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 384

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 141/389 (36%), Positives = 186/389 (47%), Gaps = 56/389 (14%)

Query: 336 SEEILTQTIQALNRG---ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
           S+ ++   I A+  G       D + L S  +RSC+IA   KKLVVADL+ IE RVLAW+
Sbjct: 2   SQPVIAVGIDAMKAGCVDLVFDDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWL 61

Query: 393 AGEDWKIKAFAN----------------------------------------GEDIYVTT 412
           AGE  K+ AF +                                        G+DIY   
Sbjct: 62  AGETPKLHAFRDFDTCQGVDGTWHSGEAITHGALRGAPITLQRNAEHEPIRQGDDIYKRA 121

Query: 413 YAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTF 472
           YA +F      V+KEQR IGKV ELALGY GG   F   A+   +DL+  ++        
Sbjct: 122 YAHSFGIAPQAVTKEQRQIGKVQELALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPPLL 181

Query: 473 EDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVV 532
              E  E+      +Q P F + D+    AC++ K+AWR  H  +   WK L   FA   
Sbjct: 182 LQ-EAVEALQWTKANQRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWKALQ--FAATD 237

Query: 533 QEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS----DVKGDCSYLNT--ATSQ 586
                 +A     +    M+  +  + + LPS R L Y+    D  G  SY+ T   T +
Sbjct: 238 AIRHPETAHTCCGI---TMQYSRAWLRMHLPSGRVLYYAAPRVDEHGALSYMGTHPMTRK 294

Query: 587 LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGT 646
             R  TYGGKL ENI QA+SRD+L   M      GY IVLTVHDEI++E  D   F+   
Sbjct: 295 WTRITTYGGKLVENITQAVSRDVLAACMPAIEAAGYQIVLTVHDEIITEADDNAAFNAAH 354

Query: 647 LCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           L +LM   P WA+GLPL AEG++  RYRK
Sbjct: 355 LAALMATPPPWAQGLPLAAEGFQTHRYRK 383


>gi|331090256|ref|ZP_08339143.1| hypothetical protein HMPREF1025_02726 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330401875|gb|EGG81450.1| hypothetical protein HMPREF1025_02726 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 419

 Score =  184 bits (467), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 135/415 (32%), Positives = 220/415 (53%), Gaps = 43/415 (10%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L IDIET S   L K GV+AYA+     I L AY++DDE  K+ D  +   +  ++   L
Sbjct: 9   LAIDIETFSDVDLIKCGVYAYADSPAFEILLFAYSFDDEETKIIDLAQGEQLTEEIKNAL 68

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEH 121
            D  ++  A N+ FER    K +G+ +  + W+CT+V +    LP SL+     L  SE 
Sbjct: 69  SDVGIIKTAFNANFERTCLSKYMGVRLSPESWVCTAVQSAMLALPLSLEGVGAVLGLSEQ 128

Query: 122 LTKMEEGKALIARFCKGSIDSPPYDCTRAN---------HV-QAWQLFGEYCKRDVEATR 171
             K++EGK LI  FC       P   T+ N         H  + W+ F  YC RDV+  +
Sbjct: 129 --KLKEGKDLIRYFC------VPCKPTKTNGGRSRNLPFHAPEKWKQFKTYCIRDVDVEK 180

Query: 172 ELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIV---- 225
            + ++L   P+ + E   + LDQ INDRG  +D +LV   ++ I  +   L +DIV    
Sbjct: 181 GIRQKLHKFPIPESEMAFYRLDQEINDRGVLVDRELV---EQSITCDL--LHKDIVTNRA 235

Query: 226 -KLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
            ++T   + +      L+ +L    G+++  +S+G +  ++  ++  ++ + L L RL  
Sbjct: 236 YEVTG--LENPNSVSQLKGWLSE-RGVEIDSLSKGAVAELIEDAD-GEVLEALKL-RLLM 290

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTI 344
           + +++ K   +  +V SDGR+ G LQFYGA+RTGRW+G + Q QNLP+   S+  L +++
Sbjct: 291 AKTSVKKYEAIERSVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNHISDLELARSL 350

Query: 345 QALNRGETI-----ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
               + E +     + P  + S+ +R+  I   G + +VAD + IEARVLAW++G
Sbjct: 351 VRRGQFEELELFYESTP-NVLSELIRTAFIPKEGCRFIVADFSAIEARVLAWLSG 404


>gi|194432044|ref|ZP_03064333.1| Bbp42 [Shigella dysenteriae 1012]
 gi|194419573|gb|EDX35653.1| Bbp42 [Shigella dysenteriae 1012]
 gi|332089212|gb|EGI94319.1| DNA polymerase [Shigella dysenteriae 155-74]
          Length = 449

 Score =  182 bits (462), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 121/333 (36%), Positives = 171/333 (51%), Gaps = 13/333 (3%)

Query: 89  PSKRWICTSVLARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKG-SIDSPPYDC 147
           P +RW  T V A  +GLP SL   C  L   +   K +EGKALI  FCK    +S     
Sbjct: 7   PVERWRDTMVQALAHGLPGSLGELCEVLGVPQDKAKDKEGKALIQLFCKPRPKNSKLRRA 66

Query: 148 TRANHVQAWQLFGEYCKRDVEATRELFKRLIP--LSDGERDLWLLDQTINDRGYRIDLDL 205
           T   H + W+ F  Y   D+EA RE++ RL        E  LW  DQ INDRG  +D+ L
Sbjct: 67  TSKTHPEEWRRFVAYAGLDIEAMREVYNRLPKWNYQGTELALWHRDQQINDRGVCMDMQL 126

Query: 206 VLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSIL 265
                E + QE+K+L +   ++TDG ++++ Q  AL  ++    G++L DM   TL+  +
Sbjct: 127 ARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRDALIKHIVESYGVELPDMQRSTLERRI 186

Query: 266 SHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVF 325
           ++ ++    K+L+  RL +S ++  K   L + VS DGRLRGTLQF GASRTGRW+G +F
Sbjct: 187 ANPDLPSAVKELLAIRLQASTTSTSKYKALMKGVSHDGRLRGTLQFCGASRTGRWAGRLF 246

Query: 326 QPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIAS----NGKKLVVADL 381
           QPQNLPR    +E + + I+A N        L +AS  V +    S    +  KL   D 
Sbjct: 247 QPQNLPRPSLKQEQIDEGIEAPNAAAKTLKCLQIASGAVYTDDAGSWSELHDTKLQALDS 306

Query: 382 AGIEARVLAWIAGEDWK------IKAFANGEDI 408
              EA     +    WK      +KAF  G  +
Sbjct: 307 ILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHL 339


>gi|83311029|ref|YP_421293.1| hypothetical protein amb1930 [Magnetospirillum magneticum AMB-1]
 gi|82945870|dbj|BAE50734.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 516

 Score =  176 bits (445), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 129/446 (28%), Positives = 202/446 (45%), Gaps = 84/446 (18%)

Query: 268 SNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQP 327
            +I   A+  +  R  ++ ++  KL  + +    DGR RG    YGA  TGRW+G + Q 
Sbjct: 117 GDIEGAARQAVEIRAEAAKASTAKLTAMVKCACDDGRARGLHLVYGAG-TGRWAGRLIQL 175

Query: 328 QNLPRQERSEEILTQTIQALNRGET------IADPLGLASDCVRSCIIASNGKKLVVADL 381
           QNLPR    +  L   I  +  G+          PL + S  +R C+I + G   + +D 
Sbjct: 176 QNLPRGSVKKADLA--IPLIIDGDIDLVSMLFGPPLDVISSNLRGCLIPAEGCDFIQSDF 233

Query: 382 AGIEARVLAWIAGEDWKIKAF-----ANGEDIYVTTYAK-------AFNTPIDKVSKEQR 429
           + IE R+ AW+A E+WKI+AF       G D+Y+    K        +  P+++ S+E+ 
Sbjct: 234 SNIEGRITAWLANEEWKIQAFRDFDAGTGRDLYLIGAEKILTLLKVPYAHPLNENSQERT 293

Query: 430 AIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQY 489
             GKV ELALG+ GG   F++MA+  G+ +           T E+ +Q            
Sbjct: 294 PYGKVPELALGFGGGVGAFQSMAAIYGMKV-----------TDEEADQ------------ 330

Query: 490 PEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRL 549
                           +K AWR  H  V+ LW+++ +     +   G + +     +  +
Sbjct: 331 ----------------IKVAWREAHPRVVALWRNMEDAAFNAISNPGRVVSTAGGRIKYV 374

Query: 550 VMRRHKRDVHIVLPSSRRLVYSD------------------VKGDCSYL--NTATSQLMR 589
           V       + +VLPS R L Y+                   +K   +++  N+ T +  R
Sbjct: 375 VKGGF---LWMVLPSGRPLAYAHPRIEKRRPAWNIGQDEIKLKDTITFMSVNSITRKWER 431

Query: 590 ERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCS 649
             TYGG L EN +QAI+RD+L   +      GY +V+ VHDE ++E       SV    S
Sbjct: 432 CTTYGGSLAENAIQAIARDLLANALLKLEAAGYPVVIHVHDEALAEIRKG-VGSVDEFKS 490

Query: 650 LMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +M   P+WA GLP+ A G+   RYRK
Sbjct: 491 IMCDTPAWAAGLPVAAAGWRGSRYRK 516


>gi|83311820|ref|YP_422084.1| hypothetical protein amb2721 [Magnetospirillum magneticum AMB-1]
 gi|82946661|dbj|BAE51525.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 524

 Score =  174 bits (441), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 131/464 (28%), Positives = 212/464 (45%), Gaps = 85/464 (18%)

Query: 250 GIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTL 309
           G++   +++  ++ +L+  +I   A+  +  R  ++ ++  KL  + +    DGR RG  
Sbjct: 108 GVETEGVAKAAVRQMLA-GDIEGAARQAVEIRAEAAKASTAKLTAMVKCACDDGRARGLH 166

Query: 310 QFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET------IADPLGLASDC 363
             YGA  TGRW+G + Q QNLPR    +  L   I  +  G+          PL + S  
Sbjct: 167 LVYGAG-TGRWAGRLIQLQNLPRGVIKKADLA--IPLIIDGDIDLVSMLFGPPLDVISSN 223

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF-----ANGEDIYVTTYAKA-- 416
           +R C+I + G   + +D + IE R+ AW+A E+WKI+AF       G D+Y+    K   
Sbjct: 224 LRGCLIPAEGCDFIQSDFSNIEGRITAWLANEEWKIQAFRDFDAGTGRDLYLIGAEKILT 283

Query: 417 -----FNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
                +  P+++ S E+   GKV ELALG+ GG   F++MA+  G+ +           T
Sbjct: 284 LLKVLYAHPLNENSPERTPYGKVPELALGFGGGVGAFQSMAAIYGMKV-----------T 332

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
            E+ +Q                            +K AWR  H  V+ LW+++ +     
Sbjct: 333 DEEADQ----------------------------IKVAWREAHPRVVALWRNMEDAAFNA 364

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS------------------DV 573
           +   G + +     +  +V       + +VLPS R L Y+                   +
Sbjct: 365 ISNPGRVVSTAGGRIKYVVKGGF---LWMVLPSGRPLAYAHPRIEKRRPAWNIGQDEIKL 421

Query: 574 KGDCSYL--NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDE 631
           K   +++  N+ T +  R  TYGG L EN +QAI+RD+L   +      GY +V+ VHDE
Sbjct: 422 KDTITFMAVNSITRKWERCTTYGGSLAENAIQAIARDLLANALLKLEAAGYPVVIHVHDE 481

Query: 632 IVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            ++E       SV    S+M   P+WA GLP+ A G+   RYRK
Sbjct: 482 ALAEVRKG-VGSVDEFKSIMCDTPAWAAGLPVAAAGWRGSRYRK 524


>gi|37626195|gb|AAQ96570.1| putative DNA polymerase [Vibrio phage VP16C]
          Length = 686

 Score =  174 bits (441), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 183/721 (25%), Positives = 300/721 (41%), Gaps = 151/721 (20%)

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRW--------ICTSVLARTNGL 105
           P+DL+ ++ +   +  A N  FE  ++   L     S+ W         C    AR   L
Sbjct: 17  PTDLIDHIANGGPI-AAWNITFEFWIWNMVLA---KSEGWPWLQLEQCYCDMAKARRFSL 72

Query: 106 PSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFG----- 160
           P SL  A  AL  +E   K ++GK LI + C+      P   T+A     W L+      
Sbjct: 73  PGSLDTAAKALRTAE---KDKKGKQLIGKLCR------PVSATKARPEPRWTLYTAPQDY 123

Query: 161 ----EYCKRDVEATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQE 216
                YC +DV++   +   +  ++  ER+ WL DQ IN RG  +D++ +    +++ Q 
Sbjct: 124 ADLYRYCDQDVKSEDHVSALVPDMTPAERETWLADQRINARGVLVDVESLDNALDIVGQT 183

Query: 217 RKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKD 276
            ++   ++  +T+G + S  +   L  +L  + G  + ++   T+   L   ++   A+ 
Sbjct: 184 TRRFTMELAAITNGAVGSVSEVAKLTDFLATV-GCRMHNLKSETVAETLERDDLNPTARR 242

Query: 277 LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERS 336
           ++  R A +G+ + KL +L   +SSDGRLR    F+GA  TGRWS    Q QNL     S
Sbjct: 243 ILEIREALAGANVKKLFSLKAQISSDGRLRNQYNFFGAG-TGRWSAGGVQLQNL----TS 297

Query: 337 EEILTQTIQALNR--GET----IADPLGLASDC--------------------------- 363
           +   ++T     R  G++    +    GL  +C                           
Sbjct: 298 KGPKSKTCNGCGRIVGKSCRVEVMGAAGLCPECGANDWTDNKDWTVDAVRWALKDLKHRN 357

Query: 364 ------------------VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
                             +R   IA+ GKK V  D + IEA VLA +A  +W+I+ F   
Sbjct: 358 LDLIIDIWGDPITLLSGCLRGLFIAAPGKKFVCCDFSAIEAVVLAALARCEWRIEVFRTH 417

Query: 406 EDIYVTTYAKAFNTPIDKV--SKEQ--------RAIGKVMELALGYQGGAKVFKTMASHC 455
             IY  + +K    P +++   KE+        +++GKV ELA GY G    +K   +  
Sbjct: 418 GKIYEMSASKISGVPFEEMMAYKEKNKHDHPLRKSLGKVAELASGYGGWIGAWKAFGAE- 476

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
                           FED +  +   L  +D  PE              + + W  +++
Sbjct: 477 --------------EHFEDDDAMKKAILGWRDASPE--------------IVEFWGGQYR 508

Query: 516 GVLQLWKDLTEGFACVVQEGGSISA----RRVANVPRLVMRRHKRDVHIVLPSSR----- 566
                 K + E +     EG  I A     +   V  +        ++  LPS R     
Sbjct: 509 RDPYTRKWVREYYGL---EGAVIMAILNPGKCYAVGDITYAVFDDVLYCRLPSGRFLQYH 565

Query: 567 --RLVYSDVKGDCSY------LNTATSQ----LMRERTYGGKLTENIVQAISRDILCEGM 614
             +L+ SD      Y       NT + +     +R  TYGG+L EN+ QA + D+    M
Sbjct: 566 QPKLIESDSWKGPEYQVTFMGYNTNSQKGPVGWVRMDTYGGRLAENVTQAAAADVQAYAM 625

Query: 615 KNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYR 674
           K    NGY +V+  HDE+++E P   + SV  + +LMT    W +  P++A G+E  RY+
Sbjct: 626 KQCENNGYPVVMHTHDELIAEVPGD-FGSVEEMAALMTGREPWREWWPIRAAGWEDDRYQ 684

Query: 675 K 675
           K
Sbjct: 685 K 685


>gi|269976595|ref|ZP_06183580.1| DNA polymerase [Mobiluncus mulieris 28-1]
 gi|269935396|gb|EEZ91945.1| DNA polymerase [Mobiluncus mulieris 28-1]
          Length = 352

 Score =  174 bits (440), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 119/371 (32%), Positives = 170/371 (45%), Gaps = 67/371 (18%)

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTI 344
           S S++ K   + +   +D R  G LQFYGA+RTGRW+G + Q QNLPR    +    +++
Sbjct: 28  SRSSVAKYRKMIDVTCTDQRAHGLLQFYGANRTGRWAGRLVQVQNLPRNYLPDLAQARSL 87

Query: 345 QALNRGET-------IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
                GET       + D L   S  +R+  I S G + +VAD + IEARVLAW+AGE+ 
Sbjct: 88  VRDGNGETLEMLYSSVPDTL---SQLIRTAFIPSKGHRFIVADYSAIEARVLAWLAGEET 144

Query: 398 KIKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHC 455
            + AF NGED+Y  T +  F  P++K  V+ E R  GK+  LA GY G     K M    
Sbjct: 145 TLAAFKNGEDLYCATASAMFGVPVEKHGVNSELRQKGKIAVLACGYNGSVGALKAMG--- 201

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
                                                A+K  L     + +  AWRA + 
Sbjct: 202 -------------------------------------ALKMGLSEDELQPIVDAWRAANP 224

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK- 574
            ++QLW D+       +  G      R   +  L   +    + I LPS RRL Y     
Sbjct: 225 NIVQLWHDVDNAATRAISTG------RPVTLGNLGFEKKSGMLFINLPSGRRLAYVKPGI 278

Query: 575 GDCSYLNTATS--------QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVL 626
           G   +  T+ +        +  +  TYGGKL ENIVQA +RD+L E +      G+ IV+
Sbjct: 279 GMNRFGGTSITYWGQGVARKWQKLETYGGKLVENIVQATARDLLVEAITRIENAGHRIVM 338

Query: 627 TVHDEIVSETP 637
            +HDE+V + P
Sbjct: 339 HIHDEVVIDEP 349


>gi|253316034|ref|ZP_04839247.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           str. CF-Marseille]
          Length = 368

 Score =  173 bits (438), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 131/418 (31%), Positives = 191/418 (45%), Gaps = 76/418 (18%)

Query: 281 RLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEIL 340
           RL  S +++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L
Sbjct: 3   RLQMSKTSVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL 61

Query: 341 TQTIQALNRGETIAD--------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
            +  + L + +   D        P  L S  VR+   A  G +L V+D + IEARV+AW 
Sbjct: 62  -EIARDLIKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWY 120

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKT 450
           A E W++  F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K 
Sbjct: 121 AKEQWRLDVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKA 180

Query: 451 MAS-HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKA 509
           M +   G++  +    V S                                         
Sbjct: 181 MGALEMGIEENELQGLVDS----------------------------------------- 199

Query: 510 WRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLV 569
           WR  +  ++  WK      AC      ++ +R+  +   L     K  + I LPS R L 
Sbjct: 200 WRNANPNIVNFWK------ACQEAAINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALA 253

Query: 570 YSD-VKGDCSY-----------LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNA 617
           Y   + G+ S+           LN   S+L   +TYGGKL ENIVQA +RD+L   +   
Sbjct: 254 YPKALVGENSWGSQVVEFMGLDLNRKWSKL---KTYGGKLVENIVQATARDLLAISIARL 310

Query: 618 TKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
              G+ IV  VHDE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 311 EALGFKIVGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 367


>gi|325478660|gb|EGC81771.1| DNA-directed DNA polymerase [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 952

 Score =  171 bits (433), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 120/385 (31%), Positives = 178/385 (46%), Gaps = 69/385 (17%)

Query: 311 FYGASRTGR-W----SGCVFQPQNLPRQERSEEILTQTIQALNRGETIA----DPLGLAS 361
           F+   R GR W    SG + Q QNL R    +  L +++      E++      P  + S
Sbjct: 616 FFLVRRNGRVWVTGNSGRLIQVQNLRRNNLQDLDLARSLVRNKEYESLEMLYDSPSDVLS 675

Query: 362 DCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPI 421
             +R+  I   G + +V+D + IEARVLAW+AGEDW + AF NGEDIY +T ++ F  P+
Sbjct: 676 QLIRTAFIPKEGCRFIVSDFSAIEARVLAWLAGEDWVLNAFKNGEDIYCSTASQMFGVPV 735

Query: 422 DK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAE 479
            K  V+ + R  GKV  LA GY G     K M                            
Sbjct: 736 VKHGVNGDLRQKGKVATLACGYGGSVGALKAMG--------------------------- 768

Query: 480 SHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSIS 539
                        A++  L     + +  +WR  +  ++ LW D+      VV+      
Sbjct: 769 -------------AIEMGLSEDELQSIVDSWREANPNIVSLWWDIDSVVKRVVK------ 809

Query: 540 ARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTAT---------SQLMRE 590
            R       LV+   K  + I LPS RRL Y   K   +     +         ++  + 
Sbjct: 810 TRSKEEYKNLVISYEKGILFIELPSKRRLAYPKAKIGMNRFGGESIVYEGIVVGNKWDKI 869

Query: 591 RTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSL 650
            +YGGK  ENIVQAI+RDIL E M    K G++IV+ +HDE+V E+  +   S+  +  +
Sbjct: 870 ESYGGKFVENIVQAIARDILAEAMMRLEKKGFNIVMHIHDEVVIESDSS---SIEEINEI 926

Query: 651 MTKNPSWAKGLPLKAEGYEAKRYRK 675
           M+  PSWA GL L A+G+E++ Y+K
Sbjct: 927 MSLVPSWAPGLILDADGFESEFYKK 951



 Score =  143 bits (360), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 109/331 (32%), Positives = 172/331 (51%), Gaps = 21/331 (6%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M KL ID+ET S   L K GV+ YAE     I L AY+ DD  VK+ D +    +P ++L
Sbjct: 1   MKKLSIDLETYSSVDLGKSGVYKYAESEDFEILLFAYSIDDGGVKVIDLSNGEIIPEEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D+++   A N+ FER+   + LG  +  + W CT + +   GLP SL+     L  
Sbjct: 61  SALSDKSIEKWAFNASFERVCLSRFLGKRLKPQGWYCTMIWSAYLGLPLSLEKVGEVLKL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
            +   KM EGKALI  F   CK +  +        +H ++ W  F EY +RDVE   E+ 
Sbjct: 121 DKQ--KMNEGKALIRYFSIPCKPTKTNGMRTRNLPHHDLEKWSTFKEYNQRDVETEMEIK 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRID---LDLVLKLQELIAQERKKLDEDIVKLTD 229
           K+L   P+   E + + +DQ INDRG  ID   +D  +K  E++ +E     +  ++LT 
Sbjct: 179 KKLSAFPMPQSEWENYWVDQNINDRGILIDEVLVDSAIKFDEILREENM---DRAIELTG 235

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAI 289
             + +      L+ +L    G+++  +++  ++S L   N     K+++  R   S S++
Sbjct: 236 --LENPNSPMQLKEWLNE-KGLEIDSLAKKDVESAL--KNAEGDIKEVLELRQELSKSSV 290

Query: 290 LKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
            K + +     +D R+RG LQFYGA+RTGR+
Sbjct: 291 RKYDAMKNVKGNDKRVRGLLQFYGANRTGRY 321


>gi|325662096|ref|ZP_08150714.1| hypothetical protein HMPREF0490_01452 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471545|gb|EGC74765.1| hypothetical protein HMPREF0490_01452 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 356

 Score =  163 bits (413), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 118/400 (29%), Positives = 178/400 (44%), Gaps = 65/400 (16%)

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  A  +D R RG  QFYGA+RTGRW+G + Q QNLP+    +    + +  +   
Sbjct: 6   KYQAMQNAACTDHRTRGMFQFYGANRTGRWAGRLIQLQNLPQNHMDDLDAARELVRIGDY 65

Query: 351 ETIA----DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           ++++    D     S  +R+  IA  G K  VAD + IEARV+A +AGE W+   F NG 
Sbjct: 66  DSLSMLYDDIPDTLSQLIRTAFIAKPGYKFYVADFSAIEARVIAHLAGESWRADVFKNGG 125

Query: 407 DIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
           DIY  + ++ F+  ++K  ++   R  GK+ ELALGY G     K M             
Sbjct: 126 DIYCASASQMFHVTVEKHGINGHLRQKGKIAELALGYGGSVGALKAMG------------ 173

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDL 524
                                       A++  L     + +  AWR  +  ++ LW D 
Sbjct: 174 ----------------------------ALEMGLTEDELQPLVDAWRQSNPNIVALWWDF 205

Query: 525 TEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-GDCSYLNT- 582
                  ++   S ++  +    R  M      + I LPS R+L Y   + G+  +    
Sbjct: 206 DTAIKNAIKMHCSTASHGIKFTWRSGM------LLITLPSGRKLTYVKPRIGENKFGGES 259

Query: 583 -------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
                  AT +  R   YG K  EN+VQAISRD+L   MK  T +   I   VHDE++ E
Sbjct: 260 VTYEGIGATKKWERLEIYGPKFVENVVQAISRDLLMNAMK--TLSHCFICGHVHDELIIE 317

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             +    S+  LC  M + P W   + L+A+GY  + Y+K
Sbjct: 318 CSEK--VSLEVLCQQMARTPDWMPDILLRADGYVTEFYKK 355


>gi|149882966|ref|YP_001294903.1| DNA polymerase I [Burkholderia phage BcepNY3]
 gi|148763617|gb|ABR10600.1| DNA polymerase I [Burkholderia phage BcepNY3]
          Length = 656

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 189/703 (26%), Positives = 304/703 (43%), Gaps = 84/703 (11%)

Query: 4   LFIDIETRSPQPLPKVGVWAY-AEQAVITLCAYAW---DDEPVKLWDRTEQSAMPSDLLQ 59
           LF+D ET S   L + G+  Y A+Q+    C + +         LW+  ++  +P  + +
Sbjct: 6   LFLDFETSSHTDLTEHGLGRYLADQSTRAYC-FTFRLPGMSTADLWEVGQR--VPEVITR 62

Query: 60  YLRDETVMCVAHNSLFE----RILFKKTLGI-DIPS---KRWICTSVLARTNGLPSSLKN 111
           ++R   +  VAHN+ F+      + ++  G  D+P     +  C++  AR NGLP SL  
Sbjct: 63  HVRAGHLF-VAHNAPFDFWIWNTVLRRQRGYHDLPELQIGQVRCSAARARYNGLPGSLAG 121

Query: 112 ACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATR 171
           AC AL     + K  EG    A++ K    +P  D T A+H + +    +Y   D +A  
Sbjct: 122 ACEALGLP--VQKDTEG----AKWMKEIAANP--DWTPADHPEHFARTYKYALIDTDAMV 173

Query: 172 ELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGI 231
            +++  +PL   E+  + +D  IN RG  +D++    +++L A    +LD ++  LTDG 
Sbjct: 174 GVWENTVPLPAREQAYFEMDMRINARGIGVDVEAAQAMEDLKAFAEAQLDYEMAYLTDGG 233

Query: 232 IRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILK 291
           + +  +   ++ Y   + G D+ D    TLK I +  N+    + LI  RL +S +    
Sbjct: 234 VLAVSEVEKIKTYAATL-GEDMDDAGRETLKKIAARDNLPDSLRQLIELRLDASRAPKKS 292

Query: 292 LNTLSEAVSSDGRLRGTLQFYGA---SRTGRWSGCV-----FQPQNLPRQERSEEILTQT 343
              L   V   GRL+ +  ++GA     T R +G        +P+   +    E IL   
Sbjct: 293 AAILRAHVG--GRLQHSTIYHGALSGRSTARGAGGAQTLNTARPRPGKKTADCEAILDAC 350

Query: 344 IQ---ALNRGETIADPLGLASDCVRSCIIASN-GKKLVVADLAGIEARVLAWIAGEDWKI 399
           ++   A      +   L   +D  R    A+  G  LV ADL+GIEAR   WIAG+   +
Sbjct: 351 LRHDRAYLSSPEVGPILAALADAQRQLFRATQPGHVLVGADLSGIEARFSPWIAGDLELL 410

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDL 459
           +AF  G D Y    A  F    + V+K+QR IGKV  LAL Y GGA  F +MA++ G+ L
Sbjct: 411 EAFEKGVDPYKLAAAAIFQVTYEAVTKDQRQIGKVAMLALTYGGGAGAFVSMAANYGVHL 470

Query: 460 --QQFSQNV----KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             +Q  + V     +   FE W     + + M    P   +   +    C  V       
Sbjct: 471 PPEQVDEIVLNWRAARPAFERWWSLCEYSVLMALDQPNREITMPIGRDFCSHVTFV---- 526

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           H G   L   L  G A +      +     ANVP                     +Y   
Sbjct: 527 HDG-RALRMQLPSGRA-ISYHNARLHLEPGANVP-------------------IAIYDKP 565

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
           +G   Y+ T   ++         L+ N+ Q ++RD+    + +  +    IV  V+DE +
Sbjct: 566 EG---YIETLDRKI---------LSNNMTQGLARDLFWSVLLDVDRV-EQIVHHVYDEAL 612

Query: 634 SET-PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            E   +        L   M +  +W  GLPL AEG+   R+RK
Sbjct: 613 LEVREEVAELRCDQLVERMCRGEAWCPGLPLGAEGWFGLRWRK 655


>gi|41057712|ref|NP_958166.1| gp61 [Burkholderia phage Bcep43]
 gi|40737699|gb|AAR89352.1| gp61 [Burkholderia phage Bcep43]
          Length = 656

 Score =  153 bits (387), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 179/707 (25%), Positives = 295/707 (41%), Gaps = 92/707 (13%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ-SAMPSDLLQYLR 62
           LF+D E  S   L + G+  Y +        + +    +   D  E  + +P  ++ +L 
Sbjct: 6   LFLDFEASSKTDLTEAGLGRYLDDPTTRAYCFTFRLPGMATADLWEYGNVVPKQIVMHLT 65

Query: 63  DETVMCVAHNSLFE----RILFKKTLGI-DIPS---KRWICTSVLARTNGLPSSLKNACL 114
              +  VAHN+ F+     ++ ++  G  D+P     +  C++  AR NGLP SL  AC 
Sbjct: 66  SGGLF-VAHNAPFDFWIWNLILRRQHGYHDLPEIQIGQVRCSAARARYNGLPGSLAGACE 124

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
           AL     + K  EG    A++ K    +P  D T  +H + +    +Y   D +A   ++
Sbjct: 125 ALGLP--VQKDTEG----AKWMKEIAANP--DWTPTDHPEHFSRTYKYALIDTDAMVGVW 176

Query: 175 KRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRS 234
           +  +PL   E+  + +D  IN RG  +D++    +++L A    +LD ++  LTDG I +
Sbjct: 177 ESTVPLPPREQAYFEMDMRINARGIGVDVEAAQAMEDLKAFAEAQLDYEMAYLTDGGILA 236

Query: 235 SRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNT 294
             +   ++ Y   + G D+ D    TLK I +  N+    + LI  RL +S +       
Sbjct: 237 VTEVAKIKEYAATL-GEDMDDAGRETLKKIAARDNLPDSLRQLIELRLDASRAPKKSAAI 295

Query: 295 LSEAVSSDGRLRGTLQFYGA---SRTGRWSGCVFQPQNL--PRQERSEEILTQTIQALNR 349
           L   V   GRL+    ++GA     T R +G   Q  N   PR  +        + A  R
Sbjct: 296 LRAHVG--GRLQHHTIYHGALSGRSTARGAGGA-QTLNTARPRPGKKTADCEAILDACLR 352

Query: 350 GE-------TIADPLGLASDCVRSCIIASN-GKKLVVADLAGIEARVLAWIAGEDWKIKA 401
           G+        +   L   +D  R    A+  G  LV ADL+GIEAR+  W+A +  K++A
Sbjct: 353 GDRAYLSSPEVGPILAALADAQRQLFRATKPGHVLVGADLSGIEARMAPWLANDVPKLEA 412

Query: 402 FANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDL-- 459
           F  G D Y       ++   D V+K+QR +GK  +LALG+ G    F +MA++ G+ L  
Sbjct: 413 FEKGIDGYKLAAMDIYSIEYDAVTKDQRQVGKAADLALGFGGADGAFASMAANYGVHLPP 472

Query: 460 QQFSQNV----KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
           +Q S+ V         FE W        W   +Y      D+      E+V    R    
Sbjct: 473 EQVSEIVYNWRAGRPAFERW--------WSLCEYSALMALDQ---PGREIVMPVGR---- 517

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKG 575
                                        N  ++   +  R + + LPS R + Y + + 
Sbjct: 518 ----------------------------NNCSQITFVKDARALRMHLPSGRAISYHNARL 549

Query: 576 DCSY-LNTATSQLMRERTYGGK-----LTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                 N   +   +   Y        L+ N  Q +SRD+    + +  +   +IV  ++
Sbjct: 550 HLEPGANVPIAIYDKPEGYVETLDRKILSNNQTQGLSRDLFWSVLLDVDRV-EEIVHHIY 608

Query: 630 DEIVSET-PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE + E   +        L   M +  +W  GLPL AEG+   R+RK
Sbjct: 609 DEALLEVLAELAALREKQLVERMCRGEAWCPGLPLGAEGWHGLRWRK 655


>gi|331028082|ref|YP_004421796.1| DNA polymerase A domain protein [Roseobacter phage RDJL Phi 1]
 gi|301341545|gb|ADK73429.1| DNA polymerase A domain protein [Roseobacter phage RDJL Phi 1]
          Length = 838

 Score =  150 bits (380), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 137/498 (27%), Positives = 222/498 (44%), Gaps = 61/498 (12%)

Query: 6   IDIETRSPQPLPKVGVWAYA-EQAVITLC-AYAWDDE-PVKLWDRTE------QSAMPSD 56
           ID ETRSP  + K G + Y+ + A   +C AY    E  VKLW          +S  P+D
Sbjct: 41  IDFETRSPTDIKKRGGFLYSLDPATEAMCLAYHLPGETEVKLWHMAHPEFFIGESPAPTD 100

Query: 57  LLQYLRDETVMCVAHNSLFER-----ILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKN 111
           L  ++     +  AHN+ FER     I+  +     I   +W C++  A    LP SL+ 
Sbjct: 101 LFAFIL-AGGLVEAHNAFFERCIWTNIMIPRYGWPVIKPDQWRCSAAKASAMSLPRSLEE 159

Query: 112 ACLALNFSEHLTKMEEGKALIARFCK------GSIDSPPYDCTRANHVQAWQLFG----- 160
           A  A++    + K  EG+ L+ + CK        ++   +D        A++  G     
Sbjct: 160 AVAAMDLG--IDKDMEGRKLMLKMCKPRKLRKAEMEKWMHDTGHKGRTPAYKSAGYPIVY 217

Query: 161 -----------EYCKRDVEATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKL 209
                      +YCK+DV A   L   L  LS+ E + W +DQ +N RG R DL +  + 
Sbjct: 218 HETEEDLHRLWDYCKQDVFAEHALSLSLPELSEQELETWKMDQWLNWRGARFDLTMAKQA 277

Query: 210 QELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSN 269
             + ++ RK+L+  +  LT GI  ++++  A++ +L     +DL D +  TLK  L +  
Sbjct: 278 LSMASEWRKRLNSILEALT-GITSATKRA-AVKEWLVEEEDLDLPDTAADTLKHYLENEE 335

Query: 270 ITQLAKDLILNRLASSGSAILKLNTL-SEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQ 328
           ++  A+ ++      + ++  K N +  +A   D R R  + ++GA  TGRW+G   Q  
Sbjct: 336 LSARARRVLEIVRDVNKTSTRKYNAMIDKAWEGDERARDLMMYHGAG-TGRWAGKGIQVH 394

Query: 329 NLPRQERSEEILTQTIQALNRGE------TIADPLGLASDCVRSCIIASNGKKLVVADLA 382
           N P ++   +   +  + +  G+         D +   S  +R  I+A  G++L+VAD A
Sbjct: 395 NFPARDLVVKDFDEAAELILDGDLDWCHALYGDVMAFLSHALRGAILAEEGRELMVADYA 454

Query: 383 GIEARVLAWIAGEDWKIKAFANGEDIYV------------TTYAKAFNTPIDKVSKEQRA 430
            IEAR + W A +   +  F  G+DIY                AK +  P   +    R 
Sbjct: 455 AIEARCVLWEADDQQGLGVFRRGDDIYCDMATGIYGFEVQKKIAKDWTHPDYTLHSGCRQ 514

Query: 431 IGKVMELALGYQGGAKVF 448
            GK   L LGY  G   F
Sbjct: 515 FGKQAILGLGYGMGYMTF 532



 Score = 89.7 bits (221), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 72/134 (53%), Gaps = 17/134 (12%)

Query: 558 VHIVLPSSRRLVYSD------------VKGDCSYLNT--ATSQLMRERTYGGKLTENIVQ 603
           +H  LPS RR+ Y D             K    Y++    T + +R  TYGGK+ ENI Q
Sbjct: 706 LHCELPSGRRMSYCDPQIKLTKTSWGETKPALRYMSVDGVTRKWVRTATYGGKIVENITQ 765

Query: 604 AISRDILCEGMKNATKNG--YDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGL 661
           A++RDI+ E M N+ K G  YD +++VHDE+V E  D     +    +LM+  P WA G 
Sbjct: 766 AVARDIMAEAMLNSVKEGCPYDPIMSVHDELVCEV-DEDKGDLEEFETLMSDLPIWAAGC 824

Query: 662 PLKAEGYEAKRYRK 675
           P+ AE    KRYRK
Sbjct: 825 PIVAEAERFKRYRK 838


>gi|71902389|ref|ZP_00684353.1| phage-related DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71727877|gb|EAO30114.1| phage-related DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 300

 Score =  147 bits (372), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 89/230 (38%), Positives = 118/230 (51%), Gaps = 43/230 (18%)

Query: 253 LVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFY 312
           L DM + T++  L    + +  ++L+  R  +S ++  K   L    S DGRLRGTLQF 
Sbjct: 13  LPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALLNCTSGDGRLRGTLQFN 72

Query: 313 GASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG---ETIADPLGLASDCVRSCII 369
           GASRTGRW+G +FQP NLPR   S+ ++   I A+  G       D + L S  +RSC+I
Sbjct: 73  GASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDVVFDDVMALTSSALRSCLI 132

Query: 370 ASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN------------------------- 404
           A   KKLVVADL+ IE RVLAW+AGE  K++AF +                         
Sbjct: 133 APTHKKLVVADLSNIEGRVLAWLAGETPKLQAFGDFDTCQGVDGTWHSGEAITHGALRGA 192

Query: 405 ---------------GEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
                          G+DIY   YA +F      V+K+QR IGKV ELAL
Sbjct: 193 PITLQWNAEHEPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKVQELAL 242


>gi|84662708|ref|YP_453672.1| putative DNA polymerase I [Xanthomonas phage OP2]
 gi|84570757|dbj|BAE72819.1| putative DNA polymerase I [Xanthomonas oryzae phage OP2]
          Length = 658

 Score =  147 bits (372), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 171/658 (25%), Positives = 282/658 (42%), Gaps = 123/658 (18%)

Query: 69  VAHNSLFERILFKKTLGIDIPSKRWI--------------CTSVLARTNGLPSSLKNACL 114
           VAHN+ F+ +++   L       RW+              C++  AR NGLP  L  A  
Sbjct: 73  VAHNAAFDALIWNDVL------PRWVKADLPQLNLRGQVQCSAARARYNGLPGGLGRAAE 126

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
           AL     L K  EG A +    K  + +P +  T A H + +    +Y   D +    L+
Sbjct: 127 ALGLP--LQKDREGAAAM----KELMHNPEW--TPATHPELFARTYKYALLDTDVMVALW 178

Query: 175 KRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRS 234
           +   P+   E+  W LD  IN RG+ +D++    + E+    +  +D ++   T G I +
Sbjct: 179 EATQPMPPKEQLYWQLDLEINMRGFGVDVEAAEGMAEMAQLAQAMIDFEVETATQGKILT 238

Query: 235 SRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS-----AI 289
           +     ++ +   + G +L +    ++K++L+  ++ ++ +D++  RL +S +     AI
Sbjct: 239 TSVIKQIQSFAAGL-GAELDEAGRESVKALLTRDDVPEVLRDVLTLRLDASRAPKKHDAI 297

Query: 290 LKLNTLSEAVSSDGRLRGTLQFYGASRTGRWS--GCV-FQPQNL--PRQERSEEILTQTI 344
           L+ +        +GR+  +  ++GA  +GR +  GC   Q  N+  PR  R  +     +
Sbjct: 298 LRAHV-------NGRMCHSTVYHGA-LSGRSTAMGCGDVQLLNVARPRPGRKVKDTITYL 349

Query: 345 QALNRGE-------TIADPLGLASDCVRSCIIASN-GKKLVVADLAGIEARVLAWIAGED 396
            A  R +        +  PL   +D  R    A+N G  LVVADL+GIEAR   W+A ++
Sbjct: 350 DAARRRDYDYLSRPEVGPPLAALADAQRHLFCATNPGCILVVADLSGIEARKGPWLANDE 409

Query: 397 WKIKAFANGEDIYVTTYAKAFNTP-IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHC 455
             +  +  G D Y    A  F+ P  D V+ +QR IGK+  LAL + GG      MA   
Sbjct: 410 GMLVEYEQGIDGYKVEAATIFDLPDTDAVTSDQRQIGKITRLALQFGGGDGALDNMAKAY 469

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHL----WMQDQYPEFAVKDKLIGTACELVKKAWR 511
           GL+L   S++++       W   ESH      W   +Y      D+              
Sbjct: 470 GLEL---SEDLRRKIV---WSYRESHPALSTWWASLEYAALIALDQ-------------- 509

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSI--SARRVANVPRLVMRRHKRDVHIVLPSSRRLV 569
                          G A VV  G  +  SA  V +   L M          LPS R + 
Sbjct: 510 --------------PGRAVVVPIGRGLCTSATFVRDTTALRME---------LPSGRAIS 546

Query: 570 YSDVK-----GDCSYL------NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
           Y + +     G  + +      N     L R+      L+ N+ Q ++RD+  E M +  
Sbjct: 547 YHNARLVLEPGASAPIAVYDKPNGVVETLDRK-----ILSNNMTQGLARDLFWEAMLSVA 601

Query: 619 KNGYDIVLTVHDEIVSETPDT-PYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                IV  V+DE++ E P+      +  L + ++K P WA GLPL AEG+ +  +RK
Sbjct: 602 PV-EQIVHHVYDEVILEVPEERAELRLKQLEARLSKAPLWAPGLPLGAEGFVSPYWRK 658


>gi|15838882|ref|NP_299570.1| hypothetical protein XF2291 [Xylella fastidiosa 9a5c]
 gi|9107455|gb|AAF85090.1|AE004041_2 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 252

 Score =  142 bits (357), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 95/265 (35%), Positives = 134/265 (50%), Gaps = 27/265 (10%)

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQN-------VKSTSTFEDWE 476
           ++KEQR IGKV ELALGY GG   F   A+   +DL+  +         ++  +   +W 
Sbjct: 1   MTKEQRQIGKVQELALGYGGGVGAFAAFAALYHIDLEAMAAQAVFPPLLLQEATELLEWT 60

Query: 477 QAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGG 536
           +A        +  P F + D+    AC++ K+AWR  H  +   W+ L       +    
Sbjct: 61  KA--------NHRPTFDLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQFAVTDAIHHPE 111

Query: 537 SISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS----DVKGDCSYLNTA--TSQLMRE 590
           +           + ++  +  + + LPS R L Y+    D  G  SY+ T   T +  R 
Sbjct: 112 TTH-----TCCGITVQYRRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRL 166

Query: 591 RTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSL 650
            TYGGKL ENI QA+SRD+L   M      GY IVLTVHDEI++E  D P F+   L +L
Sbjct: 167 TTYGGKLVENITQAVSRDVLAACMPAIEAAGYSIVLTVHDEIITEADDHPCFNAAHLAAL 226

Query: 651 MTKNPSWAKGLPLKAEGYEAKRYRK 675
           M   P WA+GLPL AEG++  RYRK
Sbjct: 227 MATPPPWAEGLPLAAEGFDTYRYRK 251


>gi|37626129|gb|AAQ96505.1| putative DNA polymerase [Vibrio phage VP16T]
          Length = 714

 Score =  140 bits (354), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 122/476 (25%), Positives = 207/476 (43%), Gaps = 93/476 (19%)

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKR----WI------CTSVLARTN 103
           P+DL++++ +   +  A N  FE  ++   L     +KR    W+      C    AR  
Sbjct: 107 PTDLIEHIANGGPI-AAWNITFEFWIWNMVL-----AKREGWPWLQLEQCYCDMAKARRF 160

Query: 104 GLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGE-- 161
            LP SL  A  AL  S    K ++GK LI + C+      P   T+A  +  W L+    
Sbjct: 161 SLPGSLDAAAQALKTSP---KDKKGKQLINKLCR------PVSATKARPLPRWTLYTAPQ 211

Query: 162 -------YCKRDVEATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIA 214
                  YC +DV++   +      ++  ER+ WL DQ IN RG ++D++ +    +++ 
Sbjct: 212 DYSDLYAYCDQDVKSEDHVSALTPDMTPSERETWLADQRINARGVQVDVESLDNALDIVD 271

Query: 215 QERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLA 274
           Q  ++   ++  +T+G + S  +   +  +L  + G  + +++  ++   L   ++   A
Sbjct: 272 QTTRRFTMELAAITNGAVGSVSEVAKMTDFLAGL-GCRMHNLTADSVSEALERDDLNPTA 330

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
           + ++  R A +G+ + KL +L   +SSDGRLR    F+GA  TGRWS    Q QNL  + 
Sbjct: 331 RRVLEIREALAGANVKKLFSLKAQISSDGRLRNQYNFFGAG-TGRWSAGGVQLQNLTSKG 389

Query: 335 RSEEILTQTIQALNRGETI----------------------------------------- 353
              +      + + +  TI                                         
Sbjct: 390 PKSKTCNGCGRIVGKACTIEVMGATGLCPECGGNEWTDNKDWTVDAVRWALKDLTHRNLD 449

Query: 354 ------ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGED 407
                  DP+ L S C+R   IA+ GKK V  D + IEA VLA +A  +W+++ F     
Sbjct: 450 LIIAIWGDPITLLSGCLRGLFIAAPGKKFVCCDFSAIEAVVLAALARCEWRLEVFRTHGK 509

Query: 408 IYVTTYAKAFNTPIDKV--SKEQ--------RAIGKVMELALGYQGGAKVFKTMAS 453
           IY  + +K    P +++   KEQ        +++GKV ELA GY G    +K   +
Sbjct: 510 IYEMSASKISGVPFEEMMAYKEQNKHDHPLRKSLGKVAELASGYGGWLGAWKAFGA 565


>gi|254443055|ref|ZP_05056531.1| DNA polymerase I domain protein [Verrucomicrobiae bacterium DG1235]
 gi|198257363|gb|EDY81671.1| DNA polymerase I domain protein [Verrucomicrobiae bacterium DG1235]
          Length = 596

 Score =  139 bits (349), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 112/389 (28%), Positives = 156/389 (40%), Gaps = 91/389 (23%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           L T+      DG L   L+++GA  TGRW+G                      Q  NR  
Sbjct: 294 LETMQSRCRRDGSLPFGLKYFGAIATGRWAGDA----------------GLNFQNFNREA 337

Query: 352 TIA-DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYV 410
               DP        R C++A  G KL++ADL+ IE RVLAWIAG+        NG  IY 
Sbjct: 338 YYGVDP--------RKCLVARPGHKLIIADLSQIEPRVLAWIAGDRELFDKIRNGLPIYQ 389

Query: 411 TTYAKAFNTPIDKVSKEQRA---IGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVK 467
                + N     + KE      + K   + LGY  G K F+++A   GL++        
Sbjct: 390 AHAETSMNWKGGDLKKENSNLYLLAKCRVIGLGYGAGCKTFQSLARGYGLEMS------- 442

Query: 468 STSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEG 527
                                          IG A   V   +R  +  ++ LW+ + + 
Sbjct: 443 -------------------------------IGEAKRTVDD-FRKANPRIVSLWQAVEDS 470

Query: 528 FACVVQEGGSISARRVANVPRLVMRRH-KRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQ 586
                                  MR H      + LPS R + Y DV+ +     T    
Sbjct: 471 -----------------------MRYHIGSTFFMYLPSLRSIRYFDVQEEEGLTATTERG 507

Query: 587 LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGT 646
             R   YGGKLTEN+VQA +RD+  EG+    K G  I+ TVHDE++ E P+    +V T
Sbjct: 508 GRRLHWYGGKLTENLVQATARDVFAEGLLRIHKAGIRILWTVHDEVICEVPENSDITVET 567

Query: 647 LCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +  L+ + P W  GLP+ AEG E   Y K
Sbjct: 568 VTDLLAQTPDWIPGLPVAAEGIETSCYTK 596


>gi|62327352|ref|YP_224065.1| hypothetical protein BPKS7gp43 [Salmonella phage SS3e]
 gi|57472386|gb|AAW51248.1| hypothetical protein [Salmonella phage SS3e]
          Length = 306

 Score =  137 bits (344), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 129/286 (45%), Gaps = 47/286 (16%)

Query: 436 ELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWM---------- 485
           EL LGY+GG   F T A + GLDL + ++ +  T     W      + W           
Sbjct: 22  ELGLGYEGGVGAFVTFAKNLGLDLIEMAKTMDGTFPDHIWAATARGYEWARIQEAKRPPH 81

Query: 486 ---QDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGG-----S 537
              +D  P + + DK +   C+ +K+ WR  H   +  W+DL +G    V+  G      
Sbjct: 82  PGEKDDRPSY-ILDKKVWRTCDAIKRMWRESHPETVAFWRDLKDGILAAVRNPGREFWAG 140

Query: 538 ISARRVANVPRLVMRRHKRD----------VHIVLPSSRRLVYSDV-------KGDCSYL 580
              RR       + R  + D          + + LPS R L Y  +         +   +
Sbjct: 141 AHLRRNGERAIRIWRTVEFDSSGRKVPGWWLCMELPSGRILSYPGIGVSVTKETDEDGRI 200

Query: 581 NT-------ATSQLMRE----RTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
           NT         +QL R+     T+GGK  ENIVQA+ RD+L   M N    GY IVL+VH
Sbjct: 201 NTNVRIKYQGENQLTRQWTTLYTHGGKACENIVQALCRDLLAYAMLNVEAGGYPIVLSVH 260

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE+V ETPDT  ++V  L  LM   P WA G PL AEG E KRY K
Sbjct: 261 DELVCETPDTSDYTVAELEKLMCALPEWADGFPLVAEGAELKRYAK 306


>gi|38638673|ref|NP_944374.1| gp66 [Burkholderia phage Bcep1]
 gi|34486055|gb|AAQ73412.1| gp66 [Burkholderia phage Bcep1]
          Length = 655

 Score =  136 bits (343), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 183/709 (25%), Positives = 297/709 (41%), Gaps = 97/709 (13%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAW---DDEPVKLWDRTEQSAMPSDLLQY 60
           LF+D ET S   L + G+  Y +        + +         LW+  +   +P  ++ +
Sbjct: 6   LFLDFETSSHTDLTEHGLGRYLDDPSTRAYCFTFRLPGMSTADLWEVGQ--PVPKQIIGH 63

Query: 61  LRDETVMCVAHNSLFE----RILFKKTLGI-DIPS---KRWICTSVLARTNGLPSSLKNA 112
           L       VAHN+ F+      + ++  G  D+P     +  C++  AR NGLP SL  A
Sbjct: 64  LNGSPF--VAHNAPFDFWIWNTVLRRQRGYHDLPELQIGQVRCSAARARYNGLPGSLAGA 121

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRE 172
           C AL     + K  EG    A++ K    +P  D T A+H + +    +Y   D +A   
Sbjct: 122 CEALGLP--VQKDTEG----AKWMKEIAANP--DWTPADHPEHFTRTYKYALIDTDAMVG 173

Query: 173 LFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           +++  +PL   E+  + +D  IN RG  +D++    +++L A    +LD ++  LTDG I
Sbjct: 174 VWENTVPLPAREQAYFEMDMRINARGIGVDVEAAQAMEDLKAFAEAQLDYEMAYLTDGGI 233

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +  +   ++ Y   + G D+ D    TLK I +  N+    + LI  RL +S +     
Sbjct: 234 LAVTEVAKIKEYAATL-GEDMDDAGRETLKKIAARDNLPDSLRQLIELRLDASRAPKKSA 292

Query: 293 NTLSEAVSSDGRLRGTLQFYGA---SRTGRWSGCVFQPQNL--PRQERSEEILTQTIQAL 347
             L   V   GRL+    ++GA     T R +G   Q  N   PR  +        + A 
Sbjct: 293 AILRAHVG--GRLQHHTIYHGALSGRSTARGAGGA-QTLNTARPRPGKKTADCEAILDAC 349

Query: 348 NRGE-------TIADPLGLASDCVRSCIIASN-GKKLVVADLAGIEARVLAWIAGEDWKI 399
            RG+        +   L   +D  R    A+  G  LV ADL+GIEAR+  W+A +  K+
Sbjct: 350 LRGDRAYLSSPEVGPILAALADAQRQLFRATKPGHVLVGADLSGIEARMAPWLANDVPKL 409

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDL 459
           +AF  G D Y       ++   D V+K+QR +GKV +LALG+ GG   F +MA++ G+ L
Sbjct: 410 EAFEKGIDGYKLAAMDIYSIEYDAVTKDQRQVGKVADLALGFGGGDGAFASMAANYGVHL 469

Query: 460 --QQFSQNV----KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             +Q S+ V         FE W        W   +Y      D+                
Sbjct: 470 PPEQVSEIVYNWRAGRPAFERW--------WSLCEYSVLMALDQ--------------PG 507

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
            + V+ + +D       V                     R  R + + LPS R + Y + 
Sbjct: 508 REVVMPVGRDFCSQITFV---------------------RDARALRMHLPSGRAISYHNA 546

Query: 574 KGDCSY-LNTATSQLMRERTYGGK-----LTENIVQAISRDILCEGMKNATKNGYDIVLT 627
           +       N   +   +   Y        L+ N  Q ++RD+    + +  +   +IV  
Sbjct: 547 RLHLEPGANVPIAIYDKPEGYVETLDRKILSNNQTQGLARDLFWSVLLDVDRV-EEIVHH 605

Query: 628 VHDEIVSET-PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V+DE + E   +        L   M +  +W  GLPL AEG+   R+RK
Sbjct: 606 VYDEALLEVLAELAALRQKQLVERMCRGEAWCPGLPLGAEGWHGLRWRK 654


>gi|284009391|emb|CBA76577.1| phage DNA polymerase [Arsenophonus nasoniae]
          Length = 223

 Score =  136 bits (343), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 84/206 (40%), Positives = 113/206 (54%), Gaps = 5/206 (2%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           LF D+ET S  P+   G   YAE A I L AYA++ EPVK+WD T+   MP DL  YL D
Sbjct: 10  LFCDLETYSDIPI-NCGTHRYAENAEILLFAYAYNHEPVKVWDVTQDKTMPKDLKAYLDD 68

Query: 64  ETVMCVAHN-SLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
             ++ V HN  +F+ ++ K  L ID+P  R   T V A  +GLP +L + C   N +   
Sbjct: 69  PEILTVWHNGGMFDTVILKHALNIDLPLSRVHDTLVQALAHGLPGALGSLCDIFNVNSDK 128

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLI--P 179
           TK +EGKALI  FCK    +S     T   H + W  F  Y   D+ A RE+++ L    
Sbjct: 129 TKDKEGKALIQLFCKPRPKNSKIQRATALTHFEEWLRFKTYAGSDILAMREIYQHLPRWN 188

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDL 205
           ++  E  LW LDQ IN RG  +D++L
Sbjct: 189 MNFNETTLWQLDQRINLRGMCMDVEL 214


>gi|323443494|gb|EGB01110.1| hypothetical protein SAO46_0719 [Staphylococcus aureus O46]
          Length = 330

 Score =  135 bits (339), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 106/336 (31%), Positives = 158/336 (47%), Gaps = 32/336 (9%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SDLLQY- 60
           IDIE  S   + K G + Y  AE   I + AY+ D  PV   D T+    P  +D   + 
Sbjct: 3   IDIEIYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGPVSAIDMTKVDNEPYHADYETFK 62

Query: 61  --LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKCAFNANFERTCLAKHFNKSMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYCKRDVE 168
                K + GK LI  F      S P   T+ N            + WQ F +YC RDVE
Sbjct: 123 QNQ--KDKAGKNLIRYF------SMPCKPTKVNGGRTRNLPEHDPEKWQQFIDYCIRDVE 174

Query: 169 ATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
               +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q + +L +   +
Sbjct: 175 VEMAIANKIKDFPVTTIEQKYWVFDQHINDRGIKLSKSLMLGANVLDKQSKGELLKQAKQ 234

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           +TD  + +      L  +L    G+D+ ++ + T++  L  +  T  AK ++  RL  S 
Sbjct: 235 ITD--LENPNSPTQLLTWLNKEQGLDIPNLQKKTVQDYLKEA--TGKAKKMLEIRLQMSK 290

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSG 322
           +++ K N + + + SD R+RG  QFYGA  TGRW+G
Sbjct: 291 TSVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAG 325


>gi|23752370|ref|NP_705685.1| gp62 [Burkholderia phage Bcep781]
 gi|23507237|gb|AAN38060.1| gp62 [Burkholderia phage Bcep781]
          Length = 655

 Score =  132 bits (332), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 181/709 (25%), Positives = 295/709 (41%), Gaps = 97/709 (13%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAW---DDEPVKLWDRTEQSAMPSDLLQY 60
           LF+D E  S   L + G+  Y +        + +         LW+  +   +P  ++ +
Sbjct: 6   LFLDFEASSKTDLTEAGLGRYLDDPTTRAYCFTFRLPGMSTADLWEVGQ--PVPKQIVGH 63

Query: 61  LRDETVMCVAHNSLFE----RILFKKTLGI-DIPS---KRWICTSVLARTNGLPSSLKNA 112
           L       VAHN+ F+     ++ ++  G  D+P     +  C++  AR NGLP SL  A
Sbjct: 64  LNGSPF--VAHNAPFDFWIWNLVLRRQHGYHDLPEIQIGQVRCSAARARYNGLPGSLAGA 121

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRE 172
           C AL     + K  EG    A++ K    +P  D T A+H + +    +Y   D +A   
Sbjct: 122 CEALGLP--VQKDTEG----AKWMKEIAANP--DWTPADHPEHFARTYKYALIDTDAMVG 173

Query: 173 LFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           +++  +PL    +  + +D  IN RG   D++    +++L A    +LD ++  LTDG I
Sbjct: 174 VWENTVPLPPRMQAEFEMDMRINHRGIGTDVEAAQAMEDLKAFAEAQLDYEMAYLTDGGI 233

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +  +   ++ Y   + G D+ D    TLK I +  N+    + LI  RL +S +     
Sbjct: 234 LAVTEVAKIKEYAATL-GEDMDDAGRETLKKIAARDNLPDSLRQLIELRLDASRAPKKSA 292

Query: 293 NTLSEAVSSDGRLRGTLQFYGA---SRTGRWSGCVFQPQNL--PRQERSEEILTQTIQAL 347
             L   V   GRL+    ++GA     T R +G   Q  N   PR  +        + A 
Sbjct: 293 AILRAHVG--GRLQHHTIYHGALSGRSTARGAGGA-QTLNTARPRPGKKTADCEAILDAC 349

Query: 348 NRGE-------TIADPLGLASDCVRSCIIASN-GKKLVVADLAGIEARVLAWIAGEDWKI 399
            RG+        +   L   +D  R    A+  G  LV ADL+GIEARV  W+A +  K+
Sbjct: 350 LRGDRAYLSSPEVGPILAALADAQRQLFRATKPGHVLVGADLSGIEARVAPWLANDVPKL 409

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDL 459
           +AF  G D Y       ++   D V+K+QR +GK  +LALG+ GG   F +MA++ G+ L
Sbjct: 410 EAFEKGIDGYKLAAMDIYSIEYDAVTKDQRQVGKAADLALGFGGGDGAFASMAANYGVHL 469

Query: 460 --QQFSQNV----KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             +Q S+ V         FE W        W   +Y      D+                
Sbjct: 470 PPEQVSEIVYNWRAGRPAFERW--------WSLCEYSVLMALDQ---------------- 505

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
                        G   V+  G +       N  ++   +  R + + LPS R + Y + 
Sbjct: 506 ------------PGREIVMPVGRN-------NCSQITFVKDARALRMHLPSGRAISYHNA 546

Query: 574 KGDCSY-LNTATSQLMRERTYGGK-----LTENIVQAISRDILCEGMKNATKNGYDIVLT 627
           +       N   +   +   Y        L+ N  Q ++RD+    + +  +   +IV  
Sbjct: 547 RLHLEPGANVPIAIYDKPEGYVETLDRKILSNNQTQGLARDLFWSVLLDVDRV-EEIVHH 605

Query: 628 VHDEIVSET-PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V+DE + E   +        L   M +  +W  GLPL AEG+   R+RK
Sbjct: 606 VYDEALLEVLAELAALREKQLVERMCRGEAWCPGLPLGAEGWHGLRWRK 654


>gi|126015344|gb|ABN70703.1| DNA polymerase 4 [Salmonella phage SETP7]
 gi|126015346|gb|ABN70704.1| DNA polymerase 4 [Salmonella phage SETP11]
          Length = 237

 Score =  126 bits (317), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 126/236 (53%), Gaps = 15/236 (6%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M+ L++D ET S   L KVG +AYAE     I +C YA+D+ PV++WD T+ S MP DL 
Sbjct: 1   MNLLYLDTETFSEADLKKVGSYAYAEHPTTEIVICTYAFDEGPVQVWDATDGSDMPRDLR 60

Query: 59  QYL-----RDETVMCVAHNSL-FERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNA 112
           + +      D  +  V  N L F+R + K   G ++  +  I T ++A  + LP SL   
Sbjct: 61  RAMLKLQKPDSNLKLVGQNFLMFDRPVIKHCWGFELLVENIIDTMIVAFRHALPGSLAAL 120

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRA---NHVQAWQLFGEYCKRDVEA 169
           C  LN    + K + GKALI RF K +  +  Y   R     H + W  F  Y K D+ +
Sbjct: 121 CEVLNIDASMAKDKRGKALIQRFSKPTPKN--YKIRRYTADTHPKEWAEFIAYAKSDITS 178

Query: 170 TRELFKRLIPLSDGERD--LWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
            RE++K++    + E +  +  LDQ INDRG+++D+ L     E + + +++L E+
Sbjct: 179 MREVYKKMPKWGNSEFEDRVLHLDQVINDRGFKVDVALAESAIEAVTRHKEELQEE 234


>gi|126015348|gb|ABN70705.1| DNA polymerase 4 [Salmonella phage SETP13]
          Length = 237

 Score =  126 bits (317), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 126/236 (53%), Gaps = 15/236 (6%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M+ L++D ET S   L KVG +AYAE     I +C YA+D+ PV++WD T+ S MP DL 
Sbjct: 1   MNLLYLDTETFSEADLKKVGSYAYAEHPTTEIVICTYAFDEGPVQVWDATDGSDMPRDLR 60

Query: 59  QYL-----RDETVMCVAHNSL-FERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNA 112
           + +      D  +  V  N L F+R + K   G ++  +  I T ++A  + LP SL   
Sbjct: 61  RAMLKLQKPDSNLKLVGQNFLMFDRPVIKHCWGFELLVENIIDTMIVAFRHALPGSLAAL 120

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRA---NHVQAWQLFGEYCKRDVEA 169
           C  LN    + K + GKALI RF K +  +  Y   R     H + W  F  Y K D+ +
Sbjct: 121 CEVLNIDASMAKDKRGKALIQRFSKPTPKN--YKIRRYTADTHPKEWAEFIAYAKSDITS 178

Query: 170 TRELFKRLIPLSDGERD--LWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
            RE++K++    + E +  +  LDQ INDRG+++D+ L     E + + +++L E+
Sbjct: 179 MREVYKKMPKWGNSEFEDRVLHLDQVINDRGFKVDVALAEAAIEAVTRHKEELQEE 234


>gi|188496446|ref|ZP_03003716.1| DNA polymerase [Escherichia coli 53638]
 gi|188491645|gb|EDU66748.1| DNA polymerase [Escherichia coli 53638]
 gi|323173133|gb|EFZ58764.1| DNA polymerase 1 [Escherichia coli LT-68]
          Length = 231

 Score =  122 bits (305), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 115/233 (49%), Gaps = 11/233 (4%)

Query: 448 FKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVK 507
           F T A    LDL + +         +   +A+S +     +   + + +++   AC+ +K
Sbjct: 4   FITFALVYSLDLDELANAALPNIPRDVIREAKSWYYESVKRKSTYGLSERVF-IACDSLK 62

Query: 508 KAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRR 567
           + WR  H      W +L       +      + ++      L +RR    + I LPS R 
Sbjct: 63  RLWRRAHPATCDFWYELERTVRTAIA-----TPQKTLYCGYLKIRRDGAWLRIQLPSGRA 117

Query: 568 LVYSDV---KGDCSYL--NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGY 622
           + Y      KG+ +Y+  N+ + +  R +TYGGKL EN+ QA +RD+L   M      GY
Sbjct: 118 VCYPSPVIEKGNITYMGVNSYSRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGY 177

Query: 623 DIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            IVLTVHDEI+SE PD+P +S   +  L+   P WA  +PL A G+E+ RYRK
Sbjct: 178 SIVLTVHDEIISEAPDSPDYSAEHVSQLLATVPDWATSIPLNAGGFESYRYRK 230


>gi|126015340|gb|ABN70701.1| DNA polymerase 1 [Salmonella phage SETP7]
 gi|126015342|gb|ABN70702.1| DNA polymerase 1 [Salmonella phage SETP11]
          Length = 267

 Score =  120 bits (302), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 116/266 (43%), Gaps = 47/266 (17%)

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWM-------------QDQYPEFAVKDKLIGTA 502
           GLDL + ++ +  T     W      + W              +D  P + + DK +   
Sbjct: 3   GLDLIEXAKTMAGTFPDHIWAATARGYEWARIQEAKRPPRPGEKDDRPSY-ILDKKVWRT 61

Query: 503 CELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGS---ISARRVANVPRLVMRRHKRDVH 559
           C+ +K+ WR  H   +  W+DL +G    V+  G      A   +N  R +      ++ 
Sbjct: 62  CDAIKRMWRESHPQTVAFWRDLKDGILAAVRNPGRDFWAGANIRSNGERAIRIWRTTEID 121

Query: 560 ------------IVLPSSRRLVY------------------SDVKGDCSYLNTATSQLMR 589
                       + LPS R L Y                  ++V+      N  T Q   
Sbjct: 122 SSGRNIPGWWLCMELPSGRILSYPGIGVSVTKETDEDGRVNTNVRIKYQGENQLTRQWTT 181

Query: 590 ERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCS 649
             T+GGK  ENIVQA  RD+L   M NA   GY IVL+VHDE+V ETPDTP ++V  L  
Sbjct: 182 LYTHGGKACENIVQAFCRDLLAYAMLNAEAGGYPIVLSVHDELVCETPDTPDYTVAELEK 241

Query: 650 LMTKNPSWAKGLPLKAEGYEAKRYRK 675
           LM   P WA+G PL AEG E KRY K
Sbjct: 242 LMCALPEWAEGFPLVAEGAELKRYAK 267


>gi|71898989|ref|ZP_00681155.1| truncated phage-related DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71731235|gb|EAO33300.1| truncated phage-related DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 199

 Score =  119 bits (297), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 79/196 (40%), Positives = 106/196 (54%), Gaps = 14/196 (7%)

Query: 487 DQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANV 546
           +Q P F + D+    AC++ K+AWR  H  +   W+ L     C V +  +I     A+ 
Sbjct: 10  NQRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ----CAVTD--AIGHPETAHT 62

Query: 547 PRLVMRRHKRD-VHIVLPSSRRLVYS----DVKGDCSYLNT--ATSQLMRERTYGGKLTE 599
              +  ++ R  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL E
Sbjct: 63  CCGITVQYSRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVE 122

Query: 600 NIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAK 659
           NI QA+SRD+L   M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+
Sbjct: 123 NITQAVSRDVLAACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQ 182

Query: 660 GLPLKAEGYEAKRYRK 675
           GLPL AEG+E  RYRK
Sbjct: 183 GLPLAAEGFETHRYRK 198


>gi|284006861|emb|CBA72127.1| phage DNA polymerase [Arsenophonus nasoniae]
          Length = 181

 Score =  117 bits (294), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 95/176 (53%), Gaps = 3/176 (1%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           LF D+ET S  P+   G   YAE A I L AY+++  PVK+WD T+   MP+DL  YL D
Sbjct: 5   LFCDLETYSDIPI-NCGTHRYAENAEILLFAYSYNHGPVKVWDVTQDKTMPTDLKAYLDD 63

Query: 64  ETVMCVAHN-SLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
             ++ V HN  +F+ ++  K L ID+P  R   T V A  +GLP +L + C   N +   
Sbjct: 64  PEILTVWHNGGMFDTVILSKVLNIDLPLSRVHDTLVQALAHGLPGALGSLCDIFNVNSDK 123

Query: 123 TKMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL 177
            K +EGKALI  FCK    +S     T   H + W  F  Y   D+ A RE+++ L
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKIQRATALTHFEEWLRFKTYAGSDILAMREIYQHL 179


>gi|28199079|ref|NP_779393.1| truncated phage-related DNA polymerase [Xylella fastidiosa
           Temecula1]
 gi|28057177|gb|AAO29042.1| truncated phage-related DNA polymerase [Xylella fastidiosa
           Temecula1]
          Length = 290

 Score =  117 bits (293), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 105/196 (53%), Gaps = 14/196 (7%)

Query: 487 DQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANV 546
           +  P F + D+    AC++ K+AWR  H  +   W+ L     C V +  +I     A+ 
Sbjct: 101 NHRPTFGLSDRAW-LACDVFKRAWRNAHPAIAAFWQALQ----CAVTD--AIGHPETAHT 153

Query: 547 PRLVMRRHKRD-VHIVLPSSRRLVYS----DVKGDCSYLNT--ATSQLMRERTYGGKLTE 599
              +  ++ R  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL E
Sbjct: 154 CCGITVQYSRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVE 213

Query: 600 NIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAK 659
           NI QA+SRD+L   M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+
Sbjct: 214 NITQAVSRDVLAACMPAIETAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQ 273

Query: 660 GLPLKAEGYEAKRYRK 675
           GLPL AEG++  RYRK
Sbjct: 274 GLPLAAEGFQTHRYRK 289


>gi|307700631|ref|ZP_07637659.1| conserved hypothetical protein [Mobiluncus mulieris FB024-16]
 gi|307614161|gb|EFN93402.1| conserved hypothetical protein [Mobiluncus mulieris FB024-16]
          Length = 240

 Score =  117 bits (292), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 85/286 (29%), Positives = 123/286 (43%), Gaps = 59/286 (20%)

Query: 402 FANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMAS-HCGLD 458
           F NGED+Y  T +  F  P++K  V+ E R  GK+  LA GY G     K M +   GL 
Sbjct: 1   FKNGEDLYCATASAMFGVPVEKHGVNSELRQKGKIAVLACGYNGSVGALKAMGALKMGLS 60

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                               KD+L     + +  AWRA +  ++
Sbjct: 61  ------------------------------------KDEL-----QPIVDAWRAANPNIV 79

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-GDC 577
           QLW D+       +  G  ++ R       L   +    + I LPS RRL Y     G  
Sbjct: 80  QLWHDVDNAATRAISTGSPVTLRN------LGFEKKSGMLFINLPSGRRLAYVKPGIGMN 133

Query: 578 SYLNTATS--------QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
            +  T+ +        +  +  TYGGKL ENIVQA +RD+L E +      G  IV+ +H
Sbjct: 134 RFGGTSITYWGQGVARKWQKLETYGGKLVENIVQATARDLLVEDITRIENAGNRIVMHIH 193

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE+V + P     +V  +C+L+ + P    GLP+ A GYE   Y+K
Sbjct: 194 DEVVIDEPINSGITVADICALLNELPERTAGLPIDAAGYECGFYQK 239


>gi|307580241|gb|ADN64210.1| truncated phage-related DNA polymerase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 205

 Score =  116 bits (291), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 79/207 (38%), Positives = 108/207 (52%), Gaps = 14/207 (6%)

Query: 476 EQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEG 535
           E  E+      +  P F + D+    AC++ K+AWR  H  +   W+ L     C V + 
Sbjct: 5   EAVEALQWTKANHRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ----CAVTD- 58

Query: 536 GSISARRVANVPRLVMRRHKRD-VHIVLPSSRRLVYS----DVKGDCSYLNT--ATSQLM 588
            +I     A+    +  ++ R  + + LPS R L Y+    D  G  SY+ T   T +  
Sbjct: 59  -AIGHPETAHTCCGITVQYSRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWT 117

Query: 589 RERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLC 648
           R  TYGGKL ENI QA+SRD+L   M      GY IVLTVHDEI++E  D   F+   L 
Sbjct: 118 RITTYGGKLVENITQAVSRDVLAACMPAIETAGYAIVLTVHDEIITEADDNAAFNAAHLA 177

Query: 649 SLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +LM   P WA+GLPL AEG++  RYRK
Sbjct: 178 ALMATPPPWAQGLPLAAEGFQTHRYRK 204


>gi|331090255|ref|ZP_08339142.1| hypothetical protein HMPREF1025_02725 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330401874|gb|EGG81449.1| hypothetical protein HMPREF1025_02725 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 225

 Score =  107 bits (267), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 117/271 (43%), Gaps = 60/271 (22%)

Query: 417 FNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCGLDLQQFSQNVKSTSTFE 473
           F  PI++++K    R  GK+ ELALGY G      +M +   GL                
Sbjct: 2   FGVPIEEITKGSPLRQKGKIAELALGYGGAVGALTSMGALAMGLS--------------- 46

Query: 474 DWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQ 533
                       +D+ P       L+ T        WR  +  + Q W D+ E     V+
Sbjct: 47  ------------EDELP------GLVST--------WRNANPHITQFWWDVDEAAVRAVR 80

Query: 534 EGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-GDCSYLNTATS------- 585
           E      R+   V  +  +     +  +LPS R+L Y   + G   Y     +       
Sbjct: 81  E------RKETQVGLIRFQYASGILFAMLPSGRKLAYVKPRMGVNKYGRDGLTYEGVGEN 134

Query: 586 -QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R  TYG KL ENIVQ  SRDIL E M    K G+ IV  VHDE V E P+    SV
Sbjct: 135 KKWERMDTYGPKLVENIVQGTSRDILAEAMMRLNKAGFSIVFHVHDEAVLEVPEGKS-SV 193

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             +C +M + PSW  GLPL+A+GYE + Y+K
Sbjct: 194 EEVCRIMAEPPSWVHGLPLRADGYECQFYKK 224


>gi|28198296|ref|NP_778610.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182680933|ref|YP_001829093.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|28056366|gb|AAO28259.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182631043|gb|ACB91819.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
          Length = 154

 Score =  102 bits (254), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 61/120 (50%), Positives = 72/120 (60%), Gaps = 6/120 (5%)

Query: 562 LPSSRRLVYS----DVKGDCSYLNT--ATSQLMRERTYGGKLTENIVQAISRDILCEGMK 615
           LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L   M 
Sbjct: 34  LPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVENITQAVSRDVLAACMP 93

Query: 616 NATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                GY IVLTVHDEI++E  D   F+   L +LM   P WA+GLPL AEG+E  RYRK
Sbjct: 94  AIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFETHRYRK 153


>gi|307579401|gb|ADN63370.1| DNA-directed DNA polymerase [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 132

 Score =  101 bits (251), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 61/120 (50%), Positives = 72/120 (60%), Gaps = 6/120 (5%)

Query: 562 LPSSRRLVYS----DVKGDCSYLNT--ATSQLMRERTYGGKLTENIVQAISRDILCEGMK 615
           LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L   M 
Sbjct: 12  LPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVENITQAVSRDVLAACMP 71

Query: 616 NATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                GY IVLTVHDEI++E  D   F+   L +LM   P WA+GLPL AEG+E  RYRK
Sbjct: 72  AIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFETHRYRK 131


>gi|71897667|ref|ZP_00679912.1| phage-related DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71732570|gb|EAO34623.1| phage-related DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 169

 Score =  101 bits (251), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 60/120 (50%), Positives = 72/120 (60%), Gaps = 6/120 (5%)

Query: 562 LPSSRRLVYS----DVKGDCSYLNT--ATSQLMRERTYGGKLTENIVQAISRDILCEGMK 615
           LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L   M 
Sbjct: 49  LPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSRDVLAACMP 108

Query: 616 NATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                GY IVLTVHDEI++E  D   F+   L +LM   P WA+GLPL AEG++  RYRK
Sbjct: 109 AIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFQTHRYRK 168


>gi|260439053|ref|ZP_05792869.1| prophage LambdaSa04, DNA polymerase [Butyrivibrio crossotus DSM
           2876]
 gi|292808509|gb|EFF67714.1| prophage LambdaSa04, DNA polymerase [Butyrivibrio crossotus DSM
           2876]
          Length = 239

 Score =  100 bits (250), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 121/288 (42%), Gaps = 61/288 (21%)

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMASHCG 456
           +K F    DIY  + +  F+ P++K  V+   R  GK+ ELALGY G       + +   
Sbjct: 1   MKVFKENGDIYCASASAMFHVPVEKHGVNGHLRQKGKIAELALGYGGSVGALTAIGA--- 57

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           LD          T   ED  Q                            +  +WRA +  
Sbjct: 58  LD----------TGLSEDELQP---------------------------LVDSWRASNPN 80

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-- 574
           ++Q W D+     CV     +I  R       +        + IVLPS RRL Y   K  
Sbjct: 81  IVQFWWDVDR---CVKT---AIKQRTATETHGIRFVYQNGILFIVLPSGRRLCYVKPKIG 134

Query: 575 ------GDCSYLNTATSQ-LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLT 627
                    +Y    T++   R  +YG K  ENIVQAISRDILC  M+  T +   IV  
Sbjct: 135 ENKFGGESVTYEGVGTNKKWGRIESYGPKFVENIVQAISRDILCHSMR--TLSHCFIVGH 192

Query: 628 VHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           VHDE++ ETP     +   +C  + + P W  GL L+A+GYE   Y+K
Sbjct: 193 VHDELIIETPMDADLT--AICEQIGRTPKWIYGLLLRADGYETAFYKK 238


>gi|71276173|ref|ZP_00652453.1| truncated phage-related DNA polymerase [Xylella fastidiosa Dixon]
 gi|71163091|gb|EAO12813.1| truncated phage-related DNA polymerase [Xylella fastidiosa Dixon]
          Length = 160

 Score = 99.4 bits (246), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 60/133 (45%), Positives = 78/133 (58%), Gaps = 6/133 (4%)

Query: 549 LVMRRHKRDVHIVLPSSRRLVYS----DVKGDCSYLNT--ATSQLMRERTYGGKLTENIV 602
           + M+  +  + + LPS R L Y+    D  G  SY+ T   T +  R  TYGGKL ENI 
Sbjct: 27  ITMQYSRAWLRMHLPSGRVLYYAAPRVDEHGALSYMGTHPMTRKWTRITTYGGKLVENIT 86

Query: 603 QAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLP 662
           QA+SRD+L   M      GY IVLTVHDE+++E  D   F+   L +LM   P WA+GLP
Sbjct: 87  QAVSRDVLAACMPAIEAAGYAIVLTVHDEMITEADDNAAFNAAHLAALMATPPPWAQGLP 146

Query: 663 LKAEGYEAKRYRK 675
           L AEG++  RYRK
Sbjct: 147 LAAEGFQTHRYRK 159


>gi|323443495|gb|EGB01111.1| phage related DNA polymerase family A [Staphylococcus aureus O46]
          Length = 225

 Score = 97.4 bits (241), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 116/274 (42%), Gaps = 66/274 (24%)

Query: 417 FNTPIDKVSKEQ--RAIGKVMELALGYQGGAKVFKTMAS-HCGLDLQQFSQNVKSTSTFE 473
           FN P++ ++K    R  GKV ELALGYQGGA   K M +   G++  +    V S     
Sbjct: 2   FNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENELQGLVDS----- 56

Query: 474 DWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQ 533
                                               WR  +  ++  WK      AC   
Sbjct: 57  ------------------------------------WRNANPNIVNFWK------ACQEA 74

Query: 534 EGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-GDCSY-----------LN 581
              ++ +R+  +   L     K  + I LPS R L Y     G+ S+           LN
Sbjct: 75  AINTVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGENSWGSQVVEFMGLDLN 134

Query: 582 TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPY 641
              S+L   +TYGGKL ENIVQA +RD+L   +     +G+ IV  VHDE++ E P    
Sbjct: 135 RKWSKL---KTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIVEIPRGSN 191

Query: 642 FSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 192 -GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 224


>gi|227540973|ref|ZP_03971022.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
 gi|227183233|gb|EEI64205.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
          Length = 100

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 56/89 (62%)

Query: 587 LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGT 646
           ++R  +YGGKL ENIVQA++RD+    M    + G+ IV+ VHDEIV + P    F+V  
Sbjct: 11  VVRLESYGGKLVENIVQAVARDLFVHAMTLVAQTGHKIVMHVHDEIVIDEPVGSGFTVAD 70

Query: 647 LCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            C LM   P WA GLPL A+GYE   YRK
Sbjct: 71  ACVLMATLPDWAAGLPLDADGYECDYYRK 99


>gi|167461235|ref|ZP_02326324.1| Phage-related DNA polymerase [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322383556|ref|ZP_08057314.1| hypothetical protein PL1_0952 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321152024|gb|EFX44960.1| hypothetical protein PL1_0952 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 222

 Score = 93.2 bits (230), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/271 (29%), Positives = 111/271 (40%), Gaps = 63/271 (23%)

Query: 417 FNTPIDK--VSKEQRAIGKVMELALGYQGGAKVFKTMAS-HCGLDLQQFSQNVKSTSTFE 473
           FN  ++K  V+   R  GK+ ELALGY G     K+M +   G++ ++    V       
Sbjct: 2   FNVAVEKHGVNGHLRQKGKIAELALGYGGSVGALKSMGALEMGIEEEELQPLVT------ 55

Query: 474 DWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQ 533
                                              AWR  +  + +LW D+       V+
Sbjct: 56  -----------------------------------AWRQSNSNITKLWWDVDRAVKVCVK 80

Query: 534 EGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY------SDVKGDCSYLNTA---T 584
           +        +  + +  M      + IVLPS RRL Y       +V G  S        T
Sbjct: 81  QKTPTETHGIKFIYQSGM------LFIVLPSGRRLAYVKPRMGENVFGGESVTYEGVGGT 134

Query: 585 SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R  +YG K  ENIV AISRDIL   M+  T     IV  VHDEI+ E      FS 
Sbjct: 135 KKWERIESYGPKFVENIVHAISRDILYHAMQ--TLKNCSIVAHVHDEIIIEADMRMSFS- 191

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             +C  M + PSWA GL L A+GYE + Y+K
Sbjct: 192 -AICEQMARTPSWANGLLLSADGYECQFYQK 221


>gi|253317126|ref|ZP_04840339.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           str. CF-Marseille]
          Length = 284

 Score = 93.2 bits (230), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 127/287 (44%), Gaps = 29/287 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP--SD 56
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P  +D
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 57  LLQY---LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
              +   L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----------HVQAWQLFGEYC 163
             L       K + GK LI  F      S P   T+ N           ++ WQ F +YC
Sbjct: 121 EVLRLQSQ--KDKAGKNLIRYF------SIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYC 172

Query: 164 KRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLD 221
            RDVE    +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L 
Sbjct: 173 IRDVEVEMAIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELL 232

Query: 222 EDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS 268
           +    +T   + +      L  +L    G+D+ ++ + T++  L  +
Sbjct: 233 KQAKHITG--LENPNSPTQLLAWLKDEQGLDIPNLQKKTVQEYLKEA 277


>gi|75906055|gb|ABA29401.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 324

 Score = 90.5 bits (223), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 51/77 (66%)

Query: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658
           ENI QA +RD+L   M    K GY+IVLTVHDEI+SE PDTP FS   L  L++ N  WA
Sbjct: 247 ENICQAAARDVLAYNMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKLLSFNSDWA 306

Query: 659 KGLPLKAEGYEAKRYRK 675
             LPL A G+E  RYRK
Sbjct: 307 WDLPLSANGFETYRYRK 323


>gi|325662094|ref|ZP_08150713.1| hypothetical protein HMPREF0490_01451 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471757|gb|EGC74976.1| hypothetical protein HMPREF0490_01451 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 341

 Score = 88.2 bits (217), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/261 (29%), Positives = 119/261 (45%), Gaps = 40/261 (15%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           + ++ ID+ET S   + K GV+ YAE     I L A + D   V ++D      +P ++L
Sbjct: 4   IKEMSIDLETYSDVDIKKSGVYKYAESENFEILLFAVSIDGGDVIVYDLACGDVLPDEIL 63

Query: 59  QYLRDETVMCVAHNSLFERILF------------------KKTLGIDIPSKRWICTSVLA 100
             +  + V+  A N+ FERI                    + T+G  +    W CT + +
Sbjct: 64  DAIVSDDVIKWAFNASFERICLSYWMKRNYPDRFCSYSIPEDTVGNYLDPASWRCTMIWS 123

Query: 101 RTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN--------- 151
              GLP SL+     L   +   KM+EGK LI  FC       P   T++N         
Sbjct: 124 AYMGLPLSLEGVGAVLGLKDQ--KMKEGKDLIRYFCV------PCKPTKSNGGRTRNFPM 175

Query: 152 HV-QAWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLK 208
           H  + W +F  Y KRDVE    + ++L   P+ D   + +LLDQ INDRG  +DL +V  
Sbjct: 176 HAPEKWTVFKSYNKRDVEVEIGIKEKLHKFPVPDFVWEEYLLDQEINDRGILVDLQMVEN 235

Query: 209 LQELIAQERKKLDEDIVKLTD 229
                 + +  + ++++ LTD
Sbjct: 236 AIAFDERSKATITDEMLGLTD 256


>gi|227499957|ref|ZP_03930050.1| possible DNA-directed DNA polymerase I [Anaerococcus tetradius ATCC
           35098]
 gi|227218066|gb|EEI83339.1| possible DNA-directed DNA polymerase I [Anaerococcus tetradius ATCC
           35098]
          Length = 880

 Score = 80.1 bits (196), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 123/254 (48%), Gaps = 43/254 (16%)

Query: 198 GYRIDLDLVLKLQELIAQERKKLDEDIVKL--TDGIIRSSRQTYALRMYLFLITGIDLVD 255
           G+  D  ++L L+E I ++ +KL  +I +L  ++  I S++Q   L   LF    + ++ 
Sbjct: 498 GFVTDRKVLLDLKEDINKDLEKLTSEIYELAGSEFNINSTKQ---LGEVLFKDLDLPVIK 554

Query: 256 MSE---GTLKSILS-----HSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRG 307
            ++    T  S+L      H  I ++ K   L +L S+      +  L +A+  DGR+R 
Sbjct: 555 KTKTGFSTDASVLEKLRDKHQIIPKIEKYRELFKLQST-----YIEGLEKAIDDDGRIRS 609

Query: 308 TLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSC 367
           T +    + TGR S      QNLP +              + G             +R  
Sbjct: 610 TFR-QNIAATGRLSSQDPNLQNLPIK-------------TDEGR-----------LIRKA 644

Query: 368 IIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKE 427
             A  GK L+ AD + IE R+LA ++G++  I+AF NGEDI+  T +K F+TP+D+V+K 
Sbjct: 645 FKAGQGKILIDADYSQIELRILASLSGDEHMIEAFRNGEDIHAKTASKVFHTPLDEVTKR 704

Query: 428 QRAIGKVMELALGY 441
           QR+  K +   + Y
Sbjct: 705 QRSDAKAVNFGIIY 718


>gi|313621758|gb|EFR92494.1| DNA polymerase [Listeria innocua FSL J1-023]
          Length = 155

 Score = 79.7 bits (195), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 70/146 (47%), Gaps = 8/146 (5%)

Query: 537 SISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-------GDCSYLNTATSQLMR 589
           +IS R       L        + I LPS R L Y   K           Y         +
Sbjct: 10  AISTRESQKYKGLTFYYKAGILFIKLPSGRNLAYFRAKLVPGKYGHQICYEGVTDKGWRK 69

Query: 590 ERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCS 649
           + TYGGKL ENIVQAI+RD L   ++     G   V+ VHDE ++E P++   SV  L +
Sbjct: 70  QYTYGGKLVENIVQAIARDCLAVSLRRIEDAGISTVMHVHDEAITEVPESE-SSVDKLNA 128

Query: 650 LMTKNPSWAKGLPLKAEGYEAKRYRK 675
           ++ +  SWA GLPL+ +G+ +  Y K
Sbjct: 129 ILAEPISWAPGLPLQGDGFSSDFYMK 154


>gi|227544274|ref|ZP_03974323.1| conserved hypothetical protein [Lactobacillus reuteri CF48-3A]
 gi|227185748|gb|EEI65819.1| conserved hypothetical protein [Lactobacillus reuteri CF48-3A]
          Length = 93

 Score = 78.6 bits (192), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 52/87 (59%), Gaps = 2/87 (2%)

Query: 589 RERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLC 648
           R  TYG KL ENIVQA SRD+L E M+     G  +V+ +HDE V + P     S+ T+ 
Sbjct: 8   RIETYGAKLVENIVQATSRDLLAEAMRRLEATGNTVVMHIHDEAVIDAPFNR--SLDTMV 65

Query: 649 SLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            LMTK P WA GL L A G+ +  Y+K
Sbjct: 66  QLMTKVPDWANGLILNAAGFVSDFYKK 92


>gi|332142369|ref|YP_004428107.1| phage-related DNA polymerase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327552391|gb|AEA99109.1| phage-related DNA polymerase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 310

 Score = 77.4 bits (189), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 89/345 (25%), Positives = 134/345 (38%), Gaps = 80/345 (23%)

Query: 283 ASSGSAILKLNTLSEAVS----SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEE 338
           A S  A+ +   L +AV+    +D +L   L +YGA  TGR+ G             +E 
Sbjct: 18  AKSNQAVSRAKKLVQAVNGRPNNDNKLVVPLVYYGA-HTGRYGG-------------NEG 63

Query: 339 ILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
           +    +Q L RG              R  + A  G+ + VAD + IEAR++AW A E   
Sbjct: 64  L---NLQNLQRGSE-----------HRKALTAPFGQLVYVADSSNIEARIVAWFAQETAL 109

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDKVSKE-QRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           +  F NG D Y T     +  P+ K + + +R +GKV  L L Y  GA+ F         
Sbjct: 110 LNQFKNGIDTYATLATDIYGFPVTKQTHQLERNVGKVARLGLQYGMGARTFH-------- 161

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
                        T E          W    +PE     K       ++KK W   +Q +
Sbjct: 162 ------------RTMESGPMGIPPMPWA---FPEIEKIVKTYRRTHPMIKKCWEIGNQII 206

Query: 518 --------LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLV 569
                   L+ W+ LT    C+    G          P L      +++         +V
Sbjct: 207 QKMIRKDTLETWRCLTVRHQCLELPNGM-----YLQFPNL----RNKEIQTAQGPQYEVV 257

Query: 570 YSDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGM 614
           Y       SY +  + +L+ +R YGGKL ENI QA++   + E M
Sbjct: 258 YD------SY-DYKSKKLVEKRLYGGKLLENIAQALAGLAMKEMM 295


>gi|255534870|ref|YP_003095241.1| DNA polymerase I [Flavobacteriaceae bacterium 3519-10]
 gi|255341066|gb|ACU07179.1| DNA polymerase I [Flavobacteriaceae bacterium 3519-10]
          Length = 949

 Score = 77.4 bits (189), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 67/112 (59%), Gaps = 5/112 (4%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A+ GKK++ AD + IE R++A I+ E+  I AF NGEDI+V+T A+ F+ P+++
Sbjct: 710 IRGAFVAAEGKKIISADYSQIELRLIAEISNEENMILAFQNGEDIHVSTAARLFDIPLEE 769

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDW 475
           V+K QR   K +   + Y  GA     +A   GL   +  Q ++  S FE++
Sbjct: 770 VTKTQRGQAKTVNFGIIYGQGA---FALAEQTGLSRTEAKQMIE--SYFENY 816


>gi|298207105|ref|YP_003715284.1| DNA polymerase I [Croceibacter atlanticus HTCC2559]
 gi|83849739|gb|EAP87607.1| DNA polymerase I [Croceibacter atlanticus HTCC2559]
          Length = 956

 Score = 76.6 bits (187), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 86/179 (48%), Gaps = 33/179 (18%)

Query: 270 ITQLAKD--LILNRLASSGSAILK---LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCV 324
           ++ LA D  +I N L   G A LK   ++ L E V  DGR+  T      + TGR S   
Sbjct: 642 LSYLAADHTIIQNVLDYRGLAKLKSTYVDALPEQVEEDGRVH-TDYMQTVAATGRLSSNN 700

Query: 325 FQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKK-LVVADLA 382
              QN+P R ER  +                         VR   +  N    L+ AD +
Sbjct: 701 PNLQNIPIRTERGRQ-------------------------VRKAFVPKNEDYVLLAADYS 735

Query: 383 GIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            IE R++A ++ ED  I+AF NGEDI+ +T AK FN PI++V++EQR+  K +   + Y
Sbjct: 736 QIELRIIAALSEEDTMIEAFKNGEDIHASTAAKVFNVPINEVTREQRSNAKTVNFGIIY 794


>gi|300775482|ref|ZP_07085343.1| DNA-directed DNA polymerase I [Chryseobacterium gleum ATCC 35910]
 gi|300505509|gb|EFK36646.1| DNA-directed DNA polymerase I [Chryseobacterium gleum ATCC 35910]
          Length = 944

 Score = 75.5 bits (184), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 3/105 (2%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   ++  GKK++ AD + IE R++A I+GE+  IKAF +GEDI+ +T AK F  P+ +
Sbjct: 705 IRGAFVSGEGKKIISADYSQIELRLIAEISGEENMIKAFQDGEDIHASTAAKLFKIPLAE 764

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKS 468
           VSK QR+  K +   + Y  GA     +A   GL   +  Q +++
Sbjct: 765 VSKTQRSQAKTVNFGIIYGQGA---FALAEQTGLSRTEAKQMIEA 806


>gi|313905679|ref|ZP_07839040.1| conserved hypothetical protein [Eubacterium cellulosolvens 6]
 gi|313469503|gb|EFR64844.1| conserved hypothetical protein [Eubacterium cellulosolvens 6]
          Length = 180

 Score = 75.1 bits (183), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 79/177 (44%), Gaps = 19/177 (10%)

Query: 508 KAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRR 567
            +WR  +  +   W D+       + +      R +    +  M      + I LPS R 
Sbjct: 13  NSWRNSNPMITAFWWDIDRAVKTTITQRIQTEVRGICFFYKSGM------LFIKLPSGRL 66

Query: 568 LVYSDVK-GDCSYLNTA--------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT 618
           L Y   + G+  Y   +        T +  R  +YG K  ENIVQA+SRDILC  MK  T
Sbjct: 67  LSYVKPRIGENQYGGESVTYEGVGSTKKWERIESYGPKFVENIVQAVSRDILCYAMK--T 124

Query: 619 KNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                IV  VHDE++ E   +P      +C  M ++P W   + L+A+GYE   Y+K
Sbjct: 125 LRHCFIVGHVHDELIIEC--SPDVDTNVICKQMGRSPDWMPDILLRADGYETNFYKK 179


>gi|317121267|ref|YP_004101270.1| DNA polymerase I [Thermaerobacter marianensis DSM 12885]
 gi|315591247|gb|ADU50543.1| DNA polymerase I [Thermaerobacter marianensis DSM 12885]
          Length = 1060

 Score = 74.3 bits (181), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 74/150 (49%), Gaps = 25/150 (16%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           ++ L+E +  DGR+  T Q   A+ TGR S      QN+P                    
Sbjct: 768 VDGLAEHIGPDGRVHTTFQQTVAA-TGRLSSTQPNLQNIP-------------------- 806

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
            I D  G     +R   +A  G +LV AD + IE RVLA  +G++  ++AFA G+D++  
Sbjct: 807 -IRDEPG---RSLRRAFVAPPGHRLVAADYSQIELRVLAHYSGDEGLLEAFARGQDVHAR 862

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           T ++ F  P+++V+ EQR + K +   L Y
Sbjct: 863 TASEIFGVPLEQVTPEQRRVAKAVNFGLAY 892


>gi|154498262|ref|ZP_02036640.1| hypothetical protein BACCAP_02250 [Bacteroides capillosus ATCC
           29799]
 gi|150272809|gb|EDM99977.1| hypothetical protein BACCAP_02250 [Bacteroides capillosus ATCC
           29799]
          Length = 889

 Score = 73.9 bits (180), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 72/151 (47%), Gaps = 27/151 (17%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILTQTIQALNRG 350
           ++ L + ++ DGR+  + Q    + TGR S      QN+P R E   E+           
Sbjct: 602 VDGLGKVIAPDGRIHTSFQ-NTVTATGRLSSTEPNLQNIPVRTELGAEL----------- 649

Query: 351 ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYV 410
                         R   +A  GK LV AD + IE R+LA IAG++  I+AF  GEDI+ 
Sbjct: 650 --------------RKMFVAPAGKVLVDADYSQIELRLLAHIAGDEHMIEAFRTGEDIHT 695

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            T A+ F  P+D+V+K  R+  K +   + Y
Sbjct: 696 VTAAQVFGVPVDQVTKHMRSSAKAVNFGIVY 726


>gi|313205711|ref|YP_004044888.1| DNA polymerase i [Riemerella anatipestifer DSM 15868]
 gi|312445027|gb|ADQ81382.1| DNA polymerase I [Riemerella anatipestifer DSM 15868]
 gi|315022894|gb|EFT35918.1| DNA polymerase I [Riemerella anatipestifer RA-YM]
 gi|325336847|gb|ADZ13121.1| DNA polymerase I - 3'-5' exonuclease and polymerase domains
           [Riemerella anatipestifer RA-GD]
          Length = 935

 Score = 73.9 bits (180), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 77/157 (49%), Gaps = 30/157 (19%)

Query: 302 DGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLA 360
           DGR+  +     A+ TGR +      QN+P R ER ++                      
Sbjct: 659 DGRVHTSFAQTVAA-TGRLASNNPNLQNIPIRTERGQQ---------------------- 695

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
              VR   +A  G K+V AD + IE R++A I+GE+  IKAF  G+DI+ +T +K F+ P
Sbjct: 696 ---VRGAFVAPKGSKIVSADYSQIELRLIAEISGEETMIKAFKEGQDIHASTASKLFDVP 752

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           +++VSK QR+  K +   + Y  G   F  +A   GL
Sbjct: 753 LNEVSKTQRSQAKTVNFGIIY--GQSAF-ALADQTGL 786


>gi|259502604|ref|ZP_05745506.1| prophage LambdaSa04 DNA-directed DNA polymerase [Lactobacillus
           antri DSM 16041]
 gi|259169419|gb|EEW53914.1| prophage LambdaSa04 DNA-directed DNA polymerase [Lactobacillus
           antri DSM 16041]
          Length = 169

 Score = 73.9 bits (180), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 82/174 (47%), Gaps = 20/174 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M ++ IDIET S   L + GV+ YA+     + L  Y+ D  PVK+ D T+   +P  ++
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSDDFELLLFGYSTDFGPVKVVDLTQGEKIPPQII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L +  ++  A N+ FER+   + +G  +    W C+ V + T GLP SL++    L  
Sbjct: 61  EALDNPNIIKSAFNAQFERVCLSRFVGHRLKPTGWHCSRVWSATLGLPLSLRDVGSVLGL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA----------WQLFGEY 162
                K+  GK L+  FC       P   T+AN  +           WQ F +Y
Sbjct: 121 PRQ--KITAGKELVRYFCT------PCKPTKANQNRTRNFPYHAPDKWQQFKQY 166


>gi|313902130|ref|ZP_07835540.1| DNA polymerase I [Thermaerobacter subterraneus DSM 13965]
 gi|313467593|gb|EFR63097.1| DNA polymerase I [Thermaerobacter subterraneus DSM 13965]
          Length = 1072

 Score = 73.9 bits (180), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 73/150 (48%), Gaps = 25/150 (16%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           ++ L+E +  DGR+  T Q   A+ TGR S      QN+P                    
Sbjct: 780 VDGLAEHIGPDGRIHTTFQQTVAA-TGRLSSTQPNLQNIP-------------------- 818

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
            I D  G     +R   +A  G +LV AD + IE RVLA  +G+   ++AFA G+D++  
Sbjct: 819 -IRDEPG---RSLRRAFVAPPGHRLVAADYSQIELRVLAHYSGDPGLVEAFAQGQDVHAR 874

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           T ++ F  P+++V+ EQR + K +   L Y
Sbjct: 875 TASEIFGVPLEQVTPEQRRVAKAVNFGLAY 904


>gi|108805947|ref|YP_645884.1| DNA-directed DNA polymerase [Rubrobacter xylanophilus DSM 9941]
 gi|108767190|gb|ABG06072.1| DNA-directed DNA polymerase [Rubrobacter xylanophilus DSM 9941]
          Length = 582

 Score = 73.6 bits (179), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (57%), Gaps = 3/97 (3%)

Query: 362 DCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPI 421
           D  R C +A  G  LV+AD + IE R+LA ++G+   ++AF  GED++  T A  F  P 
Sbjct: 342 DEFRRCFVAGEGNVLVIADYSQIELRILAEVSGDPGFVEAFRRGEDLHRVTAATMFGVPK 401

Query: 422 DKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           ++V+KEQR+  K +   L Y  G    +++A+  G D
Sbjct: 402 EEVTKEQRSAAKRINFGLAYGRGP---RSLAAQLGTD 435


>gi|325849919|ref|ZP_08170958.1| DNA-directed DNA polymerase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325479943|gb|EGC83026.1| DNA-directed DNA polymerase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 778

 Score = 73.2 bits (178), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 73/150 (48%), Gaps = 25/150 (16%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           L +L E +  DGR+R T +    + TGR S      QNLP   R+EE           G 
Sbjct: 492 LESLEECIDGDGRIRSTFK-QNVTATGRLSSTEPNLQNLPI--RTEE-----------GR 537

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
            I           R    A N K L+ AD + IE RVLA +A +    +AF++  DI+  
Sbjct: 538 KI-----------RKAFKADNEKILIDADYSQIELRVLAHLANDKKMQEAFSHDIDIHTK 586

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           T ++ FNTPID+V+K QR+  K +   + Y
Sbjct: 587 TASEVFNTPIDEVTKLQRSEAKAVNFGIIY 616


>gi|212702438|ref|ZP_03310566.1| hypothetical protein DESPIG_00455 [Desulfovibrio piger ATCC 29098]
 gi|212674099|gb|EEB34582.1| hypothetical protein DESPIG_00455 [Desulfovibrio piger ATCC 29098]
          Length = 919

 Score = 72.8 bits (177), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 73/155 (47%), Gaps = 25/155 (16%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           L+ L   V   GR+  T     A+ TGR S      QN+P                    
Sbjct: 629 LDPLPRLVDPQGRIHTTFN-QKATATGRLSSSNPNLQNIP-------------------- 667

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
            +  PLG     +RSC IA  G+ LV AD + +E RVLA ++ +   ++AF NGEDI+  
Sbjct: 668 -VRGPLG---KRMRSCFIAGPGRLLVSADYSQVELRVLAHVSQDPALLEAFRNGEDIHAR 723

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAK 446
           T A  ++ P D+VS +QR   K +   L Y  GA+
Sbjct: 724 TAALVYDLPPDQVSPDQRRNAKTINFGLIYGMGAQ 758


>gi|86131451|ref|ZP_01050049.1| DNA-directed DNA polymerase [Dokdonia donghaensis MED134]
 gi|85817896|gb|EAQ39064.1| DNA-directed DNA polymerase [Dokdonia donghaensis MED134]
          Length = 949

 Score = 72.4 bits (176), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 110/234 (47%), Gaps = 37/234 (15%)

Query: 220 LDEDIVKLTDGIIRSSRQTYAL----RMYLFLITGIDLVDMSEGTLKSILSHSN--ITQL 273
           L+ DI +LT  I   + + + +    ++   L   + LVD  + T     S +   ++ L
Sbjct: 579 LNADIERLTSEIYEEAGEEFKISSPKQLGEILFDKMKLVDKPKKTKTGQYSTAEDVLSYL 638

Query: 274 AKD--LILNRLASSGSAILK---LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQ 328
           AKD  +I   L   G + LK   ++ L E V+ DGR+  T      + TGR S      Q
Sbjct: 639 AKDHDIIQKVLDYRGLSKLKSTYVDALPEQVAQDGRVH-TDYMQTVAATGRLSSNNPNLQ 697

Query: 329 NLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEAR 387
           N+P R ER  ++                         ++ +       L+ AD + IE R
Sbjct: 698 NIPIRTERGRQVR------------------------KAFVPRDENHTLLAADYSQIELR 733

Query: 388 VLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           ++A ++ E+  I+AF +GEDI+ +T AK FN P+++V++EQR+  K +   + Y
Sbjct: 734 IIAALSEEENMIQAFTDGEDIHASTAAKVFNVPLEEVTREQRSNAKTVNFGIIY 787


>gi|227544665|ref|ZP_03974714.1| conserved hypothetical protein [Lactobacillus reuteri CF48-3A]
 gi|227185353|gb|EEI65424.1| conserved hypothetical protein [Lactobacillus reuteri CF48-3A]
          Length = 93

 Score = 72.4 bits (176), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 38/87 (43%), Positives = 50/87 (57%), Gaps = 2/87 (2%)

Query: 589 RERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLC 648
           R  TYG KL ENIVQA SRD+L   M+     G  +V+ +HDE V + P     S+ T+ 
Sbjct: 8   RIETYGAKLVENIVQATSRDLLAGAMRRLETAGNPVVMHIHDEAVIDAPTDR--SLDTIV 65

Query: 649 SLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +MT+ P WA GL L A G+    Y+K
Sbjct: 66  KIMTEVPDWADGLILNAAGFVGGFYKK 92


>gi|332169409|gb|AEE18664.1| DNA polymerase I [Krokinobacter diaphorus 4H-3-7-5]
          Length = 949

 Score = 72.0 bits (175), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 110/234 (47%), Gaps = 37/234 (15%)

Query: 220 LDEDIVKLTDGIIRSSRQTYAL----RMYLFLITGIDLVDMSEGTLKSILSHSN--ITQL 273
           L+ DI +LT  I   + + + +    ++   L   + LVD  + T     S +   ++ L
Sbjct: 579 LNADIERLTSEIFAEAGEEFNIGSPKQLGEILFDKMKLVDKPKKTKTGQYSTAEDVLSYL 638

Query: 274 AKD--LILNRLASSGSAILK---LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQ 328
           AKD  +I   L   G + LK   ++ L E V+ DGR+  T      + TGR S      Q
Sbjct: 639 AKDHDIIQKVLDYRGLSKLKSTYVDALPEQVAQDGRVH-TDYMQTVAATGRLSSNNPNLQ 697

Query: 329 NLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEAR 387
           N+P R ER  ++                         ++ +       L+ AD + IE R
Sbjct: 698 NIPIRTERGRQVR------------------------KAFVPRDENHTLLAADYSQIELR 733

Query: 388 VLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           ++A ++ E+  I+AF +GEDI+ +T AK FN P+++V++EQR+  K +   + Y
Sbjct: 734 IIAALSEEENMIQAFTDGEDIHASTAAKVFNVPLEEVTREQRSNAKTVNFGIIY 787


>gi|256544867|ref|ZP_05472238.1| DNA polymerase I [Anaerococcus vaginalis ATCC 51170]
 gi|256399366|gb|EEU12972.1| DNA polymerase I [Anaerococcus vaginalis ATCC 51170]
          Length = 893

 Score = 72.0 bits (175), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 73/150 (48%), Gaps = 25/150 (16%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           L +L E +  DGR+R T +    + TGR S      QNLP   R+EE           G 
Sbjct: 607 LESLEECIDEDGRIRSTFK-QNVTATGRLSSTEPNLQNLPI--RTEE-----------GR 652

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
            I           R    A +GK L+ AD + IE RVLA +A +    +AF+   DI+  
Sbjct: 653 KI-----------RKAFKADDGKVLIDADYSQIELRVLAHLANDKKMQEAFSKDIDIHTK 701

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           T ++ F+TPID+V+K QR+  K +   + Y
Sbjct: 702 TASEVFSTPIDEVTKLQRSEAKAVNFGIIY 731


>gi|325286748|ref|YP_004262538.1| DNA polymerase I [Cellulophaga lytica DSM 7489]
 gi|324322202|gb|ADY29667.1| DNA polymerase I [Cellulophaga lytica DSM 7489]
          Length = 946

 Score = 71.6 bits (174), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 128/286 (44%), Gaps = 53/286 (18%)

Query: 170 TRELFKRL-IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
           T ELF  + IPL     D+ L        G  +D+D +  L E       +L+ DI  L 
Sbjct: 538 TEELFNDIEIPLLSVLADMEL-------EGINLDVDFLNSLSE-------ELNTDIKNLE 583

Query: 229 DGIIRSSRQTYAL----RMYLFLITGIDLVDMSEGTLKSILSHSN--ITQLAKD--LILN 280
             I  ++ + + +    ++   L   + LVD  + T     S +   ++ LA+D  +I N
Sbjct: 584 TSIYEAAGEEFNIASPKQLGEILFGKLKLVDKPKKTKTGQYSTAEDVLSYLAQDHEIIKN 643

Query: 281 RLASSGSAILK---LNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQER 335
            L   G A LK   ++ L + V  S GR+  T      + TGR S      QN+P R ER
Sbjct: 644 ILEYRGLAKLKSTYIDALPDQVEESTGRVH-TDYMQTVAATGRLSSNNPNLQNIPIRTER 702

Query: 336 SEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGE 395
             ++                         ++ +       L+ AD + IE R++A ++ E
Sbjct: 703 GRQVR------------------------KAFVPRDENYTLLAADYSQIELRIIAALSDE 738

Query: 396 DWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
              I+AF NGEDI+ +T +K FN P+D+V++EQR+  K +   + Y
Sbjct: 739 TTMIEAFKNGEDIHASTASKVFNVPLDQVTREQRSNAKTVNFGIIY 784


>gi|284009397|emb|CBA76584.1| phage DNA polymerase [Arsenophonus nasoniae]
          Length = 92

 Score = 70.5 bits (171), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 37/87 (42%), Positives = 50/87 (57%), Gaps = 2/87 (2%)

Query: 4  LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
          LF D+ET S  P+   G   YAE A I L AYA++   VK+WD TE   MP+DL  Y   
Sbjct: 5  LFCDLETYSDIPI-NCGTHRYAENAEILLFAYAYNHGSVKVWDVTEDKTMPTDLKSYFDA 63

Query: 64 ETVMCVAHN-SLFERILFKKTLGIDIP 89
            ++ V HN  +F+ ++ K  L ID+P
Sbjct: 64 PEILTVWHNGGMFDTVILKHVLNIDLP 90


>gi|325479001|gb|EGC82102.1| DNA-directed DNA polymerase [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 878

 Score = 70.1 bits (170), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 72/147 (48%), Gaps = 25/147 (17%)

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIA 354
           L +A+  DGR+R T +    + TGR S      QNLP +              + G    
Sbjct: 595 LEKAIDYDGRIRSTFR-QNIAATGRLSSQDPNLQNLPIK-------------TDEGR--- 637

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYA 414
                    +R    A  GK L+ AD + IE R+LA ++G++  I AF N +DI+  T +
Sbjct: 638 --------LIRKAFKAEEGKILIDADYSQIELRILASLSGDEHMIDAFINVDDIHRKTAS 689

Query: 415 KAFNTPIDKVSKEQRAIGKVMELALGY 441
           K F+TP+++V+K QR+  K +   + Y
Sbjct: 690 KVFHTPLEEVTKRQRSEAKAVNFGIIY 716


>gi|291545365|emb|CBL18473.1| hypothetical protein CK1_00910 [Ruminococcus sp. SR1/5]
          Length = 124

 Score = 70.1 bits (170), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 63/118 (53%), Gaps = 6/118 (5%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S  PL K GV+ Y E     I L AY+ D++PV++ D      +P ++L
Sbjct: 1   MKTLSIDIETYSDVPLQKTGVYRYVESPDFEILLFAYSVDNQPVQVIDLACGEQIPKEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNA 112
             L DE V+  A N+ FERI   + LG      +  + W C+ + + T GLP SL+  
Sbjct: 61  LALEDECVIKWAFNATFERICLSRFLGYPTGEYLKPESWRCSMIWSATMGLPLSLEGV 118


>gi|303248854|ref|ZP_07335103.1| DNA polymerase I [Desulfovibrio fructosovorans JJ]
 gi|302489723|gb|EFL49656.1| DNA polymerase I [Desulfovibrio fructosovorans JJ]
          Length = 874

 Score = 70.1 bits (170), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 102/254 (40%), Gaps = 60/254 (23%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           L+ L +   +DGR+  TL    A+ TGR S      QN+P                    
Sbjct: 588 LDPLPKLADADGRIHTTLNNM-ATATGRLSSSNPNLQNIP-------------------- 626

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
            I  PLG     +R C +A  GK LV AD + IE RVLA ++GE   + AFA G DI+  
Sbjct: 627 -IRGPLG---RRMRECFVAGPGKTLVAADYSQIELRVLAHLSGEPALLSAFAAGADIHAR 682

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGG-------------------AKVFKTMA 452
           T +  F+ P  ++  ++R   K +   L Y  G                   AK F+ ++
Sbjct: 683 TASLLFDKPEAEIGPDERRQAKTINFGLLYGMGPQKLSRDLGIKLDAAKAFIAKYFERLS 742

Query: 453 SHCGLDLQQFSQNVKSTSTFEDW-----------EQAESHHLWMQDQYPEFAVKDKLIGT 501
                 L  F  N+  ++  + +              ES +  +  Q    A+   + G 
Sbjct: 743 G-----LSAFYDNIVESAKTQGYVTTLAGRRRLLPDIESKNSQLASQARRQAINTVVQGG 797

Query: 502 ACELVKKAWRAKHQ 515
           A +++K A  A H+
Sbjct: 798 AADIIKMAMLAAHK 811


>gi|254518126|ref|ZP_05130182.1| DNA polymerase I [Clostridium sp. 7_2_43FAA]
 gi|226911875|gb|EEH97076.1| DNA polymerase I [Clostridium sp. 7_2_43FAA]
          Length = 532

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 102/446 (22%), Positives = 180/446 (40%), Gaps = 92/446 (20%)

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           L D+ ++ V HN+ F+ + F ++ G  + +  + CT ++A+  G               E
Sbjct: 49  LNDKNIIKVFHNAKFD-VGFFQSKGYRVNN--YHCTLLMAQVLG--------------EE 91

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
            L+     KAL  ++    +D            +  Q   +Y  +DVE TR L+ +L+ L
Sbjct: 92  KLSL----KALAKKYLDVDMDKSMQHSDNWQETEITQEHIDYAVKDVEHTRALYYKLLDL 147

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKK----LDEDI-------VKLTD 229
              E +L     T+ +R  R    +V+     I  E  K    LD+D        +++ D
Sbjct: 148 L-VENNLL----TVYERERRALPAIVMLESNGINMEFDKWNARLDDDRRLAVELEIRIKD 202

Query: 230 GIIRSSRQTYALRMYLFLIT--GIDLVDMSEGTLKSILSHSNITQLAKDL--ILNRLASS 285
            + R      + +  +  I   GI L   S+  L        + +L +    +  ++ + 
Sbjct: 203 LLNRKELNLNSPKQLVEAIVEYGIKLHSTSDDELAKYSDEHEVIKLIRKYRRLQAKIKTY 262

Query: 286 GSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQ 345
           G  + K       + +DGR+R   +  G SR+GR S C     N P              
Sbjct: 263 GEKLKKF------IDNDGRIRAHWRLIG-SRSGRMS-C-----NNP-------------- 295

Query: 346 ALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
                     PL       R   +A  G KL+ +D + IE RVLA I+ ++  I  F NG
Sbjct: 296 ----------PLQAMPGNSREFFVADEGYKLIGSDYSQIELRVLASISKDETLISYFNNG 345

Query: 406 EDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQN 465
            D+++ T +  F  PID++SKE+R + K +   + Y              G+      +N
Sbjct: 346 IDLHLGTASLIFKKPIDEISKEERQVAKSLNFGIVY--------------GITAYGIQKN 391

Query: 466 VKSTSTFEDWEQAESHHLWMQDQYPE 491
           ++ +      E+AE + +   + YP+
Sbjct: 392 LRKSGVDTSLEEAEKYRIEFLNVYPK 417


>gi|257066818|ref|YP_003153074.1| DNA polymerase I [Anaerococcus prevotii DSM 20548]
 gi|256798698|gb|ACV29353.1| DNA polymerase I [Anaerococcus prevotii DSM 20548]
          Length = 879

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 69/147 (46%), Gaps = 25/147 (17%)

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIA 354
           L +A+  DGR+R T +    + TGR S      QNLP +              + G    
Sbjct: 596 LEKAIDEDGRIRSTFR-QNIAATGRLSSQDPNLQNLPIK-------------TDEGR--- 638

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYA 414
                    +R    A  GK L+ AD + IE R+LA ++G+   I AF  G DI+  T +
Sbjct: 639 --------LIRKAFRAEEGKILIDADYSQIELRILASLSGDRHMIDAFKEGVDIHTKTAS 690

Query: 415 KAFNTPIDKVSKEQRAIGKVMELALGY 441
           K F+T +DKV+K QR+  K +   + Y
Sbjct: 691 KVFHTDLDKVTKRQRSEAKAVNFGIIY 717


>gi|220933279|ref|YP_002512178.1| DNA polymerase I [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994589|gb|ACL71191.1| DNA polymerase I [Thioalkalivibrio sp. HL-EbGR7]
          Length = 903

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 91/195 (46%), Gaps = 34/195 (17%)

Query: 270 ITQLAKDLILNRLASSGSAILKLNT-----LSEAVSSD-GRLRGTLQFYGASRTGRWSGC 323
           + QLA D  L +L     ++ KL +     L E +  D GR+  +     AS TGR S  
Sbjct: 589 LEQLALDYPLPKLILEHRSLSKLKSTYTDKLPERIDPDTGRVHTSYHQAVAS-TGRLSSS 647

Query: 324 VFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAG 383
               QN+P   R+EE                         +R   +A +G++LV AD + 
Sbjct: 648 DPNLQNIPI--RTEE----------------------GRRIRQAFVAPSGRRLVAADYSQ 683

Query: 384 IEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQG 443
           IE R++A ++G+   ++AFA G+DI+  T A+ F   +D+VS EQR   K +   L Y  
Sbjct: 684 IELRIMAHLSGDAGLLRAFAEGQDIHRATAAEVFGVGLDQVSGEQRRAAKAINFGLIY-- 741

Query: 444 GAKVFKTMASHCGLD 458
           G   F  +A   G++
Sbjct: 742 GMSAF-GLARQLGIE 755


>gi|308188689|ref|YP_003932820.1| DNA polymerase I [Pantoea vagans C9-1]
 gi|308059199|gb|ADO11371.1| DNA polymerase I [Pantoea vagans C9-1]
          Length = 928

 Score = 69.7 bits (169), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 90/356 (25%), Positives = 146/356 (41%), Gaps = 75/356 (21%)

Query: 200 RIDLDLVLKLQELIAQERKKLDEDIVKLT------DGIIRSSRQTYALRMYLFLITGIDL 253
           RI+ + VL  Q ++AQ  K+L   + +L        G   +   T  L++ LF   GI  
Sbjct: 538 RIERNGVLIDQAILAQHSKELTARLAELELKAHELAGEPFNLSSTKQLQVILFEKQGIKP 597

Query: 254 VDMSEGTLKSILSHSNITQLAKDLILNR--LASSGSAILK----------LNTLSEAVSS 301
              + G   S  S   + +LA D  L +  L   G + LK          +N LS     
Sbjct: 598 TKKTPGGAPST-SEEVLAELALDYPLPKVILEHRGLSKLKSTYTDKLPLMINPLS----- 651

Query: 302 DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLAS 361
            GR+  T      + TGR S      QN+P   R++E                       
Sbjct: 652 -GRVH-TSYHQAVTATGRLSSADPNLQNIPV--RNDE----------------------G 685

Query: 362 DCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPI 421
             +R   +A+ G ++V AD + IE R++A ++ +   + AFA GEDI+  T ++ F  P+
Sbjct: 686 RRIRQAFVAAKGYRIVAADYSQIELRIMAHLSQDKGLLDAFAQGEDIHRATASEVFGVPL 745

Query: 422 DKVSKEQRAIGKVMELALGY--------------QGGAKVFKTMASHCGLDLQQFSQNVK 467
           DKVS EQR   K +   L Y               G AK +  +       + ++ +N +
Sbjct: 746 DKVSAEQRRSAKAINFGLIYGMSAFGLSRQLNIGAGEAKKYMDLYFERYPGVLRYMENTR 805

Query: 468 STSTFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAWRA 512
             +  + + E  E   LW+ D     A++ K          + GTA +++K+A  A
Sbjct: 806 QLAASKGYVETIEGRRLWLPDIKSSNAIRRKAAERAAINAPMQGTAADIIKRAMIA 861


>gi|108759777|ref|YP_631312.1| DNA polymerase I [Myxococcus xanthus DK 1622]
 gi|108463657|gb|ABF88842.1| DNA polymerase I [Myxococcus xanthus DK 1622]
          Length = 908

 Score = 69.3 bits (168), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 72/151 (47%), Gaps = 27/151 (17%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILTQTIQALNRG 350
           L+TL   V++DGR+  T     A+ TGR S      QN+P R +   EI           
Sbjct: 622 LDTLPTLVAADGRIHTTYH-QAATATGRLSSTDPNLQNIPVRTDLGREI----------- 669

Query: 351 ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYV 410
                         R   +A+ G +LV AD + +E R+LA IA +   I+AF + EDI+ 
Sbjct: 670 --------------RRAFVAAEGHQLVSADYSQVELRLLAHIANDPVLIEAFLHDEDIHT 715

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            T A+ F    ++V +EQR + K++   + Y
Sbjct: 716 RTAAEVFGVAKEQVDREQRRVAKMVNFGIAY 746


>gi|319953575|ref|YP_004164842.1| DNA polymerase i [Cellulophaga algicola DSM 14237]
 gi|319422235|gb|ADV49344.1| DNA polymerase I [Cellulophaga algicola DSM 14237]
          Length = 945

 Score = 69.3 bits (168), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 87/302 (28%), Positives = 133/302 (44%), Gaps = 56/302 (18%)

Query: 156 WQLFGEYCKRDVEA-TRELFKRL-IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELI 213
           +QL  ++     EA T+ELF  + IPL     D+ L        G  +D   +  L E  
Sbjct: 522 YQLAQQFKPELEEAKTQELFTDIEIPLLHVLADMEL-------EGINLDTKFLNSLAE-- 572

Query: 214 AQERKKLDEDIVKLTDGIIRSSRQTYAL----RMYLFLITGIDLVDMSEGTLKSILSHSN 269
                 LD DI KL   I   + + + +    ++   L   + LV   + T     S + 
Sbjct: 573 -----DLDNDIKKLEADIYEEAGEEFNIASPKQLGDILFDKLALVKKPKKTKTGQYSTAE 627

Query: 270 --ITQLAKD--LILNRLASSGSAILK---LNTLSEAVS-SDGRLRGTLQFYGASRTGRWS 321
             ++ LAKD  +I N L+  G A LK   ++ L   V  S GR+  T      + TGR S
Sbjct: 628 DVLSYLAKDHKIIENVLSYRGLAKLKSTYVDALPAQVEESTGRVH-TDYMQTVAATGRLS 686

Query: 322 GCVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKK-LVVA 379
                 QN+P R ER  +                         VR   +  N +  LV A
Sbjct: 687 SNNPNLQNIPIRTERGRQ-------------------------VRKAFVPRNKEYVLVAA 721

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++ E   I+AF NGEDI+ +T +K FN P+++V++EQR+  K +   +
Sbjct: 722 DYSQIELRIIAALSEETTMIEAFKNGEDIHASTASKVFNVPLEEVTREQRSNAKTVNFGI 781

Query: 440 GY 441
            Y
Sbjct: 782 IY 783


>gi|73540576|ref|YP_295096.1| DNA polymerase I [Ralstonia eutropha JMP134]
 gi|72117989|gb|AAZ60252.1| DNA polymerase I [Ralstonia eutropha JMP134]
          Length = 941

 Score = 69.3 bits (168), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 84/172 (48%), Gaps = 31/172 (18%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G  +V AD + IE R++A I+G++  ++AFANGEDI+  T ++ F    + 
Sbjct: 702 IREAFIASPGSVIVSADYSQIELRIMAHISGDENLLRAFANGEDIHRATASEIFGVDREA 761

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD-----------------LQQFSQNV 466
           VS EQR   KV+   L Y  G   F  +AS+ G++                 + Q+ ++ 
Sbjct: 762 VSSEQRRYAKVINFGLIY--GMSAFG-LASNLGIEREAAKHYIDRYFMRYPGVAQYMEDT 818

Query: 467 KSTSTFEDW-EQAESHHLWMQD---------QYPE-FAVKDKLIGTACELVK 507
           + T+  + + E      LW+ D         Q  E  A+   + GTA +L+K
Sbjct: 819 RQTAREQGYVETVFGRRLWLPDINGGSGPRRQAAERAAINAPMQGTAADLIK 870


>gi|295132395|ref|YP_003583071.1| DNA polymerase I [Zunongwangia profunda SM-A87]
 gi|294980410|gb|ADF50875.1| DNA polymerase I [Zunongwangia profunda SM-A87]
          Length = 941

 Score = 69.3 bits (168), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 132/290 (45%), Gaps = 53/290 (18%)

Query: 166 DVEATRELFKRL-IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           D   TR+LF  + +PL +   D+ +        G  +DLD + KL E        LD DI
Sbjct: 529 DEAKTRKLFNEIEMPLVEVLADMEI-------EGINLDLDFLKKLSE-------ALDRDI 574

Query: 225 VKLTDGIIRSSRQTYAL----RMYLFLITGIDLVDMSEGTLKSILSHSN--ITQLAKDLI 278
            +L   I  ++ + + +    ++ + L   + LV   + T     S S   ++ LA +  
Sbjct: 575 KELEAKIYEAAGEEFKISSPKQLGIILFEKLALVKKPKKTKTGQYSTSEDVLSYLAPEHE 634

Query: 279 LNRLASSGSAILKL-NTLSEAV-----SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLP- 331
           + +       ++KL NT  +A+      S GR+  T      + TGR S      QN+P 
Sbjct: 635 IVQHVLDYRGLVKLQNTYVDALPGQVEKSSGRVH-TDYVQTIAATGRLSSNNPNLQNIPI 693

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
           R ER  ++                         ++ I  S+   L+ AD + IE R++A 
Sbjct: 694 RTERGRQVR------------------------KAFIPRSDDYVLLAADYSQIELRIIAA 729

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           ++ E+  IKAF +GEDI+ +T ++ FN P+++V++EQR+  K +   + Y
Sbjct: 730 LSEEETMIKAFKDGEDIHASTASQVFNVPLEEVTREQRSNAKTVNFGIIY 779


>gi|194290334|ref|YP_002006241.1| DNA polymerase I [Cupriavidus taiwanensis LMG 19424]
 gi|193224169|emb|CAQ70178.1| DNA polymerase A; 5'->3' exonuclease ; 3'->5' polymerase ; 3'->5'
           exonuclease [Cupriavidus taiwanensis LMG 19424]
          Length = 939

 Score = 68.9 bits (167), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 56/95 (58%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A I+G++  ++AFANGEDI+  T A+ F    D 
Sbjct: 700 IREAFIAEPGSVIVSADYSQIELRIMAHISGDENLLRAFANGEDIHRATAAEIFGVERDA 759

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           VS EQR   KV+   L Y  G   F  +AS+ G++
Sbjct: 760 VSSEQRRYAKVINFGLIY--GMSAFG-LASNLGIE 791


>gi|319941599|ref|ZP_08015924.1| DNA polymerase I [Sutterella wadsworthensis 3_1_45B]
 gi|319804901|gb|EFW01747.1| DNA polymerase I [Sutterella wadsworthensis 3_1_45B]
          Length = 952

 Score = 68.6 bits (166), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 118/262 (45%), Gaps = 44/262 (16%)

Query: 212 LIAQERKKLDEDIVKLTDGIIRSSRQTYALR------MYLFLITGIDLVDMS----EGTL 261
           L+AQE K+L  ++ +L +    ++   + L         LF   G+ +V  +      T 
Sbjct: 576 LLAQESKELGVEVEQLVEEAHAAAGHPFNLSSPKQLAQILFAEQGLPVVKKTASGTPSTD 635

Query: 262 KSILSHSNITQLAKDLILN--RLASSGSAIL-KLNTLSEAVSSDGRLRGTLQFYGASRTG 318
           + +LS   +      +IL   RL    S  L KL TL   +  DGR+  T      + TG
Sbjct: 636 EEVLSELALNYPLPKIILEHRRLTKLKSTYLDKLPTL---IDRDGRIHTTFG-QAVAVTG 691

Query: 319 RWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVV 378
           R S      QN+P         T+T +                  +R+   A  G  ++ 
Sbjct: 692 RLSSMDPNLQNIP---------TRTPEGRR---------------IRTAFTARRGWSVID 727

Query: 379 ADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELA 438
           AD + +E R++A ++ +   + AF+ GEDI+ +T A+ F+TP+D+V+ +QR + KV+   
Sbjct: 728 ADYSQVELRIMAHLSQDAGLLSAFSRGEDIHRSTAAEVFHTPLDQVTPDQRRMAKVINFG 787

Query: 439 LGYQGGAKVFKTMASHCGLDLQ 460
           L Y  G   F  +A   GLD Q
Sbjct: 788 LIY--GMSAFG-LAQQMGLDRQ 806


>gi|156086202|ref|XP_001610510.1| DNA polymerase I [Babesia bovis T2Bo]
 gi|154797763|gb|EDO06942.1| DNA polymerase I, putative [Babesia bovis]
          Length = 1613

 Score = 68.2 bits (165), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 77/315 (24%), Positives = 124/315 (39%), Gaps = 57/315 (18%)

Query: 162  YCKRDVEATRELF---------KRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQEL 212
            Y  RD      L+         +RL  ++D E    L    +   G ++DLD   KL+ L
Sbjct: 1193 YASRDTAVLLPLYFILQEKLKAERLDMIADIENKCVLAVCQMEQNGIKVDLD---KLKSL 1249

Query: 213  IAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID------------LVDMSEGT 260
             A   K+ +  +  L D +  SS   +       ++  +             + D SE T
Sbjct: 1250 QAALDKENETAMKHLGDTLGVSSNPNFNYNSQRQILQALQQQKVMDKTRRGLIQDTSERT 1309

Query: 261  LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
            L     H  I  L +    N+  ++ +  +     +   S+ GR+   +   GA  +GR+
Sbjct: 1310 LSRNTYHPAIQALREYRKTNKAVTAFTEKIP----NHIDSATGRIYPNINQIGA-ESGRF 1364

Query: 321  SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVAD 380
            S      Q +PR  R                             R C IA  G KLV+AD
Sbjct: 1365 SCDNPNLQQIPRDSR----------------------------FRECFIADKGNKLVIAD 1396

Query: 381  LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
             + IE R+ A IA +   I+A+ +GED++  T +   N PI +V+KE+R + K +   L 
Sbjct: 1397 FSQIELRIAADIAEDRRMIEAYNSGEDLHSLTASLVKNKPISEVTKEERQLAKAVNFGLI 1456

Query: 441  YQGGAKVFKTMASHC 455
            +      F+  A  C
Sbjct: 1457 FGMSLAGFRNYAESC 1471


>gi|215426947|ref|ZP_03424866.1| DNA polymerase I [Mycobacterium tuberculosis T92]
 gi|215430521|ref|ZP_03428440.1| DNA polymerase I [Mycobacterium tuberculosis EAS054]
 gi|289750174|ref|ZP_06509552.1| DNA polymerase I polA [Mycobacterium tuberculosis T92]
 gi|289753716|ref|ZP_06513094.1| DNA polymerase I polA [Mycobacterium tuberculosis EAS054]
 gi|289690761|gb|EFD58190.1| DNA polymerase I polA [Mycobacterium tuberculosis T92]
 gi|289694303|gb|EFD61732.1| DNA polymerase I polA [Mycobacterium tuberculosis EAS054]
          Length = 904

 Score = 68.2 bits (165), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 100/222 (45%), Gaps = 56/222 (25%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H ++T+L                + ++ L +AV++DGR+  T     A+ TGR 
Sbjct: 600 LQHLLAHRDVTRLK---------------VTVDGLLQAVAADGRIHTTFNQTIAA-TGRL 643

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG-KKLVVA 379
           S      QN+P       I T                  AS  +R   +  +G  +L+ A
Sbjct: 644 SSTEPNLQNIP-------IRTD-----------------ASRRIRDAFVVGDGYAELMTA 679

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++G++  I+AF  GED++    ++AF  PID+V+ E R   K M   L
Sbjct: 680 DYSQIEMRIMAHLSGDEGLIEAFNTGEDLHSFVASRAFGVPIDEVTGELRRRVKAMSYGL 739

Query: 440 GYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
            Y              GL     SQ +K  ST E  EQ +++
Sbjct: 740 AY--------------GLSAYGLSQQLK-ISTEEANEQMDAY 766


>gi|219557549|ref|ZP_03536625.1| DNA polymerase I [Mycobacterium tuberculosis T17]
 gi|260200690|ref|ZP_05768181.1| DNA polymerase I [Mycobacterium tuberculosis T46]
 gi|289443081|ref|ZP_06432825.1| DNA polymerase I polA [Mycobacterium tuberculosis T46]
 gi|289569674|ref|ZP_06449901.1| DNA polymerase I polA [Mycobacterium tuberculosis T17]
 gi|289416000|gb|EFD13240.1| DNA polymerase I polA [Mycobacterium tuberculosis T46]
 gi|289543428|gb|EFD47076.1| DNA polymerase I polA [Mycobacterium tuberculosis T17]
          Length = 904

 Score = 68.2 bits (165), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 100/222 (45%), Gaps = 56/222 (25%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H ++T+L                + ++ L +AV++DGR+  T     A+ TGR 
Sbjct: 600 LQHLLAHRDVTRLK---------------VTVDGLLQAVAADGRIHTTFNQTIAA-TGRL 643

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG-KKLVVA 379
           S      QN+P       I T                  AS  +R   +  +G  +L+ A
Sbjct: 644 SSTEPNLQNIP-------IRTD-----------------ASRRIRDAFVVGDGYAELMTA 679

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++G++  I+AF  GED++    ++AF  PID+V+ E R   K M   L
Sbjct: 680 DYSQIEMRIMAHLSGDEGLIEAFNTGEDLHSFVASRAFGVPIDEVTGELRRRVKAMSYGL 739

Query: 440 GYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
            Y              GL     SQ +K  ST E  EQ +++
Sbjct: 740 AY--------------GLSAYGLSQQLK-ISTEEANEQMDAY 766


>gi|305665261|ref|YP_003861548.1| DNA polymerase I [Maribacter sp. HTCC2170]
 gi|88710015|gb|EAR02247.1| DNA polymerase I [Maribacter sp. HTCC2170]
          Length = 944

 Score = 68.2 bits (165), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 133/303 (43%), Gaps = 58/303 (19%)

Query: 156 WQLFGEYCKRDVEA-TRELFKRL-IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELI 213
           +QL   +     EA T ELF  + IPL     D+ L        G  +D + +  L E  
Sbjct: 521 YQLAQHFRPELAEASTEELFNTIEIPLLHVLADMEL-------EGINLDKEFLGSLSE-- 571

Query: 214 AQERKKLDEDIVKLTDGIIRSSRQTYAL----RMYLFLITGIDLVDMSEGTLKSILSHSN 269
                 L+ DI +L   I + + Q + +    ++   L   + LVD  + T     S + 
Sbjct: 572 -----DLNNDIKELQSKIYKEADQEFNIASPKQLGEILFDKLKLVDKPKKTKTGQYSTAE 626

Query: 270 --ITQLAKD--LILNRLASSGSAILKLNTLSEAV-----SSDGRLRGTLQFYGASRTGRW 320
             ++ LAKD  +I N L   G + LK +T  +A+        GR+  T      + TGR 
Sbjct: 627 DVLSYLAKDHEIIRNVLEYRGLSKLK-STYVDALPLQVEERTGRVH-TDYMQTVAATGRL 684

Query: 321 SGCVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGK-KLVV 378
           S      QN+P R ER  +                         VR   +  +    L+ 
Sbjct: 685 SSNNPNLQNIPIRTERGRQ-------------------------VRKAFVPRDEDYTLLA 719

Query: 379 ADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELA 438
           AD + IE R++A ++ ED  I+AF NGEDI+ +T +K F+ P+D+V++EQR+  K +   
Sbjct: 720 ADYSQIELRIIAALSEEDTMIEAFKNGEDIHASTASKVFDVPLDEVTREQRSNAKTVNFG 779

Query: 439 LGY 441
           + Y
Sbjct: 780 IIY 782


>gi|157373118|ref|YP_001481107.1| DNA polymerase I [Serratia proteamaculans 568]
 gi|157324882|gb|ABV43979.1| DNA polymerase I [Serratia proteamaculans 568]
          Length = 934

 Score = 68.2 bits (165), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (61%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G ++V AD + IE R++A ++ ++  +KAFA GEDI+  T A+ F  P+DK
Sbjct: 694 IRQAFIAPEGYRIVAADYSQIELRIMAHLSQDEGLLKAFAAGEDIHRATAAEVFGLPLDK 753

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 754 VTNEQRRSAKAINFGLIY 771


>gi|331087492|ref|ZP_08336428.1| hypothetical protein HMPREF1025_00011 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330410472|gb|EGG89903.1| hypothetical protein HMPREF1025_00011 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 164

 Score = 68.2 bits (165), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 68/136 (50%), Gaps = 10/136 (7%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L IDIET S   L K GV+ YAE     + L  Y+ D   VK+ D  +   +P +++  L
Sbjct: 23  LEIDIETFSSVNLAKAGVYRYAESPDFEVLLFGYSVDGGEVKVGDLVKGEKIPEEVMSAL 82

Query: 62  RDETVMCVAHNSLFERILFKKTLGID-----IPSKRWICTSVLARTNGLPSSLKNACLAL 116
            DE V   A N+ FERI   + LG +     +P+  W C+ V +   GLP SL+     L
Sbjct: 83  EDEAVTKWAFNAQFERICISRMLGYEAGTYLVPAS-WKCSMVWSAYMGLPLSLEGVGAVL 141

Query: 117 NFSEHLTKMEEGKALI 132
              +   K+ EGK LI
Sbjct: 142 GLEKQ--KLTEGKDLI 155


>gi|291531643|emb|CBK97228.1| DNA polymerase I [Eubacterium siraeum 70/3]
          Length = 829

 Score = 67.8 bits (164), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 83/174 (47%), Gaps = 28/174 (16%)

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIA 354
           L + V  DGR+  T +    +RTGR S      QN+P                     + 
Sbjct: 546 LLKVVGEDGRIHSTFK-QTETRTGRISSAEPNIQNIP---------------------VR 583

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYA 414
            PLG     +R    A +G  LV AD + IE RVLA I+G++   KAF +G DI+  T +
Sbjct: 584 TPLGRE---MRRFFTAKDGYLLVDADYSQIELRVLAHISGDEIMKKAFLDGVDIHTVTAS 640

Query: 415 KAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKS 468
           + FN PI+ V+ + R+  K +   + Y  GA    +++   G+ + + S+ ++S
Sbjct: 641 QVFNQPIEWVTPDLRSKAKAVNFGIVYGIGA---FSLSKDIGVSVPKASEYIRS 691


>gi|291556803|emb|CBL33920.1| DNA polymerase I [Eubacterium siraeum V10Sc8a]
          Length = 829

 Score = 67.4 bits (163), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 83/174 (47%), Gaps = 28/174 (16%)

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIA 354
           L + V  DGR+  T +    +RTGR S      QN+P                     + 
Sbjct: 546 LLKVVGEDGRIHSTFK-QTETRTGRISSAEPNIQNIP---------------------VR 583

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYA 414
            PLG     +R    A +G  LV AD + IE RVLA I+G++   KAF +G DI+  T +
Sbjct: 584 TPLGRE---MRRFFTAKDGYLLVDADYSQIELRVLAHISGDEIMKKAFLDGVDIHTVTAS 640

Query: 415 KAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKS 468
           + FN PI+ V+ + R+  K +   + Y  GA    +++   G+ + + S+ ++S
Sbjct: 641 QVFNQPIEWVTPDLRSKAKAVNFGIVYGIGA---FSLSKDIGVSVPKASEYIRS 691


>gi|126658688|ref|ZP_01729833.1| hypothetical protein CY0110_32040 [Cyanothece sp. CCY0110]
 gi|126619950|gb|EAZ90674.1| hypothetical protein CY0110_32040 [Cyanothece sp. CCY0110]
          Length = 662

 Score = 67.4 bits (163), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 64/120 (53%), Gaps = 7/120 (5%)

Query: 365 RSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV 424
           RSC + ++G KL++AD + IE R+ A IA +   I A+ N +D++  T A     P+D+V
Sbjct: 425 RSCFVPASGYKLIIADYSQIELRIAAEIANDSVMIDAYCNEKDLHRLTAALVSGKPLDEV 484

Query: 425 SKEQRAIGKVMELALGYQGGAKVFKTMA-SHCGLDL-----QQFSQN-VKSTSTFEDWEQ 477
           +K++R +GK +   L Y  GA   +  A ++ G+ +     Q+F  N  K       W Q
Sbjct: 485 TKQERQLGKAVNFGLIYGMGATKLRIYAETNYGVKMSIEEAQRFRDNFFKGYPGLHQWHQ 544


>gi|209517786|ref|ZP_03266621.1| DNA polymerase I [Burkholderia sp. H160]
 gi|209501732|gb|EEA01753.1| DNA polymerase I [Burkholderia sp. H160]
          Length = 913

 Score = 67.4 bits (163), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G KLV AD + IE R++A I+G++  ++AF+ GEDI+  T ++ FN    +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLMRAFSQGEDIHRATASEIFNVTPLE 733

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           VS +QR + KV+   L Y  G   F  +AS+ G+
Sbjct: 734 VSSDQRRVAKVINFGLIY--GMSAF-GLASNLGI 764


>gi|126663071|ref|ZP_01734069.1| DNA polymerase I [Flavobacteria bacterium BAL38]
 gi|126624729|gb|EAZ95419.1| DNA polymerase I [Flavobacteria bacterium BAL38]
          Length = 950

 Score = 67.0 bits (162), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 363 CVRSCIIASN-GKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPI 421
            +R   IA +    L+ AD + IE R++A + GE+  IKAF N EDI+ +T AK FN P+
Sbjct: 709 LIRKAFIARDENYTLLSADYSQIELRIIAALCGEENMIKAFQNHEDIHKSTAAKVFNIPL 768

Query: 422 DKVSKEQRAIGKVMELALGY 441
           D+V+KEQR+  K +   + Y
Sbjct: 769 DEVTKEQRSHAKTVNFGIIY 788


>gi|295700821|ref|YP_003608714.1| DNA polymerase I [Burkholderia sp. CCGE1002]
 gi|295440034|gb|ADG19203.1| DNA polymerase I [Burkholderia sp. CCGE1002]
          Length = 913

 Score = 67.0 bits (162), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G KLV AD + IE R++A I+G++  ++AF+ GEDI+  T ++ FN    +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLMRAFSQGEDIHRATASEIFNVTPLE 733

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           VS +QR + KV+   L Y  G   F  +AS+ G+
Sbjct: 734 VSSDQRRVAKVINFGLIY--GMSAF-GLASNLGI 764


>gi|240949360|ref|ZP_04753702.1| DNA polymerase I [Actinobacillus minor NM305]
 gi|240296210|gb|EER46863.1| DNA polymerase I [Actinobacillus minor NM305]
          Length = 950

 Score = 67.0 bits (162), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 49/78 (62%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G K+V AD + IE R++A +A ++  +KAFA G+DI+ +T ++ F  P+D+
Sbjct: 712 IRQAFIARKGYKIVAADYSQIELRIMAHLANDEGMLKAFAEGKDIHRSTASEIFGVPLDE 771

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 772 VTGEQRRNAKAINFGLIY 789


>gi|15608767|ref|NP_216145.1| DNA polymerase I [Mycobacterium tuberculosis H37Rv]
 gi|15841084|ref|NP_336121.1| DNA polymerase I [Mycobacterium tuberculosis CDC1551]
 gi|31792815|ref|NP_855308.1| DNA polymerase I [Mycobacterium bovis AF2122/97]
 gi|121637536|ref|YP_977759.1| DNA polymerase I [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|148661424|ref|YP_001282947.1| DNA polymerase I [Mycobacterium tuberculosis H37Ra]
 gi|148822836|ref|YP_001287590.1| DNA polymerase I [Mycobacterium tuberculosis F11]
 gi|167968418|ref|ZP_02550695.1| DNA polymerase I [Mycobacterium tuberculosis H37Ra]
 gi|218753335|ref|ZP_03532131.1| DNA polymerase I [Mycobacterium tuberculosis GM 1503]
 gi|224990011|ref|YP_002644698.1| DNA polymerase I [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253799333|ref|YP_003032334.1| DNA polymerase I polA [Mycobacterium tuberculosis KZN 1435]
 gi|254231830|ref|ZP_04925157.1| DNA polymerase I polA [Mycobacterium tuberculosis C]
 gi|254364479|ref|ZP_04980525.1| DNA polymerase I polA [Mycobacterium tuberculosis str. Haarlem]
 gi|260186577|ref|ZP_05764051.1| DNA polymerase I [Mycobacterium tuberculosis CPHL_A]
 gi|260204898|ref|ZP_05772389.1| DNA polymerase I [Mycobacterium tuberculosis K85]
 gi|289447237|ref|ZP_06436981.1| DNA polymerase I polA [Mycobacterium tuberculosis CPHL_A]
 gi|289574296|ref|ZP_06454523.1| DNA polymerase I polA [Mycobacterium tuberculosis K85]
 gi|289761777|ref|ZP_06521155.1| DNA polymerase I polA [Mycobacterium tuberculosis GM 1503]
 gi|297634182|ref|ZP_06951962.1| DNA polymerase I [Mycobacterium tuberculosis KZN 4207]
 gi|297731169|ref|ZP_06960287.1| DNA polymerase I [Mycobacterium tuberculosis KZN R506]
 gi|306775815|ref|ZP_07414152.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu001]
 gi|306779627|ref|ZP_07417964.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu002]
 gi|306784359|ref|ZP_07422681.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu003]
 gi|306788727|ref|ZP_07427049.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu004]
 gi|306793064|ref|ZP_07431366.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu005]
 gi|306797446|ref|ZP_07435748.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu006]
 gi|306803324|ref|ZP_07439992.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu008]
 gi|306807906|ref|ZP_07444574.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu007]
 gi|306967723|ref|ZP_07480384.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu009]
 gi|306971921|ref|ZP_07484582.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu010]
 gi|307084209|ref|ZP_07493322.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu012]
 gi|313658501|ref|ZP_07815381.1| DNA polymerase I [Mycobacterium tuberculosis KZN V2475]
 gi|61223052|sp|P0A550|DPO1_MYCTU RecName: Full=DNA polymerase I; Short=POL I
 gi|61223053|sp|P0A551|DPO1_MYCBO RecName: Full=DNA polymerase I; Short=POL I
 gi|416117|gb|AAB46393.1| DNA polymerase I [Mycobacterium tuberculosis H37Rv]
 gi|2113913|emb|CAB08882.1| PROBABLE DNA POLYMERASE I POLA [Mycobacterium tuberculosis H37Rv]
 gi|13881298|gb|AAK45935.1| DNA polymerase I [Mycobacterium tuberculosis CDC1551]
 gi|31618405|emb|CAD96323.1| DNA polymerase I polA [Mycobacterium bovis AF2122/97]
 gi|121493183|emb|CAL71654.1| DNA polymerase I polA [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|124600889|gb|EAY59899.1| DNA polymerase I polA [Mycobacterium tuberculosis C]
 gi|134149993|gb|EBA42038.1| DNA polymerase I polA [Mycobacterium tuberculosis str. Haarlem]
 gi|148505576|gb|ABQ73385.1| DNA polymerase I [Mycobacterium tuberculosis H37Ra]
 gi|148721363|gb|ABR05988.1| DNA polymerase I polA [Mycobacterium tuberculosis F11]
 gi|224773124|dbj|BAH25930.1| DNA polymerase I [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253320836|gb|ACT25439.1| DNA polymerase I polA [Mycobacterium tuberculosis KZN 1435]
 gi|289420195|gb|EFD17396.1| DNA polymerase I polA [Mycobacterium tuberculosis CPHL_A]
 gi|289538727|gb|EFD43305.1| DNA polymerase I polA [Mycobacterium tuberculosis K85]
 gi|289709283|gb|EFD73299.1| DNA polymerase I polA [Mycobacterium tuberculosis GM 1503]
 gi|308215730|gb|EFO75129.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu001]
 gi|308327428|gb|EFP16279.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu002]
 gi|308330907|gb|EFP19758.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu003]
 gi|308334742|gb|EFP23593.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu004]
 gi|308338519|gb|EFP27370.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu005]
 gi|308342190|gb|EFP31041.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu006]
 gi|308345716|gb|EFP34567.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu007]
 gi|308350015|gb|EFP38866.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu008]
 gi|308354652|gb|EFP43503.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu009]
 gi|308358608|gb|EFP47459.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu010]
 gi|308366154|gb|EFP55005.1| DNA polymerase I polA [Mycobacterium tuberculosis SUMu012]
 gi|323719889|gb|EGB29002.1| DNA polymerase I polA [Mycobacterium tuberculosis CDC1551A]
 gi|328459083|gb|AEB04506.1| DNA polymerase I polA [Mycobacterium tuberculosis KZN 4207]
 gi|740010|prf||2004291B DNA polymerase I
          Length = 904

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 99/222 (44%), Gaps = 56/222 (25%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H ++T+L                + ++ L +AV++DGR+  T     A+ TGR 
Sbjct: 600 LQHLLAHRDVTRLK---------------VTVDGLLQAVAADGRIHTTFNQTIAA-TGRL 643

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG-KKLVVA 379
           S      QN+P       I T                  A   +R   +  +G  +L+ A
Sbjct: 644 SSTEPNLQNIP-------IRTD-----------------AGRRIRDAFVVGDGYAELMTA 679

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++G++  I+AF  GED++    ++AF  PID+V+ E R   K M   L
Sbjct: 680 DYSQIEMRIMAHLSGDEGLIEAFNTGEDLHSFVASRAFGVPIDEVTGELRRRVKAMSYGL 739

Query: 440 GYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
            Y              GL     SQ +K  ST E  EQ +++
Sbjct: 740 AY--------------GLSAYGLSQQLK-ISTEEANEQMDAY 766


>gi|310822212|ref|YP_003954570.1| DNA polymerase I [Stigmatella aurantiaca DW4/3-1]
 gi|309395284|gb|ADO72743.1| DNA polymerase I [Stigmatella aurantiaca DW4/3-1]
          Length = 899

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 68/151 (45%), Gaps = 27/151 (17%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILTQTIQALNRG 350
           L+TL   V+ DGR+  T     A+ TGR S      QN+P R E   EI           
Sbjct: 613 LDTLPGLVAKDGRIHTTYH-QAATATGRLSSSDPNLQNIPVRTELGREI----------- 660

Query: 351 ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYV 410
                         R   +A  G +LV AD + +E R+LA IA +   + AF + EDI+ 
Sbjct: 661 --------------RRAFVAEAGYQLVSADYSQVELRLLAHIAEDPVLLDAFQHDEDIHS 706

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            T A+ F    DKV ++QR + K +   + Y
Sbjct: 707 RTAAEIFGVTPDKVDRDQRRVAKTVNFGIAY 737


>gi|291615288|ref|YP_003525445.1| DNA polymerase I [Sideroxydans lithotrophicus ES-1]
 gi|291585400|gb|ADE13058.1| DNA polymerase I [Sideroxydans lithotrophicus ES-1]
          Length = 929

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (61%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   I   G ++V AD + IE R++A ++G++  +KAFA GEDI+  T A+ F+  +D 
Sbjct: 690 IREAFITPAGSRIVSADYSQIELRIMAHLSGDEGLLKAFAAGEDIHRATAAEVFSVALDA 749

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   KV+   L Y
Sbjct: 750 VSSEQRRYAKVINFGLIY 767


>gi|289554597|ref|ZP_06443807.1| DNA polymerase I polA [Mycobacterium tuberculosis KZN 605]
 gi|289439229|gb|EFD21722.1| DNA polymerase I polA [Mycobacterium tuberculosis KZN 605]
          Length = 903

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 99/222 (44%), Gaps = 56/222 (25%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H ++T+L                + ++ L +AV++DGR+  T     A+ TGR 
Sbjct: 599 LQHLLAHRDVTRLK---------------VTVDGLLQAVAADGRIHTTFNQTIAA-TGRL 642

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG-KKLVVA 379
           S      QN+P       I T                  A   +R   +  +G  +L+ A
Sbjct: 643 SSTEPNLQNIP-------IRTD-----------------AGRRIRDAFVVGDGYAELMTA 678

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++G++  I+AF  GED++    ++AF  PID+V+ E R   K M   L
Sbjct: 679 DYSQIEMRIMAHLSGDEGLIEAFNTGEDLHSFVASRAFGVPIDEVTGELRRRVKAMSYGL 738

Query: 440 GYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
            Y              GL     SQ +K  ST E  EQ +++
Sbjct: 739 AY--------------GLSAYGLSQQLK-ISTEEANEQMDAY 765


>gi|167751303|ref|ZP_02423430.1| hypothetical protein EUBSIR_02289 [Eubacterium siraeum DSM 15702]
 gi|167655810|gb|EDR99939.1| hypothetical protein EUBSIR_02289 [Eubacterium siraeum DSM 15702]
          Length = 829

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 83/174 (47%), Gaps = 28/174 (16%)

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIA 354
           L + V  DGR+  T +    +RTGR S      QN+P                     + 
Sbjct: 546 LLKVVGEDGRIHSTFK-QTETRTGRISSAEPNIQNIP---------------------VR 583

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYA 414
            PLG     +R    A +G  LV AD + IE RVLA I+G++   KAF +G DI+  T +
Sbjct: 584 TPLGRE---MRRFFTAKDGCLLVDADYSQIELRVLAHISGDEIMKKAFLDGVDIHTVTAS 640

Query: 415 KAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKS 468
           + FN PI+ V+ + R+  K +   + Y  GA    +++   G+ + + S+ ++S
Sbjct: 641 QVFNQPIEWVTPDLRSKAKAVNFGIVYGIGA---FSLSKDIGVSVPKASEYIRS 691


>gi|115378925|ref|ZP_01466060.1| DNA polymerase I [Stigmatella aurantiaca DW4/3-1]
 gi|115364075|gb|EAU63175.1| DNA polymerase I [Stigmatella aurantiaca DW4/3-1]
          Length = 852

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 68/151 (45%), Gaps = 27/151 (17%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILTQTIQALNRG 350
           L+TL   V+ DGR+  T     A+ TGR S      QN+P R E   EI           
Sbjct: 566 LDTLPGLVAKDGRIHTTYH-QAATATGRLSSSDPNLQNIPVRTELGREI----------- 613

Query: 351 ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYV 410
                         R   +A  G +LV AD + +E R+LA IA +   + AF + EDI+ 
Sbjct: 614 --------------RRAFVAEAGYQLVSADYSQVELRLLAHIAEDPVLLDAFQHDEDIHS 659

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            T A+ F    DKV ++QR + K +   + Y
Sbjct: 660 RTAAEIFGVTPDKVDRDQRRVAKTVNFGIAY 690


>gi|215404071|ref|ZP_03416252.1| DNA polymerase I [Mycobacterium tuberculosis 02_1987]
 gi|215411274|ref|ZP_03420082.1| DNA polymerase I [Mycobacterium tuberculosis 94_M4241A]
 gi|215445811|ref|ZP_03432563.1| DNA polymerase I [Mycobacterium tuberculosis T85]
 gi|289745934|ref|ZP_06505312.1| DNA polymerase I polA [Mycobacterium tuberculosis 02_1987]
 gi|289757731|ref|ZP_06517109.1| DNA polymerase I polA [Mycobacterium tuberculosis T85]
 gi|294996578|ref|ZP_06802269.1| DNA polymerase I [Mycobacterium tuberculosis 210]
 gi|298525125|ref|ZP_07012534.1| DNA polymerase I polA [Mycobacterium tuberculosis 94_M4241A]
 gi|289686462|gb|EFD53950.1| DNA polymerase I polA [Mycobacterium tuberculosis 02_1987]
 gi|289713295|gb|EFD77307.1| DNA polymerase I polA [Mycobacterium tuberculosis T85]
 gi|298494919|gb|EFI30213.1| DNA polymerase I polA [Mycobacterium tuberculosis 94_M4241A]
 gi|326903242|gb|EGE50175.1| DNA polymerase I polA [Mycobacterium tuberculosis W-148]
          Length = 904

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 99/222 (44%), Gaps = 56/222 (25%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H ++T+L                + ++ L +AV++DGR+  T     A+ TGR 
Sbjct: 600 LQHLLAHRDVTRLK---------------VTVDGLLQAVAADGRIHTTFNQTIAA-TGRL 643

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG-KKLVVA 379
           S      QN+P       I T                  A   +R   +  +G  +L+ A
Sbjct: 644 SSTEPNLQNIP-------IRTD-----------------AGRRIRDAFVVGDGYAELMTA 679

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++G++  I+AF  GED++    ++AF  PID+V+ E R   K M   L
Sbjct: 680 DYSQIEMRIMAHLSGDEGLIEAFNTGEDLHSFVASRAFGVPIDEVTGELRRRVKAMSYGL 739

Query: 440 GYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
            Y              GL     SQ +K  ST E  EQ +++
Sbjct: 740 AY--------------GLSAYGLSQQLK-ISTEEANEQMDAY 766


>gi|254550633|ref|ZP_05141080.1| DNA polymerase I [Mycobacterium tuberculosis '98-R604 INH-RIF-EM']
          Length = 814

 Score = 66.6 bits (161), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 99/222 (44%), Gaps = 56/222 (25%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H ++T+L                + ++ L +AV++DGR+  T     A+ TGR 
Sbjct: 583 LQHLLAHRDVTRLK---------------VTVDGLLQAVAADGRIHTTFNQTIAA-TGRL 626

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG-KKLVVA 379
           S      QN+P       I T                  A   +R   +  +G  +L+ A
Sbjct: 627 SSTEPNLQNIP-------IRTD-----------------AGRRIRDAFVVGDGYAELMTA 662

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++G++  I+AF  GED++    ++AF  PID+V+ E R   K M   L
Sbjct: 663 DYSQIEMRIMAHLSGDEGLIEAFNTGEDLHSFVASRAFGVPIDEVTGELRRRVKAMSYGL 722

Query: 440 GYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
            Y              GL     SQ +K  ST E  EQ +++
Sbjct: 723 AY--------------GLSAYGLSQQLK-ISTEEANEQMDAY 749


>gi|219850431|ref|YP_002464864.1| DNA polymerase I [Chloroflexus aggregans DSM 9485]
 gi|219544690|gb|ACL26428.1| DNA polymerase I [Chloroflexus aggregans DSM 9485]
          Length = 936

 Score = 66.2 bits (160), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 132/308 (42%), Gaps = 62/308 (20%)

Query: 169 ATRELFKRL-IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
           A R+L+ R+ +PL D   D+ L        G  +D + + +L +  AQ   +L E I   
Sbjct: 524 ALRDLYYRVELPLIDVLTDMEL-------TGILLDHEYLRELGKRFAQRIAELTEQIYAK 576

Query: 228 TDGI--IRSSRQTYALRMYLFLITGIDLVDMSEGTLKS--------ILSH-SNITQLAKD 276
             G   I S +Q   L   LF   GI+  D     LKS        +L   S +  +A D
Sbjct: 577 AGGPFNINSGQQ---LNEVLFERLGINPRDYGLSKLKSGGYSITAEVLEELSQLYPIAAD 633

Query: 277 LI----LNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
           ++    L +L S+      ++ L + V+   GR+  +    GA+ TGR S      QN+P
Sbjct: 634 ILAYRQLTKLKST-----YIDALPQLVNPRTGRIHTSYNQIGAA-TGRLSSNNPNLQNIP 687

Query: 332 -RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
            R E   EI                         R   +A+ G + V AD + IE RVLA
Sbjct: 688 VRTEEGREI-------------------------RRAFVAAPGHRFVAADYSQIELRVLA 722

Query: 391 WIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKT 450
            I+G++  I AF  G DI+  T ++ F    D+V K QR + K +   + Y  G   F  
Sbjct: 723 HISGDENLIAAFQQGLDIHAATASRLFGVAPDQVDKNQRRVAKTVVFGVIY--GISAFG- 779

Query: 451 MASHCGLD 458
           +A   G++
Sbjct: 780 LAQRLGIE 787


>gi|78484390|ref|YP_390315.1| DNA polymerase I [Thiomicrospira crunogena XCL-2]
 gi|78362676|gb|ABB40641.1| DNA polymerase I [Thiomicrospira crunogena XCL-2]
          Length = 939

 Score = 66.2 bits (160), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 107/233 (45%), Gaps = 39/233 (16%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G +L+ +D + IE R++A ++G+   +KAFA G+DI+  T A+ FN P+++
Sbjct: 700 IRQAFIAQPGYRLMASDYSQIELRIMAHLSGDASLLKAFAEGKDIHQATAAEIFNMPLEE 759

Query: 424 VSKEQRAIGKVMELALGY--------------QGGAKVFKTM--ASHCGLD--LQQFSQN 465
           V+ EQR   K +   L Y              +G A+ +  +  A + G+   ++   +N
Sbjct: 760 VTSEQRRSAKAVNFGLIYGMSAFGLAKQLNISRGLAQEYINLYFARYPGVANYMESTKEN 819

Query: 466 VKSTSTFEDWEQAESHHLWMQD---------QYPE-FAVKDKLIGTACELVKKAWRAKHQ 515
            K T   E         L++ D         QY E  A+   + GTA +++K A      
Sbjct: 820 AKQTGYVETL---MGRRLYLPDINAKNGQLRQYAERTAINAPMQGTAADIIKTAMVK--- 873

Query: 516 GVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRL 568
             +Q W D T    C ++    +    V  V    M + ++++  ++ ++ +L
Sbjct: 874 --MQQWLDQT---PCDIKMLMQVHDELVFEVAEADMDQARKEIKTIMEAALKL 921


>gi|94311560|ref|YP_584770.1| DNA polymerase I [Cupriavidus metallidurans CH34]
 gi|93355412|gb|ABF09501.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Cupriavidus metallidurans CH34]
          Length = 934

 Score = 66.2 bits (160), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 56/95 (58%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G  +V AD + IE R++A I+G++  ++AFANGEDI+  T  + F    + 
Sbjct: 695 IREAFIAAPGNVIVSADYSQIELRIMAHISGDENLLRAFANGEDIHRATAGEIFGVEREA 754

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           VS EQR   KV+   L Y  G   F  +AS+ G++
Sbjct: 755 VSSEQRRYAKVINFGLIY--GMSAFG-LASNLGIE 786


>gi|257464896|ref|ZP_05629267.1| DNA polymerase I [Actinobacillus minor 202]
 gi|257450556|gb|EEV24599.1| DNA polymerase I [Actinobacillus minor 202]
          Length = 950

 Score = 66.2 bits (160), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 48/78 (61%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G K+V AD + IE R++A +A +   +KAFA G+DI+ +T ++ F  P+D+
Sbjct: 712 IRQAFIARKGYKIVAADYSQIELRIMAHLANDKGMLKAFAEGKDIHRSTASEIFGVPLDE 771

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 772 VTGEQRRNAKAINFGLIY 789


>gi|163786572|ref|ZP_02181020.1| DNA polymerase I [Flavobacteriales bacterium ALC-1]
 gi|159878432|gb|EDP72488.1| DNA polymerase I [Flavobacteriales bacterium ALC-1]
          Length = 948

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 116/259 (44%), Gaps = 49/259 (18%)

Query: 198 GYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYAL----RMYLFLITGIDL 253
           G  +D D +  L E       +L+ DI  L   I  ++ + + +    ++ + L   + L
Sbjct: 562 GINLDKDFLNSLSE-------ELNTDIANLEKSIYEAAGEEFNIASPKQLGVILFEKMKL 614

Query: 254 VDMSEGTLKSILSHSN--ITQLAKD--LILNRLASSGSAILKLNTLSEAV-----SSDGR 304
           VD  + T     S +   ++ LAKD  +I   L   G + LK +T  +A+      S GR
Sbjct: 615 VDKPKKTKTGQYSTAEDVLSYLAKDHKIIQQVLDFRGLSKLK-STYVDALPLQVDESTGR 673

Query: 305 LRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDC 363
           +  T      + TGR S      QN+P R ER  +                         
Sbjct: 674 VH-TDYMQTVAATGRLSSNNPNLQNIPIRTERGRQ------------------------- 707

Query: 364 VRSCIIASNGKK-LVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPID 422
           VR   +  +    L+ AD + IE R++A ++ E+  I+AF NGEDI+ +T +K FN PI 
Sbjct: 708 VRKAFVPRDENHILLAADYSQIELRIIAALSKEETMIEAFKNGEDIHASTASKVFNVPIT 767

Query: 423 KVSKEQRAIGKVMELALGY 441
           +V++EQR+  K +   + Y
Sbjct: 768 EVTREQRSNAKTVNFGIIY 786


>gi|54293062|ref|YP_125477.1| DNA polymerase I [Legionella pneumophila str. Lens]
 gi|53752894|emb|CAH14329.1| DNA polymerase I [Legionella pneumophila str. Lens]
          Length = 896

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 81/317 (25%), Positives = 134/317 (42%), Gaps = 47/317 (14%)

Query: 160 GEYCKRDVEATRELFKRLIP---------LSDGERDLWLLDQTINDRGYRIDLDLVLKLQ 210
           G Y   D + T  L  +L P         L D E  L  +   +   G  ID  ++ K  
Sbjct: 464 GIYAAEDADITLRLHHKLYPMLDKPLRNVLHDIEMPLLTVLADMEMHGVLIDPVILEKHG 523

Query: 211 ELIAQERKKLDEDIVKLTDGI--IRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS 268
             + ++ K L+++ ++L      + S +Q   L+  LF    + +V  +  T +   + S
Sbjct: 524 SRLKEQMKSLEQEAIQLAGKAFNLNSPKQ---LQEILFDEQKLPVVAKTP-TGQPSTAES 579

Query: 269 NITQLAKD-----LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGC 323
            + +LA D     +IL   + S      ++ L + ++       T      + TGR S  
Sbjct: 580 VLQELAFDYRLPAVILEYRSLSKLVSTYIDALPKRINPKTHRVHTSYNQAVAATGRLSSS 639

Query: 324 VFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAG 383
               QN+P   RSEE                         +R+  IA  G  ++ AD + 
Sbjct: 640 DPNLQNIPI--RSEE----------------------GRLIRTAFIAPEGSLIMAADYSQ 675

Query: 384 IEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQG 443
           IE R++A ++ +D  ++AFANG DI+  T ++ F T +D VSKEQR   K +   L Y  
Sbjct: 676 IELRIMAHLSQDDNLLRAFANGWDIHAATASEIFQTNLDAVSKEQRRRAKAVNFGLIY-- 733

Query: 444 GAKVFKTMASHCGLDLQ 460
           G   F  +A   G++ Q
Sbjct: 734 GMSAF-GLAKQIGVERQ 749


>gi|167583897|ref|ZP_02376285.1| DNA polymerase I [Burkholderia ubonensis Bu]
          Length = 917

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G ++V AD + IE R++A I+G+   ++AF+NGEDI+  T A+ F     +
Sbjct: 678 IREAFIASPGHQIVSADYSQIELRIMAHISGDASLLRAFSNGEDIHRATAAEVFGVTPLE 737

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 738 VTADQRRIAKVINFGLIY--GMSAFG-LASNLGI 768


>gi|170691111|ref|ZP_02882277.1| DNA polymerase I [Burkholderia graminis C4D1M]
 gi|170144360|gb|EDT12522.1| DNA polymerase I [Burkholderia graminis C4D1M]
          Length = 913

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G KLV AD + IE R++A I+G++  ++AF+ GEDI+  T A+ F+    +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLLRAFSEGEDIHRATAAEIFSVTPLE 733

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           VS +QR + KV+   L Y  G   F  +AS+ G+
Sbjct: 734 VSNDQRRVAKVINFGLIY--GMSSFG-LASNLGI 764


>gi|307726557|ref|YP_003909770.1| DNA polymerase I [Burkholderia sp. CCGE1003]
 gi|307587082|gb|ADN60479.1| DNA polymerase I [Burkholderia sp. CCGE1003]
          Length = 913

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G KLV AD + IE R++A I+G++  ++AF+ GEDI+  T A+ F+    +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLLRAFSQGEDIHRATAAEIFSVTPLE 733

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           VS +QR + KV+   L Y  G   F  +AS+ G+
Sbjct: 734 VSNDQRRVAKVINFGLIY--GMSSFG-LASNLGI 764


>gi|323529237|ref|YP_004231389.1| DNA polymerase I [Burkholderia sp. CCGE1001]
 gi|323386239|gb|ADX58329.1| DNA polymerase I [Burkholderia sp. CCGE1001]
          Length = 913

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G KLV AD + IE R++A I+G++  ++AF+ GEDI+  T A+ F+    +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLLRAFSQGEDIHRATAAEIFSVTPLE 733

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           VS +QR + KV+   L Y  G   F  +AS+ G+
Sbjct: 734 VSNDQRRVAKVINFGLIY--GMSSFG-LASNLGI 764


>gi|52840354|ref|YP_094153.1| DNA polymerase I [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52627465|gb|AAU26206.1| DNA polymerase I [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 896

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 82/317 (25%), Positives = 134/317 (42%), Gaps = 47/317 (14%)

Query: 160 GEYCKRDVEATRELFKRLIP---------LSDGERDLWLLDQTINDRGYRIDLDLVLKLQ 210
           G Y   D + T  L  +L P         L D E  L  +   +   G  ID  ++ K  
Sbjct: 464 GIYAAEDADITLRLHHKLYPMLDESLRNVLHDIEIPLLTVLADMEMHGVLIDPVILEKHG 523

Query: 211 ELIAQERKKLDEDIVKLTDGI--IRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS 268
             + ++ K L+++ V+L      + S +Q   L+  LF    + +V  +  T +   + S
Sbjct: 524 SRLKEQMKSLEQEAVQLAGKAFNLNSPKQ---LQEILFDEQKLPVVAKTP-TGQPSTAES 579

Query: 269 NITQLAKD-----LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGC 323
            + +LA D     +IL   + S      ++ L + ++       T      + TGR S  
Sbjct: 580 VLQELAFDYRLPAVILEYRSLSKLVSTYIDALPKRINPKTHRVHTSYNQAVAATGRLSSS 639

Query: 324 VFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAG 383
               QN+P   RSEE                         +R+  IA  G  ++ AD + 
Sbjct: 640 DPNLQNIPI--RSEE----------------------GRLIRTAFIAPEGSLIMAADYSQ 675

Query: 384 IEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQG 443
           IE R++A ++ +D  ++AFANG DI+  T ++ F T +D VSKEQR   K +   L Y  
Sbjct: 676 IELRIMAHLSQDDNLLRAFANGWDIHAATASEIFQTNLDAVSKEQRRRAKAVNFGLIY-- 733

Query: 444 GAKVFKTMASHCGLDLQ 460
           G   F  +A   G++ Q
Sbjct: 734 GMSAF-GLAKQIGVERQ 749


>gi|225013103|ref|ZP_03703517.1| DNA polymerase I [Flavobacteria bacterium MS024-2A]
 gi|225002761|gb|EEG40743.1| DNA polymerase I [Flavobacteria bacterium MS024-2A]
          Length = 940

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 107/236 (45%), Gaps = 40/236 (16%)

Query: 220 LDEDIVKLTDGIIRSSRQTYAL----RMYLFLITGIDLVDMSEGTLKSILSHSN--ITQL 273
           L EDI KL   I   + + + L    ++ L L   + LVD  + T     S +   ++ L
Sbjct: 569 LAEDIQKLEAAIFEVAGENFNLASPKQLGLILFDKLKLVDKPKKTKTGQYSTAEDVLSYL 628

Query: 274 AKDLILNRLASSGSAILKL-NTLSEAVSSD-----GRLRGTLQFYGASRTGRWSGCVFQP 327
           AKD  +        ++ KL NT  +A+ ++     GR+  T+     + TGR S      
Sbjct: 629 AKDHPIISDILDWRSLQKLQNTYVDALPNEINPKTGRVH-TIYNQAVAATGRLSSNNPNL 687

Query: 328 QNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKK-LVVADLAGIE 385
           QN+P R ER ++                         VR   I  +    L+ AD + IE
Sbjct: 688 QNIPIRTERGQQ-------------------------VRKAFIPRDENHVLMAADYSQIE 722

Query: 386 ARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            R++A ++G++  + AF N EDI+  T +K FN P+++V++EQR   K +   + Y
Sbjct: 723 LRIIAALSGDEGMLSAFQNNEDIHSATASKVFNVPLEEVTREQRGNAKTVNFGIIY 778


>gi|304399055|ref|ZP_07380924.1| DNA polymerase I [Pantoea sp. aB]
 gi|304353515|gb|EFM17893.1| DNA polymerase I [Pantoea sp. aB]
          Length = 928

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 85/350 (24%), Positives = 144/350 (41%), Gaps = 63/350 (18%)

Query: 200 RIDLDLVLKLQELIAQERKKLDEDIVKLT------DGIIRSSRQTYALRMYLFLITGIDL 253
           RI+ + VL  Q ++AQ  K+L   + +L        G   +   T  L++ LF   GI  
Sbjct: 538 RIERNGVLIDQSILAQHSKELTARLAELELKAHELAGEPFNLSSTKQLQVILFEKQGIKP 597

Query: 254 VDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL-NTLSEAVS-----SDGRLRG 307
              + G   S  S   + +LA D  L ++      + KL +T ++ +        GR+  
Sbjct: 598 TKKTPGGAPST-SEEVLAELALDYPLPKVILEHRGLSKLKSTYTDKLPLMINPISGRVH- 655

Query: 308 TLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSC 367
           T      + TGR S      QN+P   R++E                         +R  
Sbjct: 656 TSYHQAVTATGRLSSADPNLQNIPV--RNDE----------------------GRRIRQA 691

Query: 368 IIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKE 427
            +A+ G ++V AD + IE R++A ++ +   + AFA GEDI+  T ++ F   +DKVS E
Sbjct: 692 FVAAKGHRIVAADYSQIELRIMAHLSQDKGLLDAFAQGEDIHRATASEVFGVALDKVSGE 751

Query: 428 QRAIGKVMELALGY--------------QGGAKVFKTMASHCGLDLQQFSQNVKSTSTFE 473
           QR   K +   L Y               G AK +  +       + ++ +N +  +   
Sbjct: 752 QRRSAKAINFGLIYGMSAFGLSRQLNIGAGEAKKYMDLYFERYPGVLRYMENTRQLAASN 811

Query: 474 DW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAWRA 512
            + E  E   LW+ D     A++ K          + GTA +++K+A  A
Sbjct: 812 GYVETLEGRRLWLPDIKSSNAIRRKAAERAAINAPMQGTAADIIKRAMIA 861


>gi|320539310|ref|ZP_08038980.1| fused DNA polymerase I 5'->3' polymerase/3'->5' exonuclease/5'->3'
           exonuclease [Serratia symbiotica str. Tucson]
 gi|320030702|gb|EFW12711.1| fused DNA polymerase I 5'->3' polymerase/3'->5' exonuclease/5'->3'
           exonuclease [Serratia symbiotica str. Tucson]
          Length = 933

 Score = 65.5 bits (158), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G ++V AD + IE R++A ++ +   +KAFA G+DI+  T A+ F  P+DK
Sbjct: 693 IRQAFIAPEGYRIVAADYSQIELRIMAHLSQDAGLLKAFAEGKDIHRATAAEVFGVPLDK 752

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 753 VASEQRRSAKAINFGLIY 770


>gi|293391271|ref|ZP_06635605.1| DNA polymerase I [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290951805|gb|EFE01924.1| DNA polymerase I [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 933

 Score = 65.5 bits (158), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 55/99 (55%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K++ AD + IE R++A ++ +   I AFA G+DI+ +T A+ F  P+++
Sbjct: 695 IRQAFIARDGYKIIAADYSQIELRIMAHLSNDQGLINAFAQGKDIHRSTAAEIFGLPLEQ 754

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           V+ EQR   K +   L Y   + VF         D Q++
Sbjct: 755 VTSEQRRNAKAINFGLIYGMSSFVFPARLGISRADAQRY 793


>gi|219815950|gb|ACL37074.1| DNA polymerase I [uncultured bacterium]
          Length = 803

 Score = 65.5 bits (158), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 83/183 (45%), Gaps = 30/183 (16%)

Query: 267 HSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQ 326
           H  IT++ +   L +L S+      ++ L   VS+DGRLR T    GA+ TGR +     
Sbjct: 487 HPIITEILRYRELQKLVST-----YIDNLPPLVSADGRLRTTFVQTGAA-TGRMASQNPN 540

Query: 327 PQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEA 386
            QN+P   R+EE                      S  +R   +AS G  +V  D + IE 
Sbjct: 541 LQNIPI--RTEE----------------------SKAIRQAFVASPGYSIVSIDYSQIEL 576

Query: 387 RVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAK 446
           R+ A ++ ++  ++ FA GED++     + F    ++V++E R   KV+   + Y  G  
Sbjct: 577 RIAAILSRDEKMVEIFARGEDVHTGVAVRVFGVTPEEVTREMRRKAKVINFGILYGMGVN 636

Query: 447 VFK 449
             +
Sbjct: 637 ALR 639


>gi|134292957|ref|YP_001116693.1| DNA polymerase I [Burkholderia vietnamiensis G4]
 gi|134136114|gb|ABO57228.1| DNA polymerase I [Burkholderia vietnamiensis G4]
          Length = 917

 Score = 65.5 bits (158), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G ++V AD + IE R++A I+G+   ++AFA+GEDI+  T A+ F     +
Sbjct: 678 IREAFIASPGHRIVSADYSQIELRIMAHISGDASLLRAFAHGEDIHRATAAEVFGVTPLE 737

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 738 VNSDQRRIAKVINFGLIY--GMSAFG-LASNLGI 768


>gi|239993904|ref|ZP_04714428.1| DNA polymerase I [Alteromonas macleodii ATCC 27126]
          Length = 930

 Score = 65.5 bits (158), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           VR   +   G K V AD + IE R++A ++G+   + AFA+G+DI+  T A+ F  P+D+
Sbjct: 690 VRQAFVPREGNKFVAADYSQIELRIMAHLSGDKGLLDAFAHGKDIHKATAAEVFGVPLDE 749

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 750 VTTEQRRSAKAINFGLIY 767


>gi|309791689|ref|ZP_07686181.1| DNA polymerase I [Oscillochloris trichoides DG6]
 gi|308226311|gb|EFO80047.1| DNA polymerase I [Oscillochloris trichoides DG6]
          Length = 951

 Score = 65.1 bits (157), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 66/139 (47%), Gaps = 25/139 (17%)

Query: 303 GRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASD 362
           GR+  T    GA+ TGR S      QN+P       + TQ  + + RG            
Sbjct: 667 GRVHTTYNQVGAA-TGRLSSNDPNLQNIP-------VRTQEGREIRRG------------ 706

Query: 363 CVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPID 422
                 +A+ G + + AD + IE RVLA+I  +   ++AF  G+DI+  T A+ F   ID
Sbjct: 707 -----FVAAPGHRFIAADYSQIELRVLAYITKDPNLVRAFQEGQDIHAATAAQLFGVAID 761

Query: 423 KVSKEQRAIGKVMELALGY 441
           +V KEQR I K +   + Y
Sbjct: 762 QVDKEQRRIAKTVVFGVIY 780


>gi|171321673|ref|ZP_02910595.1| DNA polymerase I [Burkholderia ambifaria MEX-5]
 gi|171093053|gb|EDT38279.1| DNA polymerase I [Burkholderia ambifaria MEX-5]
          Length = 917

 Score = 65.1 bits (157), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 84/172 (48%), Gaps = 31/172 (18%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G ++V AD + IE R++A I+G+   ++AFA GEDI+  T A+ F     +
Sbjct: 678 IREAFIASPGHRIVSADYSQIELRIMAHISGDASLLRAFAQGEDIHRATAAEVFGVTPLE 737

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ +QR I KV+   L Y  G   F  +AS+ G+                  + Q+ ++ 
Sbjct: 738 VNSDQRRIAKVINFGLIY--GMSAFG-LASNLGITRDAAKLYIDRYFTRYPGVAQYMEDT 794

Query: 467 KSTSTFEDW-EQAESHHLWMQD---------QYPE-FAVKDKLIGTACELVK 507
           ++T+  + + E      LW+ +         Q  E  A+   + GTA +L+K
Sbjct: 795 RTTAKEKGYVETVFGRRLWLPEINGGNGPRRQAAERAAINAPMQGTAADLIK 846


>gi|86140808|ref|ZP_01059367.1| putative DNA polymerase I [Leeuwenhoekiella blandensis MED217]
 gi|85832750|gb|EAQ51199.1| putative DNA polymerase I [Leeuwenhoekiella blandensis MED217]
          Length = 948

 Score = 65.1 bits (157), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 110/246 (44%), Gaps = 40/246 (16%)

Query: 210 QELIAQERKKLDEDIVKLTDGIIRSSRQTYAL----RMYLFLITGIDLVDMSEGTLKSIL 265
           QE +    + L+ DI  L   I   + + + +    ++   L   + LVD  + T     
Sbjct: 567 QEFLGSLSEALNNDIASLEKSIYEEAGEEFNIGSPKQLGEILFDKLKLVDKPKKTRTGQY 626

Query: 266 SHSN--ITQLAKD--LILNRLASSGSAILK---LNTLSEAVSSD-GRLRGTLQFYGASRT 317
           S +   ++ LA D  ++ + L   G + LK   ++ L   V++  GR+  T      + T
Sbjct: 627 STAEDVLSYLAPDHEIVQHVLDYRGLSKLKSTYVDALPAQVNAKTGRVH-TDYMQTVAAT 685

Query: 318 GRWSGCVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKK- 375
           GR S      QN+P R ER  +                         VR   +  N    
Sbjct: 686 GRLSSNNPNLQNIPIRTERGRQ-------------------------VRKAFVPRNEDYV 720

Query: 376 LVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVM 435
           L+ AD + IE R++A ++ E+  +KAF  GEDI+ +T AK FN PID+V++EQR+  K +
Sbjct: 721 LLAADYSQIELRIIAALSQEETMMKAFQEGEDIHASTAAKVFNVPIDEVTREQRSNAKTV 780

Query: 436 ELALGY 441
              + Y
Sbjct: 781 NFGIIY 786


>gi|227484612|ref|ZP_03914928.1| possible DNA-directed DNA polymerase I [Anaerococcus lactolyticus
           ATCC 51172]
 gi|227237332|gb|EEI87347.1| possible DNA-directed DNA polymerase I [Anaerococcus lactolyticus
           ATCC 51172]
          Length = 877

 Score = 65.1 bits (157), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 69/147 (46%), Gaps = 25/147 (17%)

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIA 354
           L  A+  DGR+R T +   AS TGR S      QNLP       I T   +A        
Sbjct: 594 LENAIDEDGRIRSTFRQNIAS-TGRLSSQEPNLQNLP-------IKTDEGRA-------- 637

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYA 414
                    +R    A  GK L+ AD + IE R+LA +A +     AF  G DI+  T +
Sbjct: 638 ---------IRKAFKAGEGKILIDADYSQIELRILASLADDKNMQDAFNRGIDIHTQTAS 688

Query: 415 KAFNTPIDKVSKEQRAIGKVMELALGY 441
           + F+TP+D+V+K QR+  K +   + Y
Sbjct: 689 EVFHTPLDEVTKLQRSEAKAVNFGIIY 715


>gi|120434510|ref|YP_860207.1| DNA polymerase I [Gramella forsetii KT0803]
 gi|117576660|emb|CAL65129.1| DNA polymerase I [Gramella forsetii KT0803]
          Length = 942

 Score = 65.1 bits (157), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 139/301 (46%), Gaps = 54/301 (17%)

Query: 156 WQLFGEYCKRDVEA-TRELFKRL-IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELI 213
           +QL   + K   EA TR+LF  + IPL +   D+ L        G ++D + +  L E +
Sbjct: 519 FQLKNLFEKELEEAETRKLFNEIEIPLVEVLADMEL-------EGIKLDEEYLKSLSEAL 571

Query: 214 AQERKKLDEDIVKLT--DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSN-- 269
           A + K L+  I +    + +I S +Q     + + L   ++L    + T     S S   
Sbjct: 572 ASDIKDLETKIYEAAGEEFLISSPKQ-----LGIILFEKMELSKKPKKTKTGQYSTSEDV 626

Query: 270 ITQLAK--DLILNRLASSGSAILKLNTLSEAVSSD-----GRLRGTLQFYGASRTGRWSG 322
           ++ LA+  D++ + L   G   L+ NT  +A+ +      GR+  T      + TGR S 
Sbjct: 627 LSSLAEENDIVQHVLDYRGLVKLQ-NTYVDALPNQVERTTGRVH-TDYVQTTAATGRLSS 684

Query: 323 CVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKK-LVVAD 380
                QN+P R ER ++                         VR   +  +    L+ AD
Sbjct: 685 NNPNLQNIPIRTERGKQ-------------------------VRKAFVPRDENYVLLAAD 719

Query: 381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
            + IE R++A ++ E+  I+AF +GEDI+ +T AK FN P+++V++EQR+  K +   + 
Sbjct: 720 YSQIELRIIAALSNEENMIQAFKDGEDIHASTAAKVFNVPLEEVTREQRSNAKTVNFGII 779

Query: 441 Y 441
           Y
Sbjct: 780 Y 780


>gi|254492177|ref|ZP_05105351.1| DNA polymerase I superfamily [Methylophaga thiooxidans DMS010]
 gi|224462502|gb|EEF78777.1| DNA polymerase I superfamily [Methylophaga thiooxydans DMS010]
          Length = 894

 Score = 65.1 bits (157), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 84/176 (47%), Gaps = 25/176 (14%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +ASNG  L+ AD + IE R++A ++G++  +KAFA GEDI+  T ++ F+  ++ 
Sbjct: 655 IREAFVASNGYTLLAADYSQIELRIMAHLSGDESLLKAFAAGEDIHRHTASEIFDIALED 714

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKT---MASHCGLD-----------LQQFSQNVKST 469
           VS +QR   K +   L Y   A        +  H   D           ++Q+  N +  
Sbjct: 715 VSSDQRRSAKAINFGLIYGMSAHGLSKQLGIERHQAADYMQTYFDRYPGVRQYMDNTREQ 774

Query: 470 STFEDW-EQAESHHLW---------MQDQYPE-FAVKDKLIGTACELVKKAWRAKH 514
           +  + + E      L+         M+ QY E  A+   + G+A +++K+A  A H
Sbjct: 775 AKEQGYVETIFGRRLYLPEINSSNGMRRQYAERTAINAPMQGSAADIIKRAMIAIH 830


>gi|83648986|ref|YP_437421.1| DNA polymerase I [Hahella chejuensis KCTC 2396]
 gi|83637029|gb|ABC32996.1| DNA polymerase I [Hahella chejuensis KCTC 2396]
          Length = 911

 Score = 65.1 bits (157), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G KL+ AD + IE R++A ++G++  +KAF+ G D++  T A+ FN   D+
Sbjct: 671 IRQAFIAPKGCKLISADYSQIELRIMAHLSGDEGLLKAFSEGLDVHQATAAEVFNVAFDE 730

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 731 VSSEQRRKAKAINFGLIY 748


>gi|227327116|ref|ZP_03831140.1| DNA polymerase I [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 929

 Score = 65.1 bits (157), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   + AFANG DI+  T ++ F T +DK
Sbjct: 690 IRQAFIAPQGYSIVAADYSQIELRIMAHLSGDKGLLNAFANGLDIHRATASEVFGTALDK 749

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 750 VTSEQRRSAKAINFGLIY 767


>gi|148358256|ref|YP_001249463.1| DNA polymerase I [Legionella pneumophila str. Corby]
 gi|148280029|gb|ABQ54117.1| DNA polymerase I [Legionella pneumophila str. Corby]
          Length = 896

 Score = 65.1 bits (157), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 81/317 (25%), Positives = 134/317 (42%), Gaps = 47/317 (14%)

Query: 160 GEYCKRDVEATRELFKRLIP---------LSDGERDLWLLDQTINDRGYRIDLDLVLKLQ 210
           G Y   D + T  L  +L P         L D E  L  +   +   G  ID  ++ K  
Sbjct: 464 GIYAAEDADITLRLHHKLYPMLDEPLRNVLHDIEMPLLTVLADMEIHGVLIDPVILEKHG 523

Query: 211 ELIAQERKKLDEDIVKLTDGI--IRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS 268
             + ++ K L+++ V+L      + S +Q   L+  LF    + +V  +  T +   + S
Sbjct: 524 SRLKEQMKSLEQEAVQLAGKAFNLNSPKQ---LQEILFDEQKLPVVAKTP-TGQPSTAES 579

Query: 269 NITQLAKD-----LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGC 323
            + +LA D     +IL   + S      ++ L + ++       T      + TGR S  
Sbjct: 580 VLQELAFDYRLPAVILEYRSLSKLVSTYIDALPKRINPKTHRVHTSYNQAVAATGRLSSS 639

Query: 324 VFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAG 383
               QN+P   RSEE                         +R+  IA  G  ++ AD + 
Sbjct: 640 DPNLQNIPI--RSEE----------------------GRLIRTAFIAPEGSLIMAADYSQ 675

Query: 384 IEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQG 443
           IE R++A ++ +D  ++AFANG DI+  T ++ F T ++ VSKEQR   K +   L Y  
Sbjct: 676 IELRIMAHLSQDDNLLRAFANGWDIHAATASEIFQTNLEAVSKEQRRRAKAVNFGLIY-- 733

Query: 444 GAKVFKTMASHCGLDLQ 460
           G   F  +A   G++ Q
Sbjct: 734 GMSAF-GLAKQIGVERQ 749


>gi|253690587|ref|YP_003019777.1| DNA polymerase I [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|251757165|gb|ACT15241.1| DNA polymerase I [Pectobacterium carotovorum subsp. carotovorum
           PC1]
          Length = 929

 Score = 65.1 bits (157), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   + AFANG DI+  T ++ F T +DK
Sbjct: 690 IRQAFIAPKGYSIVAADYSQIELRIMAHLSGDKGLLNAFANGLDIHRATASEVFGTALDK 749

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 750 VTSEQRRSAKAINFGLIY 767


>gi|172062801|ref|YP_001810452.1| DNA polymerase I [Burkholderia ambifaria MC40-6]
 gi|171995318|gb|ACB66236.1| DNA polymerase I [Burkholderia ambifaria MC40-6]
          Length = 917

 Score = 65.1 bits (157), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G ++V AD + IE R++A I+G+   ++AFA GEDI+  T A+ F     +
Sbjct: 678 IREAFIASPGHRIVSADYSQIELRIMAHISGDASLLRAFAQGEDIHRATAAEVFGVTPLE 737

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 738 VNSDQRRIAKVINFGLIY--GMSAFG-LASNLGI 768


>gi|54296094|ref|YP_122463.1| DNA polymerase I [Legionella pneumophila str. Paris]
 gi|53749879|emb|CAH11261.1| DNA polymerase I [Legionella pneumophila str. Paris]
          Length = 896

 Score = 65.1 bits (157), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 81/317 (25%), Positives = 134/317 (42%), Gaps = 47/317 (14%)

Query: 160 GEYCKRDVEATRELFKRLIP---------LSDGERDLWLLDQTINDRGYRIDLDLVLKLQ 210
           G Y   D + T  L  +L P         L D E  L  +   +   G  ID  ++ K  
Sbjct: 464 GIYAAEDADITLRLHHKLYPMLDKPLRNVLHDIEMPLLTVLADMEMHGVLIDPVILEKHG 523

Query: 211 ELIAQERKKLDEDIVKLTDGI--IRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS 268
             + ++ K L+++ V+L      + S +Q   L+  LF    + +V  +  T +   + S
Sbjct: 524 SRLKEQMKSLEQEAVQLAGKAFNLNSPKQ---LQEILFDEQKLPVVAKTP-TGQPSTAES 579

Query: 269 NITQLAKD-----LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGC 323
            + +LA D     +IL   + S      ++ L + ++       T      + TGR S  
Sbjct: 580 VLQELAFDYRLPAVILEYRSLSKLVSTYIDALPKRINPKTHRVHTSYNQAVAATGRLSSS 639

Query: 324 VFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAG 383
               QN+P   RSEE                         +R+  IA  G  ++ AD + 
Sbjct: 640 DPNLQNIPI--RSEE----------------------GRLIRTAFIAPEGSLIMAADYSQ 675

Query: 384 IEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQG 443
           IE R++A ++ +D  ++AFANG DI+  T ++ F T ++ VSKEQR   K +   L Y  
Sbjct: 676 IELRIMAHLSQDDNLLRAFANGWDIHAATASEIFQTNLEAVSKEQRRRAKAVNFGLIY-- 733

Query: 444 GAKVFKTMASHCGLDLQ 460
           G   F  +A   G++ Q
Sbjct: 734 GMSAF-GLAKQIGVERQ 749


>gi|115357994|ref|YP_775132.1| DNA polymerase I [Burkholderia ambifaria AMMD]
 gi|115283282|gb|ABI88798.1| DNA polymerase I [Burkholderia ambifaria AMMD]
          Length = 917

 Score = 65.1 bits (157), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G ++V AD + IE R++A I+G+   ++AFA GEDI+  T A+ F     +
Sbjct: 678 IREAFIASPGHRIVSADYSQIELRIMAHISGDASLLRAFAQGEDIHRATAAEVFGVTPLE 737

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 738 VNSDQRRIAKVINFGLIY--GMSAFG-LASNLGI 768


>gi|301629258|ref|XP_002943761.1| PREDICTED: DNA polymerase I-like [Xenopus (Silurana) tropicalis]
          Length = 931

 Score = 65.1 bits (157), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 134/308 (43%), Gaps = 32/308 (10%)

Query: 162 YCKRDVEATRELFKRLIPLSDGE---RDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           Y   D + T E+ + L PL       R ++ L+   ++  +R++ + VL    L+AQ+  
Sbjct: 501 YACEDSDQTLEVHQTLWPLLQANERLRAIYELEMHSSEALFRMERNGVLIDAALLAQQSH 560

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRM------YLFLITGIDLVDMSEGTLKSILSHSNITQ 272
            L + I++L       + Q + L          F   G+ +V  +    +S  +   + +
Sbjct: 561 ALGQRILRLETEAYEIAGQPFNLNSPKQLGEIFFDKLGMPVVRKTTTGARST-NEEVLEK 619

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
           LA D  L       + +L+  +LS+  S+     G L      RTGR      Q   +  
Sbjct: 620 LAADYPLP------ARLLEHRSLSKLKSTYTDKLGLLAL---PRTGRVHTHYAQAVAVTG 670

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
           +  S +   Q I        +  P G     +R   +A  G+ +  AD + IE R++A I
Sbjct: 671 RLSSSDPNLQNI-------PVRTPEG---RRIREAFVAPPGRVIASADYSQIELRIMAHI 720

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G+   + AF +G D++  T A+ F  P+ +VS EQR   KV+   L Y  G   F  +A
Sbjct: 721 SGDPSLLHAFHHGLDVHRATAAEVFGVPVSEVSSEQRRYAKVINFGLIY--GMSSFG-LA 777

Query: 453 SHCGLDLQ 460
            + GLD Q
Sbjct: 778 KNLGLDRQ 785


>gi|331000437|ref|ZP_08324112.1| DNA-directed DNA polymerase [Parasutterella excrementihominis YIT
           11859]
 gi|329571769|gb|EGG53449.1| DNA-directed DNA polymerase [Parasutterella excrementihominis YIT
           11859]
          Length = 950

 Score = 64.7 bits (156), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 84/182 (46%), Gaps = 31/182 (17%)

Query: 266 SHSNITQLAKDLILNRLASSGSAILKL-NTLSEAVSS-----DGRLRGTLQFYGASRTGR 319
           S   +++LA++  L ++A     I KL  T +E +       DGR+  T +    + TGR
Sbjct: 633 SEEVLSELAENYPLAKIALEYRTITKLVTTYTEKLPKMVDPKDGRVHTTFE-QAVAVTGR 691

Query: 320 WSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVA 379
            S      QN+P   R+EE                         VR   I+++G KL+ A
Sbjct: 692 LSSTNPNLQNIPI--RTEE----------------------GRKVREAFISASGCKLISA 727

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++ +   ++AF N EDI+  T A+ F    DKV+   R I KV+   L
Sbjct: 728 DYSQIELRIMAHLSADKRLVEAFKNNEDIHRATAAEVFGKERDKVTPNDRRIAKVINFGL 787

Query: 440 GY 441
            Y
Sbjct: 788 MY 789


>gi|170701220|ref|ZP_02892190.1| DNA polymerase I [Burkholderia ambifaria IOP40-10]
 gi|170133887|gb|EDT02245.1| DNA polymerase I [Burkholderia ambifaria IOP40-10]
          Length = 917

 Score = 64.7 bits (156), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G ++V AD + IE R++A I+G+   ++AFA GEDI+  T A+ F     +
Sbjct: 678 IREAFIASPGHRIVSADYSQIELRIMAHISGDASLLRAFAQGEDIHRATAAEVFGVTPLE 737

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 738 VNSDQRRIAKVINFGLIY--GMSAFG-LASNLGI 768


>gi|296105609|ref|YP_003617309.1| DNA polymerase I [Legionella pneumophila 2300/99 Alcoy]
 gi|295647510|gb|ADG23357.1| DNA polymerase I [Legionella pneumophila 2300/99 Alcoy]
          Length = 896

 Score = 64.7 bits (156), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 81/317 (25%), Positives = 134/317 (42%), Gaps = 47/317 (14%)

Query: 160 GEYCKRDVEATRELFKRLIP---------LSDGERDLWLLDQTINDRGYRIDLDLVLKLQ 210
           G Y   D + T  L  +L P         L D E  L  +   +   G  ID  ++ K  
Sbjct: 464 GIYAAEDADITLRLHHKLYPMLDKPLRNVLHDIEMPLLTVLADMEMHGVLIDPVILEKHG 523

Query: 211 ELIAQERKKLDEDIVKLTDGI--IRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS 268
             + ++ K L+++ V+L      + S +Q   L+  LF    + +V  +  T +   + S
Sbjct: 524 SRLKEQMKSLEQEAVQLAGKAFNLNSPKQ---LQEILFDEQKLPVVAKTP-TGQPSTAES 579

Query: 269 NITQLAKD-----LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGC 323
            + +LA D     +IL   + S      ++ L + ++       T      + TGR S  
Sbjct: 580 VLQELAFDYRLPAVILEYRSLSKLVSTYIDALPKRINPKTHRVHTSYNQAVAATGRLSSS 639

Query: 324 VFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAG 383
               QN+P   RSEE                         +R+  IA  G  ++ AD + 
Sbjct: 640 DPNLQNIPI--RSEE----------------------GRLIRTAFIAPEGSLIMAADYSQ 675

Query: 384 IEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQG 443
           IE R++A ++ +D  ++AFANG DI+  T ++ F T ++ VSKEQR   K +   L Y  
Sbjct: 676 IELRIMAHLSQDDNLLRAFANGWDIHAATASEIFQTNLEAVSKEQRRRAKAVNFGLIY-- 733

Query: 444 GAKVFKTMASHCGLDLQ 460
           G   F  +A   G++ Q
Sbjct: 734 GMSAF-GLAKQIGVERQ 749


>gi|253987782|ref|YP_003039138.1| DNA polymerase I [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|211638660|emb|CAR67279.1| dna polymerase I polA [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253779232|emb|CAQ82392.1| dna polymerase I polA [Photorhabdus asymbiotica]
          Length = 929

 Score = 64.7 bits (156), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 49/78 (62%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G +++ AD + IE R++A ++ +   +KAFA G+DI+  T A+ F+ P+++
Sbjct: 690 IRQAFIASEGYRIMAADYSQIELRIMAHLSQDQGLLKAFAEGQDIHRATAAEVFDVPLEQ 749

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 750 VTSEQRRSAKAINFGLIY 767


>gi|303257898|ref|ZP_07343907.1| DNA polymerase I [Burkholderiales bacterium 1_1_47]
 gi|302859241|gb|EFL82323.1| DNA polymerase I [Burkholderiales bacterium 1_1_47]
          Length = 891

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 84/182 (46%), Gaps = 31/182 (17%)

Query: 266 SHSNITQLAKDLILNRLASSGSAILKL-NTLSEAVSS-----DGRLRGTLQFYGASRTGR 319
           S   +++LA++  L ++A     I KL  T +E +       DGR+  T +    + TGR
Sbjct: 574 SEEVLSELAENYPLAKIALEYRTITKLVTTYTEKLPKMVDPKDGRVHTTFE-QAVAVTGR 632

Query: 320 WSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVA 379
            S      QN+P   R+EE                         VR   I+++G KL+ A
Sbjct: 633 LSSTNPNLQNIPI--RTEE----------------------GRKVREAFISASGCKLISA 668

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++ +   ++AF N EDI+  T A+ F    DKV+   R I KV+   L
Sbjct: 669 DYSQIELRIMAHLSADKRLVEAFKNNEDIHRATAAEVFGKERDKVTPNDRRIAKVINFGL 728

Query: 440 GY 441
            Y
Sbjct: 729 MY 730


>gi|186473237|ref|YP_001860579.1| DNA polymerase I [Burkholderia phymatum STM815]
 gi|184195569|gb|ACC73533.1| DNA polymerase I [Burkholderia phymatum STM815]
          Length = 915

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G KLV AD + IE R++A I+G++  ++AF  GEDI+  T ++ F+    +
Sbjct: 676 IREAFIAPPGHKLVSADYSQIELRIMAHISGDEALLRAFKQGEDIHRATASEVFSVTPLE 735

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           VS +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 736 VSNDQRRIAKVINFGLIY--GMSSFG-LASNLGI 766


>gi|291542252|emb|CBL15362.1| DNA polymerase I [Ruminococcus bromii L2-63]
          Length = 854

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 72/161 (44%), Gaps = 32/161 (19%)

Query: 291 KLNT-----LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILTQTI 344
           KLN+     L + ++ DGR+         +RTGR S      QN+P R E   E+     
Sbjct: 561 KLNSTYCEGLLKVIADDGRIHSNFN-QTETRTGRISSTEPNLQNIPVRTELGREM----- 614

Query: 345 QALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
                               R    A +G  LV AD + IE RVLA I+G+   IKAF +
Sbjct: 615 --------------------RKFFCARDGWALVDADYSQIELRVLAHISGDKNMIKAFKD 654

Query: 405 GEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGA 445
            EDI+  T ++ FN P+D V+   R+  K +   + Y  GA
Sbjct: 655 NEDIHAITASQVFNMPLDMVTPIMRSRAKAVNFGIVYGIGA 695


>gi|187921421|ref|YP_001890453.1| DNA polymerase I [Burkholderia phytofirmans PsJN]
 gi|187719859|gb|ACD21082.1| DNA polymerase I [Burkholderia phytofirmans PsJN]
          Length = 913

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G KLV AD + IE R++A I+G++  ++AF+ GEDI+  T A+ F+    +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLLRAFSQGEDIHRATAAEIFSVTPLE 733

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           VS +QR + KV+   L Y  G   F  +A++ G+
Sbjct: 734 VSNDQRRVAKVINFGLIY--GMSSFG-LAANLGI 764


>gi|50118986|ref|YP_048153.1| DNA polymerase I [Pectobacterium atrosepticum SCRI1043]
 gi|49609512|emb|CAG72945.1| putative DNA polymerase I [Pectobacterium atrosepticum SCRI1043]
          Length = 929

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G  +V AD + IE R++A ++G+   + AFANG DI+  T ++ F   +DK
Sbjct: 690 IRQAFIASKGYSIVAADYSQIELRIMAHLSGDKGLLNAFANGLDIHRATASEVFGIALDK 749

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 750 VTSEQRRSAKAINFGLIY 767


>gi|300813963|ref|ZP_07094261.1| DNA-directed DNA polymerase [Peptoniphilus sp. oral taxon 836 str.
           F0141]
 gi|300511926|gb|EFK39128.1| DNA-directed DNA polymerase [Peptoniphilus sp. oral taxon 836 str.
           F0141]
          Length = 885

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 50/79 (63%)

Query: 363 CVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPID 422
            +R  +++S G  LV +D + IE RVLA ++ + + I AFA+G DI+  T ++ F+TP D
Sbjct: 645 LIRKALLSSEGSSLVDSDYSQIELRVLASLSNDTYMINAFADGLDIHRKTASEVFHTPYD 704

Query: 423 KVSKEQRAIGKVMELALGY 441
           +VS E R++ K +   + Y
Sbjct: 705 EVSDELRSMAKAVNFGIVY 723


>gi|317484592|ref|ZP_07943496.1| DNA polymerase I [Bilophila wadsworthia 3_1_6]
 gi|316924132|gb|EFV45314.1| DNA polymerase I [Bilophila wadsworthia 3_1_6]
          Length = 874

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 112/257 (43%), Gaps = 38/257 (14%)

Query: 198 GYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGI--IRSSRQT-----YALRMYLFLITG 250
           G ++D + +    E + ++  ++ ED+ +   G   IRS++Q        L++ +   T 
Sbjct: 487 GVKLDAEALADFLEEVQKDLDRITEDVYREAQGPFNIRSAQQLGDVLFNRLKLPVSGKTR 546

Query: 251 IDLVDMSEGTLKSILSHSNITQ-LAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTL 309
                 S+  L+ +  H  +   L +   L +L S+      L  L   +  DGR+R T 
Sbjct: 547 GGQASTSQDVLEKLSGHHPVVDALLEFRKLEKLRST-----YLEPLPRLMGGDGRIRTTF 601

Query: 310 QFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCII 369
               A+ TGR S      QN+P +            AL R              +R+C  
Sbjct: 602 NQL-ATATGRLSSSNPNLQNIPVR-----------GALGR-------------RMRACFT 636

Query: 370 ASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQR 429
           A  GKKL+ AD + IE RVLA ++ ++  + AF  G DI+  T +  F+ P  +++ +QR
Sbjct: 637 APEGKKLISADYSQIELRVLAHLSRDETLLAAFREGADIHARTASLLFDAPPSEITPDQR 696

Query: 430 AIGKVMELALGYQGGAK 446
              K +   L Y  G +
Sbjct: 697 RNAKTINFGLIYGMGPQ 713


>gi|220904332|ref|YP_002479644.1| DNA polymerase I [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
 gi|219868631|gb|ACL48966.1| DNA polymerase I [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
          Length = 921

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 74/155 (47%), Gaps = 25/155 (16%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           L+ L   +  +GR+  T     A+ TGR S      QN+P                 RG+
Sbjct: 631 LDPLPRLMDGNGRIHTTFN-QKATATGRLSSSNPNLQNIP----------------VRGD 673

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
                LG     +R+C IA+ G  LV AD + +E RVLA ++ +   ++AF NGEDI+  
Sbjct: 674 -----LG---KRMRTCFIANPGSALVSADYSQVELRVLAHMSQDKALLEAFRNGEDIHAR 725

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAK 446
           T A  ++   D+VS +QR   K +   L Y  GA+
Sbjct: 726 TAALVYDLAPDQVSPDQRRNAKTINFGLIYGMGAQ 760


>gi|220917745|ref|YP_002493049.1| DNA polymerase I [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955599|gb|ACL65983.1| DNA polymerase I [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 897

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 82/179 (45%), Gaps = 33/179 (18%)

Query: 270 ITQLAKDLILNRLASSGSAILKL-----NTLSEAV-SSDGRLRGTLQFYGASRTGRWSGC 323
           + +LA+   L RL     ++ KL     + L + V  +DGR+  T    GA+ TGR S  
Sbjct: 583 LEKLAEQHALPRLVLEHRSLSKLKGTYVDALPQLVDPADGRIHTTFHQAGAA-TGRLSSS 641

Query: 324 VFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLA 382
               QN+P R E S  I                         R   +A  G +L+ AD +
Sbjct: 642 DPNLQNIPVRTELSRRI-------------------------RQAFVAPAGARLLSADYS 676

Query: 383 GIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            IE R+LA  + +   ++AF + ED++  T A+ F  P ++V+ +QR I KV+   + Y
Sbjct: 677 QIELRILAHYSDDPGLLQAFRDREDVHTRTAAETFGVPPEQVTPDQRRIAKVLNFGIAY 735


>gi|219667033|ref|YP_002457468.1| DNA-directed DNA polymerase [Desulfitobacterium hafniense DCB-2]
 gi|219537293|gb|ACL19032.1| DNA-directed DNA polymerase [Desulfitobacterium hafniense DCB-2]
          Length = 583

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 80/165 (48%), Gaps = 20/165 (12%)

Query: 365 RSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV 424
           R+C  A  G+KL++AD + IE RV A I+G+   I A+  GED+++ T +   + PI+++
Sbjct: 350 RACFAAPPGRKLILADYSQIELRVAAQISGDTRMISAYQQGEDLHLLTASLVAHKPIEEI 409

Query: 425 SKEQRAIGKVMELALGYQGGAKVFKTMASH---CGLDLQQFSQ----NVKSTSTFEDWEQ 477
           S ++R   K +   L +  GA   +  A       + L+Q ++      K+ +    W Q
Sbjct: 410 SPQERQAAKAVNFGLIFGMGAPGLQQYAQQNYGVEMSLEQATEFRERFFKAYTGIHRWHQ 469

Query: 478 AESHHLWMQDQ--------YPEFA-----VKDKLIGTACELVKKA 509
           +   HL  + +        Y E A         + GTA ++VKKA
Sbjct: 470 SIKAHLPKEGRTLAGRKFVYYEKAGLPGYYNTPVQGTAADIVKKA 514


>gi|307546592|ref|YP_003899071.1| DNA polymerase I [Halomonas elongata DSM 2581]
 gi|307218616|emb|CBV43886.1| DNA polymerase I [Halomonas elongata DSM 2581]
          Length = 922

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 45/78 (57%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G +LV AD + IE R++A ++G+   + AFA G DI+  T A+ F   +DK
Sbjct: 683 IRQAFVARPGYRLVAADYSQIELRIMAHLSGDKGLLDAFAQGRDIHAATAAEVFGVALDK 742

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 743 VSGEQRRSAKAINFGLIY 760


>gi|282882006|ref|ZP_06290647.1| DNA-directed DNA polymerase [Peptoniphilus lacrimalis 315-B]
 gi|281298036|gb|EFA90491.1| DNA-directed DNA polymerase [Peptoniphilus lacrimalis 315-B]
          Length = 885

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 50/79 (63%)

Query: 363 CVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPID 422
            +R  +++S G  LV +D + IE RVLA ++ + + I AFA+G DI+  T ++ F+TP D
Sbjct: 645 LIRKALLSSEGSSLVDSDYSQIELRVLASLSNDTYMINAFADGLDIHRKTASEVFHTPYD 704

Query: 423 KVSKEQRAIGKVMELALGY 441
           +VS E R++ K +   + Y
Sbjct: 705 EVSDELRSMAKAVNFGIVY 723


>gi|113460863|ref|YP_718930.1| DNA polymerase I [Haemophilus somnus 129PT]
 gi|112822906|gb|ABI24995.1| DNA polymerase I [Haemophilus somnus 129PT]
          Length = 951

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%)

Query: 363 CVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPID 422
           C+R   IA  G K++ AD + IE R++A ++ ++  I AF  G+DI+ +T A+ F  P++
Sbjct: 713 CIRQAFIARKGYKIIAADYSQIELRIMAHLSQDNGLIMAFNEGKDIHRSTAAEIFGIPLN 772

Query: 423 KVSKEQRAIGKVMELALGY 441
           +V+ EQR   K +   L Y
Sbjct: 773 EVTSEQRRSAKAINFGLIY 791


>gi|296159650|ref|ZP_06842473.1| DNA polymerase I [Burkholderia sp. Ch1-1]
 gi|295890094|gb|EFG69889.1| DNA polymerase I [Burkholderia sp. Ch1-1]
          Length = 913

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G KLV AD + IE R++A I+G++  +++F+ GEDI+  T A+ F+    +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLLRSFSQGEDIHRATAAEIFSVTPLE 733

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           VS +QR + KV+   L Y  G   F  +AS+ G+
Sbjct: 734 VSNDQRRVAKVINFGLIY--GMSSFG-LASNLGI 764


>gi|238024946|ref|YP_002909178.1| DNA polymerase I [Burkholderia glumae BGR1]
 gi|237879611|gb|ACR31943.1| DNA polymerase I [Burkholderia glumae BGR1]
          Length = 917

 Score = 64.7 bits (156), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G K+V AD + IE R++A I+G++  ++AF+ GEDI+  T A+ F     +
Sbjct: 678 IREAFIAAPGCKIVSADYSQIELRIMAHISGDESLLRAFSQGEDIHRATAAEVFGVTPLE 737

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           VS +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 738 VSTDQRRIAKVINFGLIY--GMSAFG-LASNLGI 768


>gi|74318471|ref|YP_316211.1| DNA polymerase I [Thiobacillus denitrificans ATCC 25259]
 gi|74057966|gb|AAZ98406.1| DNA polymerase A [Thiobacillus denitrificans ATCC 25259]
          Length = 907

 Score = 64.7 bits (156), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (54%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  LV AD + IE R++A ++ +   + AFAN  DI+  T A+ F  P+D 
Sbjct: 668 IREAFIAPPGHLLVSADYSQIELRIMAHLSDDAGLLHAFANDLDIHTATAAEVFGVPLDA 727

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           VS EQR I KV+   L Y  G   F  +AS   L+
Sbjct: 728 VSAEQRRIAKVINFGLIY--GMSAFG-LASQLNLE 759


>gi|167577153|ref|ZP_02370027.1| DNA polymerase I [Burkholderia thailandensis TXDOH]
          Length = 926

 Score = 64.3 bits (155), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G K+V AD + IE R++A I+ ++  ++AFANGEDI+  T A+ F     +
Sbjct: 687 IREAFIAPPGSKIVSADYSQIELRIMAHISEDESLLRAFANGEDIHRATAAEVFGVTPLE 746

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 747 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 777


>gi|170717348|ref|YP_001784457.1| DNA polymerase I [Haemophilus somnus 2336]
 gi|168825477|gb|ACA30848.1| DNA polymerase I [Haemophilus somnus 2336]
          Length = 951

 Score = 64.3 bits (155), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%)

Query: 363 CVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPID 422
           C+R   IA  G K++ AD + IE R++A ++ ++  I AF  G+DI+ +T A+ F  P++
Sbjct: 713 CIRQAFIARKGYKIIAADYSQIELRIMAHLSQDNGLIMAFNEGKDIHRSTAAEIFGIPLN 772

Query: 423 KVSKEQRAIGKVMELALGY 441
           +V+ EQR   K +   L Y
Sbjct: 773 EVTSEQRRSAKAINFGLIY 791


>gi|53728836|ref|ZP_00134878.2| COG0749: DNA polymerase I - 3'-5' exonuclease and polymerase
           domains [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|126207957|ref|YP_001053182.1| DNA polymerase I [Actinobacillus pleuropneumoniae L20]
 gi|126096749|gb|ABN73577.1| DNA polymerase I (POL I) [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
          Length = 957

 Score = 64.3 bits (155), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K+V AD + IE R++A +A ++  I AFA G+DI+  T A+ F   +D+
Sbjct: 719 IRQAFIARDGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHCATAAEIFGLALDQ 778

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 779 VTSEQRRSAKAINFGLIY 796


>gi|325680927|ref|ZP_08160464.1| DNA-directed DNA polymerase [Ruminococcus albus 8]
 gi|324107391|gb|EGC01670.1| DNA-directed DNA polymerase [Ruminococcus albus 8]
          Length = 857

 Score = 64.3 bits (155), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 30/178 (16%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILTQTIQALNRG 350
           +++L + V +DGR+R   +    +RTGR S      QN+P R+E            + R 
Sbjct: 570 VDSLLKEVEADGRVRSVFK-QTETRTGRISSTEPNMQNIPVRKE------------IGRN 616

Query: 351 ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYV 410
                        +R   +A +G   + AD + IE RVLA + G++   K FA+G DI+ 
Sbjct: 617 -------------MRKFFVAGDGYTFLDADYSQIELRVLAEVCGDENMRKTFADGTDIHT 663

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKS 468
            T ++ F  P D V  E R+  K +   + Y  GA    +++   G+ +++  Q +K+
Sbjct: 664 MTASQVFGIPADAVLPEMRSAAKAVNFGIIYGIGA---FSLSKDIGVSVKEAKQYIKN 718


>gi|319943201|ref|ZP_08017484.1| DNA-directed DNA polymerase I [Lautropia mirabilis ATCC 51599]
 gi|319743743|gb|EFV96147.1| DNA-directed DNA polymerase I [Lautropia mirabilis ATCC 51599]
          Length = 977

 Score = 64.3 bits (155), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 57/95 (60%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G +++ AD + IE R++A I+ +   +KAFA+GED++  T ++ F  PI +
Sbjct: 738 IREAFIAPPGHQMMSADYSQIELRIMAHISQDAGLLKAFADGEDVHRATASEVFGVPIAE 797

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           V+ EQR   KV+   L Y  G   F  +A++ G++
Sbjct: 798 VNSEQRRYAKVINFGLIY--GMSAFG-LAANLGIE 829


>gi|311693184|gb|ADP96057.1| LOW QUALITY PROTEIN: DNA polymerase I [marine bacterium HP15]
          Length = 868

 Score = 64.3 bits (155), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 45/78 (57%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G KLV AD + IE R++A ++G+   +KAF  GEDI+  T ++ F   +D 
Sbjct: 628 IRQAFIAPEGYKLVAADYSQIELRIMAHLSGDKGLLKAFEKGEDIHKATASEVFGVSLDD 687

Query: 424 VSKEQRAIGKVMELALGY 441
           VS +QR   K +   L Y
Sbjct: 688 VSSDQRRSAKAINFGLIY 705


>gi|172054918|ref|YP_001806245.1| DNA polymerase I-like protein [Cyanothece sp. ATCC 51142]
 gi|171701199|gb|ACB54179.1| DNA polymerase I-like protein [Cyanothece sp. ATCC 51142]
          Length = 662

 Score = 64.3 bits (155), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 79/164 (48%), Gaps = 23/164 (14%)

Query: 365 RSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV 424
           RSC + + G KL++AD + IE R+ A IA +   I A+ N +D++  T A      ID+V
Sbjct: 425 RSCFVPAPGYKLIIADYSQIELRIAAEIANDSVMIDAYCNEKDLHRLTAALVSGKDIDEV 484

Query: 425 SKEQRAIGKVMELALGYQGGAKVFKTMA-SHCGLDLQQFSQNVKSTSTFEDWEQAESHHL 483
           +K++R +GK +   L Y  GA   +  A ++ G+ +  F +  +    F  ++     H 
Sbjct: 485 TKQERQLGKAVNFGLIYGMGATKLRIYAETNYGVSM-TFDEAQRFRDNF--FKGYPGLHQ 541

Query: 484 WMQDQYPEFAVKDKLIGTACELVKKAWRAKH----QGVLQLWKD 523
           W QD             TAC+L  +  + K      G L+ WKD
Sbjct: 542 WHQD-------------TACKL--RTTKVKDIRTLSGRLRRWKD 570


>gi|268608093|ref|ZP_06141821.1| DNA polymerase I [Ruminococcus flavefaciens FD-1]
          Length = 845

 Score = 64.3 bits (155), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 77/160 (48%), Gaps = 30/160 (18%)

Query: 291 KLNT-----LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQ 345
           KLN+     L + ++ DGR+    +    +RTGR S      QN+P   R+E        
Sbjct: 552 KLNSTYVVGLLDKIADDGRIHTWFR-QTETRTGRISSTEPNMQNIPV--RTE-------- 600

Query: 346 ALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
                      LG     +R   +A  G+KLV AD + IE RV+A + G+   I+AF +G
Sbjct: 601 -----------LGAQ---MRKFFVAPKGRKLVDADYSQIELRVMAHLCGDKNMIEAFNSG 646

Query: 406 EDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGA 445
           EDI+ +T A+ F+ P   V+ E R+  K +   + Y  GA
Sbjct: 647 EDIHTSTAAQVFDMPSIMVTPEMRSAAKAVNFGIIYGIGA 686


>gi|33152330|ref|NP_873683.1| DNA polymerase I [Haemophilus ducreyi 35000HP]
 gi|33148553|gb|AAP96072.1| DNA polymerase I [Haemophilus ducreyi 35000HP]
          Length = 962

 Score = 64.3 bits (155), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K+V AD + IE R++A +A ++  I AFANG+DI+  T A+ F   + +
Sbjct: 724 IRQAFIARDGYKIVAADYSQIELRIMAHLANDEGMITAFANGQDIHQATAAEIFGLSLAE 783

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 784 VTSEQRRSAKAINFGLIY 801


>gi|240168007|ref|ZP_04746666.1| DNA polymerase I [Mycobacterium kansasii ATCC 12478]
          Length = 900

 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 86/181 (47%), Gaps = 39/181 (21%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H ++T+L                + ++ L  +V++DGR+  T     A+ TGR 
Sbjct: 596 LQHLLAHRDVTRLK---------------VTVDGLLNSVAADGRIHTTFNQTIAA-TGRL 639

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVAD 380
           S      QN+P       I T      + G  I D          + ++ +   +L+ AD
Sbjct: 640 SSTEPNLQNIP-------IRT------DAGRQIRD----------AFVVGAGYSELMTAD 676

Query: 381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
            + IE R++A ++G++  I+AF  GED++    ++AF  PID+V+ E R   K M   L 
Sbjct: 677 YSQIEMRIMAHLSGDEGLIEAFNTGEDLHSFVASRAFGVPIDEVTGELRRRVKAMSYGLA 736

Query: 441 Y 441
           Y
Sbjct: 737 Y 737


>gi|190149819|ref|YP_001968344.1| DNA polymerase I (POL I) [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|307263139|ref|ZP_07544760.1| hypothetical protein appser13_5610 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189914950|gb|ACE61202.1| DNA polymerase I (POL I) [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|306871501|gb|EFN03224.1| hypothetical protein appser13_5610 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 957

 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G K+V AD + IE R++A +A ++  I AFA G+DI+  T A+ F   +D+
Sbjct: 719 IRQAFIANKGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQ 778

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 779 VTSEQRRSAKAINFGLIY 796


>gi|303252143|ref|ZP_07338311.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|307247479|ref|ZP_07529524.1| hypothetical protein appser2_4750 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302648926|gb|EFL79114.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|306855982|gb|EFM88140.1| hypothetical protein appser2_4750 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 957

 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G K+V AD + IE R++A +A ++  I AFA G+DI+  T A+ F   +D+
Sbjct: 719 IRQAFIANKGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQ 778

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 779 VTSEQRRSAKAINFGLIY 796


>gi|296140146|ref|YP_003647389.1| DNA polymerase I [Tsukamurella paurometabola DSM 20162]
 gi|296028280|gb|ADG79050.1| DNA polymerase I [Tsukamurella paurometabola DSM 20162]
          Length = 917

 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 71/148 (47%), Gaps = 26/148 (17%)

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIA 354
           L +AV+SDGR+  T     A+ TGR S      QN+P   R+E                 
Sbjct: 632 LLKAVASDGRIHSTFNQTVAA-TGRLSSTDPNLQNIPV--RTE----------------- 671

Query: 355 DPLGLASDCVRSCIIASNG-KKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTY 413
                A   +R   +A  G + L+ AD + IE R++A ++ ++  I+AF  GED++    
Sbjct: 672 -----AGRQIRHAFVAGEGYETLMTADYSQIEMRIMAHLSSDEGLIEAFNTGEDLHNFVG 726

Query: 414 AKAFNTPIDKVSKEQRAIGKVMELALGY 441
           AKAF  PID+V+ + R   K M   L Y
Sbjct: 727 AKAFGVPIDEVTPDMRRRVKAMSYGLAY 754


>gi|307260958|ref|ZP_07542640.1| hypothetical protein appser12_5250 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306869260|gb|EFN01055.1| hypothetical protein appser12_5250 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 957

 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G K+V AD + IE R++A +A ++  I AFA G+DI+  T A+ F   +D+
Sbjct: 719 IRQAFIANKGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQ 778

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 779 VTSEQRRSAKAINFGLIY 796


>gi|303250265|ref|ZP_07336465.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307252030|ref|ZP_07533930.1| hypothetical protein appser6_5490 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302650881|gb|EFL81037.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306860499|gb|EFM92512.1| hypothetical protein appser6_5490 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 957

 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G K+V AD + IE R++A +A ++  I AFA G+DI+  T A+ F   +D+
Sbjct: 719 IRQAFIANKGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQ 778

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 779 VTSEQRRSAKAINFGLIY 796


>gi|165975932|ref|YP_001651525.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|165876033|gb|ABY69081.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
          Length = 919

 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K+V AD + IE R++A +A ++  I AFA G+DI+  T A+ F   +D+
Sbjct: 681 IRQAFIARDGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQ 740

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 741 VTSEQRRSAKAINFGLIY 758


>gi|332139424|ref|YP_004425162.1| DNA polymerase I [Alteromonas macleodii str. 'Deep ecotype']
 gi|327549446|gb|AEA96164.1| DNA polymerase I [Alteromonas macleodii str. 'Deep ecotype']
          Length = 930

 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           VR   +   G K V AD + IE R++A ++G+   + AFA+G+DI+  T ++ F  P+D+
Sbjct: 690 VRQAFVPRKGNKFVAADYSQIELRIMAHLSGDKGLLDAFAHGKDIHKATASEVFGVPLDE 749

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 750 VTTEQRRSAKAINFGLIY 767


>gi|307254261|ref|ZP_07536102.1| hypothetical protein appser9_5120 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258723|ref|ZP_07540455.1| hypothetical protein appser11_5210 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306862808|gb|EFM94761.1| hypothetical protein appser9_5120 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306867074|gb|EFM98930.1| hypothetical protein appser11_5210 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 957

 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K+V AD + IE R++A +A ++  I AFA G+DI+  T A+ F   +D+
Sbjct: 719 IRQAFIARDGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQ 778

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 779 VTSEQRRSAKAINFGLIY 796


>gi|91774714|ref|YP_544470.1| DNA polymerase I [Methylobacillus flagellatus KT]
 gi|91708701|gb|ABE48629.1| DNA polymerase I [Methylobacillus flagellatus KT]
          Length = 910

 Score = 63.9 bits (154), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  ++ AD + IE R++A ++ ++  + AFA GEDI+  T A+ F  P D+
Sbjct: 671 IREAFIAPPGASIISADYSQIELRIMAHLSQDEGLLSAFAKGEDIHRATAAEIFGVPRDE 730

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   KV+   L Y
Sbjct: 731 VSSEQRRYAKVINFGLIY 748


>gi|307256528|ref|ZP_07538309.1| hypothetical protein appser10_5330 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306864938|gb|EFM96840.1| hypothetical protein appser10_5330 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 957

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K+V AD + IE R++A +A ++  I AFA G+DI+  T A+ F   +D+
Sbjct: 719 IRQAFIARDGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQ 778

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 779 VTSEQRRSAKAINFGLIY 796


>gi|309784631|ref|ZP_07679266.1| DNA polymerase domain protein [Shigella dysenteriae 1617]
 gi|308927528|gb|EFP73000.1| DNA polymerase domain protein [Shigella dysenteriae 1617]
          Length = 66

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/44 (63%), Positives = 35/44 (79%)

Query: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF 402
           L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF
Sbjct: 3   LTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAF 46


>gi|293192693|ref|ZP_06609647.1| DNA polymerase I [Actinomyces odontolyticus F0309]
 gi|292820200|gb|EFF79197.1| DNA polymerase I [Actinomyces odontolyticus F0309]
          Length = 908

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 75/151 (49%), Gaps = 26/151 (17%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           +++LS  V+SDGR+  T     A+ TGR +      QN+P +                  
Sbjct: 620 VDSLSATVASDGRIHTTFSQVAAA-TGRLASSDPNLQNIPARS----------------- 661

Query: 352 TIADPLGLASDCVRSCIIASNG-KKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYV 410
             AD +      +R   +A  G + L+ AD + IE R++A ++G++  I+AF +GED++ 
Sbjct: 662 --ADGM-----RIRGAFVAGEGFESLMSADYSQIEMRLMAHLSGDEALIEAFNSGEDLHR 714

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           T  +  F TP+ +VS E+R+  K     L Y
Sbjct: 715 TMASMVFGTPVAEVSAEERSRIKATSYGLAY 745


>gi|307245312|ref|ZP_07527400.1| hypothetical protein appser1_5170 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306853653|gb|EFM85870.1| hypothetical protein appser1_5170 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
          Length = 957

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K+V AD + IE R++A +A ++  I AFA G+DI+  T A+ F   +D+
Sbjct: 719 IRQAFIARDGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQ 778

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 779 VTSEQRRSAKAINFGLIY 796


>gi|325981763|ref|YP_004294165.1| DNA polymerase I [Nitrosomonas sp. AL212]
 gi|325531282|gb|ADZ26003.1| DNA polymerase I [Nitrosomonas sp. AL212]
          Length = 916

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 56/95 (58%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G +++ AD + IE R++A I+ ++  +KAFA GEDI+  T A+    P+++
Sbjct: 677 IREAFIAPAGYRIISADYSQIELRIMAHISQDEGLLKAFAAGEDIHSATAAEILGIPLNQ 736

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           V +EQR   KV+   L Y  G   F  +A+  G++
Sbjct: 737 VDQEQRRHAKVINFGLIY--GMSEF-GLATQLGIE 768


>gi|254248787|ref|ZP_04942107.1| DNA polymerase A [Burkholderia cenocepacia PC184]
 gi|124875288|gb|EAY65278.1| DNA polymerase A [Burkholderia cenocepacia PC184]
          Length = 920

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 84/172 (48%), Gaps = 31/172 (18%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G ++V AD + IE R++A I+G+   ++AF+ GEDI+  T A+ F     +
Sbjct: 681 IREAFIASPGHRIVSADYSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLE 740

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ +QR I KV+   L Y  G   F  +AS+ G+                  + Q+ ++ 
Sbjct: 741 VNSDQRRIAKVINFGLIY--GMSAFG-LASNLGITRDAAKLYIDRYFARYPGVAQYMEDT 797

Query: 467 KSTSTFEDW-EQAESHHLWMQD---------QYPE-FAVKDKLIGTACELVK 507
           ++T+  + + E      LW+ +         Q  E  A+   + GTA +L+K
Sbjct: 798 RATAKEKGYVETVFGRRLWLPEINGGNGPRRQAAERAAINAPMQGTAADLIK 849


>gi|154508852|ref|ZP_02044494.1| hypothetical protein ACTODO_01362 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798486|gb|EDN80906.1| hypothetical protein ACTODO_01362 [Actinomyces odontolyticus ATCC
           17982]
          Length = 889

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 75/151 (49%), Gaps = 26/151 (17%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           +++LS  V+SDGR+  T     A+ TGR +      QN+P +                  
Sbjct: 601 VDSLSATVASDGRIHTTFSQVAAA-TGRLASSDPNLQNIPARS----------------- 642

Query: 352 TIADPLGLASDCVRSCIIASNG-KKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYV 410
             AD +      +R   +A  G + L+ AD + IE R++A ++G++  I+AF +GED++ 
Sbjct: 643 --ADGM-----RIRGAFVAGEGFESLMSADYSQIEMRLMAHLSGDEALIEAFNSGEDLHR 695

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           T  +  F TP+ +VS E+R+  K     L Y
Sbjct: 696 TMASMVFGTPVAEVSAEERSRIKATSYGLAY 726


>gi|113868699|ref|YP_727188.1| DNA polymerase I [Ralstonia eutropha H16]
 gi|113527475|emb|CAJ93820.1| DNA polymerase I [Ralstonia eutropha H16]
          Length = 938

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 54/95 (56%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A I+G++  ++AFANGEDI+  T  + F    + 
Sbjct: 699 IREAFIAEPGSVIVSADYSQIELRIMAHISGDENLLRAFANGEDIHRATAGEIFGVEREA 758

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           VS EQR   KV+   L Y  G   F  +A + G++
Sbjct: 759 VSSEQRRYAKVINFGLIY--GMSAFG-LAGNLGIE 790


>gi|30249439|ref|NP_841509.1| polA; DNA polymerase I protein [Nitrosomonas europaea ATCC 19718]
 gi|30138802|emb|CAD85379.1| polA; DNA polymerase I protein [Nitrosomonas europaea ATCC 19718]
          Length = 912

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 56/95 (58%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G  ++ AD + IE R++A I+G+   I AF+ G+DI+  T A+ F  P+++
Sbjct: 673 IREAFIAPDGWLIMSADYSQIELRIMAHISGDAGLIHAFSEGQDIHRATAAEVFGVPVEQ 732

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           V+ EQR   KV+   L Y  G   F  +A+  G++
Sbjct: 733 VNPEQRRYAKVINFGLIY--GMSEF-GLATQLGIE 764


>gi|149378378|ref|ZP_01896080.1| DNA polymerase I [Marinobacter algicola DG893]
 gi|149357343|gb|EDM45863.1| DNA polymerase I [Marinobacter algicola DG893]
          Length = 911

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 77/179 (43%), Gaps = 33/179 (18%)

Query: 270 ITQLAKDLILNRLASSGSAILKL-----NTLSEAVSS-DGRLRGTLQFYGASRTGRWSGC 323
           + +LA +  L RL     ++ KL     +TL E +    GR+  T      + TGR S  
Sbjct: 596 LQELAHEHTLPRLILEHRSLSKLKSTYTDTLPELIHHRTGRIH-TSYHQAVTATGRLSSS 654

Query: 324 VFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLA 382
               QN+P R E+   I                         R   +A  G KLV AD +
Sbjct: 655 EPNLQNIPIRSEQGRRI-------------------------RQAFVAPEGYKLVAADYS 689

Query: 383 GIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            IE R++A ++G+   + AF  GEDI+  T A+ F   +D VS +QR   K +   L Y
Sbjct: 690 QIELRIMAHLSGDKGLLTAFEKGEDIHRATAAEVFGVAVDDVSGDQRRSAKAINFGLIY 748


>gi|313669194|ref|YP_004049478.1| DNA polymerase I [Neisseria lactamica ST-640]
 gi|313006656|emb|CBN88122.1| DNA polymerase I [Neisseria lactamica 020-06]
          Length = 932

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 103/244 (42%), Gaps = 36/244 (14%)

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTY------ALRMYLFLITGIDLVDMSEGTLKSILS 266
           +A++  +L  ++VKL      ++ Q +       L+  LF   GI    + +     I +
Sbjct: 552 LARQSAELGAELVKLEQEAYAAAGQPFNLNSPKQLQEILFDKMGIPTKGLKKTAKGGIST 611

Query: 267 HSNI-TQLAKDLILNRLASSGSAILKLNT-----LSEAVSSDGRLRGTLQFYGASRTGRW 320
           + ++  QLA D  L ++     ++ KL +     L E +S   +   T      + TGR 
Sbjct: 612 NEDVLEQLAPDYPLPKIILKNRSLAKLKSTYTDKLPEMISPRDKRVHTTYAQAVAITGRL 671

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVAD 380
           +G     QN+P   R+EE                         VR    A  G  +V AD
Sbjct: 672 AGNNPNLQNIPI--RTEE----------------------GRKVRRAFTAPPGSVIVSAD 707

Query: 381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
            + IE R++A ++G+   I AF NGED++  T A+ F    + VS EQR   K +   L 
Sbjct: 708 YSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPENVSSEQRRYAKTINFGLI 767

Query: 441 YQGG 444
           Y  G
Sbjct: 768 YGMG 771


>gi|261401773|ref|ZP_05987898.1| DNA polymerase I [Neisseria lactamica ATCC 23970]
 gi|269208086|gb|EEZ74541.1| DNA polymerase I [Neisseria lactamica ATCC 23970]
          Length = 939

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 103/244 (42%), Gaps = 36/244 (14%)

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTY------ALRMYLFLITGIDLVDMSEGTLKSILS 266
           +A++  +L  ++VKL      ++ Q +       L+  LF   GI    + +     I +
Sbjct: 552 LARQSAELGAELVKLEQEAYAAAGQPFNLNSPKQLQEILFDKMGIPTKGLKKTAKGGIST 611

Query: 267 HSNI-TQLAKDLILNRLASSGSAILKLNT-----LSEAVSSDGRLRGTLQFYGASRTGRW 320
           + ++  QLA D  L ++     ++ KL +     L E +S   +   T      + TGR 
Sbjct: 612 NEDVLEQLAPDYPLPKIILKNRSLAKLKSTYTDKLPEMISPRDKRVHTTYAQAVAITGRL 671

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVAD 380
           +G     QN+P   R+EE                         VR    A  G  +V AD
Sbjct: 672 AGNNPNLQNIPI--RTEE----------------------GRKVRRAFTAPPGSVIVSAD 707

Query: 381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
            + IE R++A ++G+   I AF NGED++  T A+ F    + VS EQR   K +   L 
Sbjct: 708 YSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPENVSSEQRRYAKTINFGLI 767

Query: 441 YQGG 444
           Y  G
Sbjct: 768 YGMG 771


>gi|107026837|ref|YP_624348.1| DNA polymerase I [Burkholderia cenocepacia AU 1054]
 gi|116691969|ref|YP_837502.1| DNA polymerase I [Burkholderia cenocepacia HI2424]
 gi|170736037|ref|YP_001777297.1| DNA polymerase I [Burkholderia cenocepacia MC0-3]
 gi|105896211|gb|ABF79375.1| DNA polymerase I [Burkholderia cenocepacia AU 1054]
 gi|116649969|gb|ABK10609.1| DNA polymerase I [Burkholderia cenocepacia HI2424]
 gi|169818225|gb|ACA92807.1| DNA polymerase I [Burkholderia cenocepacia MC0-3]
          Length = 917

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 84/172 (48%), Gaps = 31/172 (18%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G ++V AD + IE R++A I+G+   ++AF+ GEDI+  T A+ F     +
Sbjct: 678 IREAFIASPGHRIVSADYSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLE 737

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ +QR I KV+   L Y  G   F  +AS+ G+                  + Q+ ++ 
Sbjct: 738 VNSDQRRIAKVINFGLIY--GMSAFG-LASNLGITRDAAKLYIDRYFARYPGVAQYMEDT 794

Query: 467 KSTSTFEDW-EQAESHHLWMQD---------QYPE-FAVKDKLIGTACELVK 507
           ++T+  + + E      LW+ +         Q  E  A+   + GTA +L+K
Sbjct: 795 RATAKEKGYVETVFGRRLWLPEINGGNGPRRQAAERAAINAPMQGTAADLIK 846


>gi|261823708|ref|YP_003261814.1| DNA polymerase I [Pectobacterium wasabiae WPP163]
 gi|261607721|gb|ACX90207.1| DNA polymerase I [Pectobacterium wasabiae WPP163]
          Length = 929

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G++  + AFANG DI+  T ++ F   +DK
Sbjct: 690 IRQAFIAPKGYSIVAADYSQIELRIMAHLSGDEGLLNAFANGLDIHRATASEVFGIALDK 749

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 750 VTSEQRRSAKAINFGLIY 767


>gi|256379536|ref|YP_003103196.1| DNA polymerase I [Actinosynnema mirum DSM 43827]
 gi|255923839|gb|ACU39350.1| DNA polymerase I [Actinosynnema mirum DSM 43827]
          Length = 888

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 84/181 (46%), Gaps = 39/181 (21%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H ++T         RL ++   +LK      AV+ DGR+  T     A+ TGR 
Sbjct: 584 LQHLLAHRDVT---------RLKTTVDGLLK------AVADDGRIHTTFHQTIAA-TGRL 627

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVAD 380
           S      QN+P       I T   + +  G                 ++     +L+ AD
Sbjct: 628 SSTDPNLQNIP-------IRTDEGRRIREG----------------FVVGPGYAELMTAD 664

Query: 381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
            + IE R++A ++G++  I+AF +GED++    +KAF+ P  +V+ EQR   K M   L 
Sbjct: 665 YSQIEMRIMAHLSGDEGLIEAFRSGEDLHTFVASKAFSVPTGEVTAEQRRRVKAMSYGLA 724

Query: 441 Y 441
           Y
Sbjct: 725 Y 725


>gi|255020063|ref|ZP_05292135.1| DNA polymerase I [Acidithiobacillus caldus ATCC 51756]
 gi|254970490|gb|EET27980.1| DNA polymerase I [Acidithiobacillus caldus ATCC 51756]
          Length = 894

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 112/256 (43%), Gaps = 45/256 (17%)

Query: 198 GYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYAL------RMYLFLITGI 251
           G RID+D++ +L E       +LD  +  +      ++ Q + L      +  LF   G+
Sbjct: 508 GVRIDVDVLKRLSE-------ELDTRMATVESEAFAAAGQRFNLNSPKQIQTILFDKMGL 560

Query: 252 DLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL-NTLSEAVSS-----DGRL 305
            ++  + G   S  +   + +LAK   L RL      + KL NT ++A+        GR+
Sbjct: 561 PVLKKTPGGQPST-NEDVLAELAKQADLPRLILDYRGLAKLKNTYADALPQMIQERTGRV 619

Query: 306 RGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVR 365
             T      + TGR S      QN+P   RS+         L R              +R
Sbjct: 620 H-THYHQAVAATGRLSSSDPNLQNIP--VRSD---------LGR-------------RIR 654

Query: 366 SCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVS 425
              +A  G  L+ AD + IE R++A ++G+    +AFA G DI+  T A+ F  P+++V+
Sbjct: 655 QAFVAEPGHLLISADYSQIELRIMAHLSGDAGLRQAFARGLDIHRATAAEVFAIPLEQVT 714

Query: 426 KEQRAIGKVMELALGY 441
            EQR   K +   L Y
Sbjct: 715 PEQRRAAKAINFGLIY 730


>gi|282891035|ref|ZP_06299540.1| hypothetical protein pah_c045o043 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499028|gb|EFB41342.1| hypothetical protein pah_c045o043 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 896

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 134/323 (41%), Gaps = 48/323 (14%)

Query: 161 EYCKRDVEATRELFKRLIPLSDGERDLWLLDQTIN-----------DRGYRIDLDLVLKL 209
           EYC  DV+ T  L K ++     ERDL  L   I             RG  +D+  + +L
Sbjct: 466 EYCCEDVDFTCRL-KEVLEKQLKERDLLNLYHQIELPLLVVLAKMERRGIYVDIPYLEQL 524

Query: 210 QELIAQERKKLDEDIVKLT--DGIIRSSRQTYALRMYLFLITGIDLVDMS---EGTLKSI 264
            + + QE K L E I  +   +  + S +Q   L   LF+  GI     +     T   +
Sbjct: 525 SKELTQELKTLQESIYTMAGEEFNLNSPKQVSEL---LFIKLGIPAPKKTATGHSTSAEV 581

Query: 265 LSH-SNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGC 323
           L    N   LA  ++  RL     +       S+ +    R+  T      + TGR S  
Sbjct: 582 LEFLKNDYPLAGKILEYRLLEKLRSTYVDALPSQVIPRTHRIHSTFN-QSVAATGRLSSQ 640

Query: 324 VFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAG 383
               QN+P   R+EE   + I+   R E                     G   + AD + 
Sbjct: 641 DPNLQNIPI--RTEE--GRKIRGAFRPE-------------------KEGWSFLSADYSQ 677

Query: 384 IEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQG 443
           IE R+LA ++ +   + AF N EDI+  T A  F  P+++VSKEQR   K +   + Y  
Sbjct: 678 IELRLLAHLSQDPVLMAAFQNNEDIHTYTAASMFEIPLEQVSKEQRYQAKAINFGIIY-- 735

Query: 444 GAKVFKTMASHCGLDLQQFSQNV 466
           G + F  +A   G++++Q S+ +
Sbjct: 736 GQQAF-GLARELGIEVKQASKFI 757


>gi|309378893|emb|CBX22480.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 939

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 103/244 (42%), Gaps = 36/244 (14%)

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTY------ALRMYLFLITGIDLVDMSEGTLKSILS 266
           +A++  +L  ++VKL      ++ Q +       L+  LF   GI    + +     I +
Sbjct: 552 LARQSAELGAELVKLEQEAYAAAGQPFNLNSPKQLQEILFDKMGIPTKGLKKTAKGGIST 611

Query: 267 HSNI-TQLAKDLILNRLASSGSAILKLNT-----LSEAVSSDGRLRGTLQFYGASRTGRW 320
           + ++  QLA D  L ++     ++ KL +     L E +S   +   T      + TGR 
Sbjct: 612 NEDVLEQLAPDYPLPKIILKNRSLAKLKSTYTDKLPEMISPRDKRVHTTYAQAVAITGRL 671

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVAD 380
           +G     QN+P   R+EE                         VR    A  G  +V AD
Sbjct: 672 AGNNPNLQNIPI--RTEE----------------------GRKVRRAFTAPPGSVIVSAD 707

Query: 381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
            + IE R++A ++G+   I AF NGED++  T A+ F    + VS EQR   K +   L 
Sbjct: 708 YSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPENVSPEQRRYAKTINFGLI 767

Query: 441 YQGG 444
           Y  G
Sbjct: 768 YGMG 771


>gi|159896602|ref|YP_001542849.1| DNA polymerase I [Herpetosiphon aurantiacus ATCC 23779]
 gi|159889641|gb|ABX02721.1| DNA polymerase I [Herpetosiphon aurantiacus ATCC 23779]
          Length = 953

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 81/184 (44%), Gaps = 30/184 (16%)

Query: 260 TLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSD-GRLRGTLQFYGASRTG 318
           TL+ + +H     +A  L   RL+   S  +  + L E ++   GR+    +  GA  TG
Sbjct: 627 TLEDLQTHDQSGIVAMILRYRRLSKLKSTYV--DALIELINQQTGRVHTQYRQIGAE-TG 683

Query: 319 RWSGCVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLV 377
           R S      QN+P R E   EI                         R   +A  G  L+
Sbjct: 684 RLSSDSPNLQNIPVRSEEGREI-------------------------RRAFVARPGHVLM 718

Query: 378 VADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMEL 437
            AD + IE RVLA I  +   ++ F  G+DI+  T A+ F+ P+D+VSK QR I K+   
Sbjct: 719 TADYSQIELRVLAHITADPALVEVFKTGQDIHAATAARLFDIPMDEVSKNQRRIAKMTVF 778

Query: 438 ALGY 441
            + Y
Sbjct: 779 GIIY 782


>gi|254447582|ref|ZP_05061048.1| DNA polymerase I [gamma proteobacterium HTCC5015]
 gi|198262925|gb|EDY87204.1| DNA polymerase I [gamma proteobacterium HTCC5015]
          Length = 900

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K++ AD + IE R++A ++G++  I+AF  G DI+  T ++ F  P+D+
Sbjct: 661 IREAFVAEPGHKILAADYSQIELRIMAHLSGDETLIRAFKEGRDIHQATASEVFGVPLDE 720

Query: 424 VSKEQRAIGKVMELALGY 441
           V  EQR   K +   L Y
Sbjct: 721 VESEQRRRAKAVNFGLIY 738


>gi|124266340|ref|YP_001020344.1| DNA-directed DNA polymerase [Methylibium petroleiphilum PM1]
 gi|124259115|gb|ABM94109.1| DNA-directed DNA polymerase [Methylibium petroleiphilum PM1]
          Length = 937

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           VR   IA  G  ++ AD + IE R++A I+ +   +KAFA G D++  T ++ FN P+ +
Sbjct: 698 VREAFIAPPGHVILSADYSQIELRIMAHISEDPGLLKAFAEGLDVHRATASEVFNVPVAE 757

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           VS EQR   KV+   L Y  GA     +AS+ G++
Sbjct: 758 VSSEQRRYAKVINFGLIYGMGA---FGLASNLGIE 789


>gi|238923922|ref|YP_002937438.1| DNA polymerase I [Eubacterium rectale ATCC 33656]
 gi|238875597|gb|ACR75304.1| DNA polymerase I [Eubacterium rectale ATCC 33656]
          Length = 903

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 69/147 (46%), Gaps = 25/147 (17%)

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIA 354
           LS  ++SDG++  TL     + TGR S      QN+P                     I 
Sbjct: 620 LSGYIASDGKIHTTLN-QTITATGRLSSTEPNLQNIP---------------------IR 657

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYA 414
             LG     +R   +   G   V +D + IE RVLA ++G++  I+AF NG+DI+ +T +
Sbjct: 658 IELG---KLIRKVFLPEEGDLFVDSDYSQIELRVLAALSGDERMIEAFKNGQDIHRSTAS 714

Query: 415 KAFNTPIDKVSKEQRAIGKVMELALGY 441
             F+TP D+V+  QR   K +   + Y
Sbjct: 715 LVFDTPFDEVTDLQRRNAKAVNFGIVY 741


>gi|78063065|ref|YP_372973.1| DNA polymerase I [Burkholderia sp. 383]
 gi|77970950|gb|ABB12329.1| DNA polymerase A [Burkholderia sp. 383]
          Length = 917

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G ++V AD + IE R++A I+G+   ++AF+ GEDI+  T A+ F     +
Sbjct: 678 IREAFIASPGHRIVSADYSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLE 737

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 738 VNSDQRRIAKVINFGLIY--GMSAFG-LASNLGI 768


>gi|291525363|emb|CBK90950.1| DNA polymerase I [Eubacterium rectale DSM 17629]
 gi|291527050|emb|CBK92636.1| DNA polymerase I [Eubacterium rectale M104/1]
          Length = 903

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 69/147 (46%), Gaps = 25/147 (17%)

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIA 354
           LS  ++SDG++  TL     + TGR S      QN+P                     I 
Sbjct: 620 LSGYIASDGKIHTTLN-QTITATGRLSSTEPNLQNIP---------------------IR 657

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYA 414
             LG     +R   +   G   V +D + IE RVLA ++G++  I+AF NG+DI+ +T +
Sbjct: 658 IELG---KLIRKVFLPEEGDLFVDSDYSQIELRVLAALSGDERMIEAFKNGQDIHRSTAS 714

Query: 415 KAFNTPIDKVSKEQRAIGKVMELALGY 441
             F+TP D+V+  QR   K +   + Y
Sbjct: 715 LVFDTPFDEVTDLQRRNAKAVNFGIVY 741


>gi|261866908|ref|YP_003254830.1| DNA polymerase I [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412240|gb|ACX81611.1| DNA polymerase I (POL I) [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 933

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K++ AD + IE R++A ++ +   I AFA G+DI+ +T A+ F  P+++
Sbjct: 695 IRQAFIARDGYKIIAADYSQIELRIMAHLSNDQGLINAFAQGKDIHRSTAAEIFGLPLEQ 754

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 755 VTSEQRRNAKAINFGLIY 772


>gi|171464028|ref|YP_001798141.1| DNA polymerase I [Polynucleobacter necessarius subsp. necessarius
           STIR1]
 gi|171193566|gb|ACB44527.1| DNA polymerase I [Polynucleobacter necessarius subsp. necessarius
           STIR1]
          Length = 942

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   I + G KL+ AD + IE R++A IA ++  + AF +G+D++  T A+ F  P+D 
Sbjct: 703 IREAFIPAEGCKLLSADYSQIELRIMAHIAEDENLLTAFRDGKDVHQATAAEIFGVPLDD 762

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           VS EQR   KV+   L Y  G   F  +A + G++
Sbjct: 763 VSSEQRRYAKVINFGLIY--GMSAF-GLAGNLGIE 794


>gi|82701702|ref|YP_411268.1| DNA polymerase I [Nitrosospira multiformis ATCC 25196]
 gi|82409767|gb|ABB73876.1| DNA polymerase I [Nitrosospira multiformis ATCC 25196]
          Length = 905

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 56/95 (58%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G +++ AD + IE R++A I+ +   +KAFA GEDI+  T ++ F  P++ 
Sbjct: 666 IREAFIAPSGYRIISADYSQIELRIMAHISQDAGLLKAFAQGEDIHRATGSEIFGVPLET 725

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           V+ EQR   K++   L Y  G   F  +A+  G++
Sbjct: 726 VNSEQRRYAKIINFGLIY--GMSEFG-LATQLGIE 757


>gi|325521672|gb|EGD00436.1| DNA polymerase I [Burkholderia sp. TJI49]
          Length = 641

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G ++V AD + IE R++A I+G+   ++AF+ GEDI+  T A+ F     +
Sbjct: 402 IREAFIASPGHRIVSADYSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLE 461

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 462 VNADQRRIAKVINFGLIY--GMSAFG-LASNLGI 492


>gi|171057747|ref|YP_001790096.1| DNA polymerase I [Leptothrix cholodnii SP-6]
 gi|170775192|gb|ACB33331.1| DNA polymerase I [Leptothrix cholodnii SP-6]
          Length = 934

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           VR   +A+ G KLV AD + IE R++A I+G+   +KAFA+G D++  T A+ FN     
Sbjct: 695 VREAFVAAPGHKLVSADYSQIELRLMAHISGDANLLKAFADGMDVHRATAAEVFNIAAAD 754

Query: 424 VSKEQRAIGKVMELALGYQGGA 445
           V+ EQR   K +   L Y  GA
Sbjct: 755 VTSEQRRYAKTINFGLIYGMGA 776


>gi|145224148|ref|YP_001134826.1| DNA polymerase I [Mycobacterium gilvum PYR-GCK]
 gi|145216634|gb|ABP46038.1| DNA polymerase I [Mycobacterium gilvum PYR-GCK]
          Length = 908

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 97/222 (43%), Gaps = 56/222 (25%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H + T+L                + ++ L  AV+SDGR+  T     A+ TGR 
Sbjct: 604 LQHLLAHRDATRLK---------------VTVDGLLNAVASDGRIHTTFNQTIAA-TGRL 647

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG-KKLVVA 379
           S      QN+P       I T+                 A   +R   +  +G  +L+ A
Sbjct: 648 SSTEPNLQNIP-------IRTE-----------------AGRRIRDAFVVGDGYGELMTA 683

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++ ++  I+AF  GED++    ++AF+ PID+V+ E R   K M   L
Sbjct: 684 DYSQIEMRIMAHLSRDEGLIEAFNTGEDLHSFVASRAFSVPIDEVTAELRRRVKAMSYGL 743

Query: 440 GYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
            Y              GL     SQ +K  ST E  EQ E +
Sbjct: 744 AY--------------GLSAYGLSQQLK-ISTEEAKEQMEQY 770


>gi|315444483|ref|YP_004077362.1| DNA polymerase I [Mycobacterium sp. Spyr1]
 gi|315262786|gb|ADT99527.1| DNA polymerase I [Mycobacterium sp. Spyr1]
          Length = 908

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 97/222 (43%), Gaps = 56/222 (25%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H + T+L                + ++ L  AV+SDGR+  T     A+ TGR 
Sbjct: 604 LQHLLAHRDATRLK---------------VTVDGLLNAVASDGRIHTTFNQTIAA-TGRL 647

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG-KKLVVA 379
           S      QN+P       I T+                 A   +R   +  +G  +L+ A
Sbjct: 648 SSTEPNLQNIP-------IRTE-----------------AGRRIRDAFVVGDGYGELMTA 683

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++ ++  I+AF  GED++    ++AF+ PID+V+ E R   K M   L
Sbjct: 684 DYSQIEMRIMAHLSRDEGLIEAFNTGEDLHSFVASRAFSVPIDEVTAELRRRVKAMSYGL 743

Query: 440 GYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
            Y              GL     SQ +K  ST E  EQ E +
Sbjct: 744 AY--------------GLSAYGLSQQLK-ISTEEAKEQMEQY 770


>gi|326318033|ref|YP_004235705.1| DNA polymerase I [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323374869|gb|ADX47138.1| DNA polymerase I [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 927

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 82/177 (46%), Gaps = 31/177 (17%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           VR   +A  G+ +  AD + IE R++A ++G+D  ++AF  G D++  T A+ F   +D+
Sbjct: 688 VREAFVAPPGRVIASADYSQIELRIMAHLSGDDALLRAFTEGLDVHRATAAEVFGVAVDQ 747

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD-------LQQFSQNVKSTSTFEDWE 476
           VS EQR   KV+   L Y  G   F  +A + G+D       + ++ Q       + D  
Sbjct: 748 VSSEQRRYAKVINFGLIY--GMSSFG-LARNLGIDNKAAAAYIDRYFQRYPGVKQYMDET 804

Query: 477 QAES------HHLWMQDQY-PEF--------------AVKDKLIGTACELVKKAWRA 512
           +A +        ++ +  Y PE               A+   + GTA +L+KKA  A
Sbjct: 805 KASAKARGYVETVFGRRLYLPEINSPNGPRRGAAERAAINAPMQGTAADLIKKAMVA 861


>gi|210623711|ref|ZP_03293995.1| hypothetical protein CLOHIR_01946 [Clostridium hiranonis DSM 13275]
 gi|210153399|gb|EEA84405.1| hypothetical protein CLOHIR_01946 [Clostridium hiranonis DSM 13275]
          Length = 891

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 76/160 (47%), Gaps = 33/160 (20%)

Query: 289 ILKLN-TLSEAVSS-----DGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILT 341
           I+KLN T  E +++     DGR+  T      + TGR S      QN+P R E    +  
Sbjct: 596 IVKLNSTYVEGLTALINPIDGRIHSTFN-QTITTTGRISSTEPNLQNIPVRMEIGRRL-- 652

Query: 342 QTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKA 401
                                  R+  ++ + K+LV AD + +E RVLA ++G+   I A
Sbjct: 653 -----------------------RAVFVSDDEKRLVDADYSQVELRVLAHMSGDQNMIDA 689

Query: 402 FANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           F +GEDI+  T ++ FN P+++V+ E R+  K +   + Y
Sbjct: 690 FKHGEDIHRKTASQVFNVPVEEVTSELRSAAKAVNFGIIY 729


>gi|120610610|ref|YP_970288.1| DNA polymerase I [Acidovorax citrulli AAC00-1]
 gi|120589074|gb|ABM32514.1| DNA polymerase I [Acidovorax citrulli AAC00-1]
          Length = 927

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 54/95 (56%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           VR   +A  G+ +  AD + IE R++A ++G+D  ++AF  G D++  T A+ F   +D+
Sbjct: 688 VREAFVAPPGRVIASADYSQIELRIMAHLSGDDALLRAFTEGLDVHRATAAEVFGVAVDQ 747

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           VS EQR   KV+   L Y  G   F  +A + G+D
Sbjct: 748 VSSEQRRYAKVINFGLIY--GMSSFG-LARNLGID 779


>gi|325954851|ref|YP_004238511.1| DNA polymerase I [Weeksella virosa DSM 16922]
 gi|323437469|gb|ADX67933.1| DNA polymerase I [Weeksella virosa DSM 16922]
          Length = 941

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query: 331 PRQERSEEILTQTIQALNRGETIADPL------GLASDCVRSCIIASNGK-KLVVADLAG 383
           P  +R      QT+ A  R  ++   L            +R   IA N + K++ AD + 
Sbjct: 663 PVTQRVHTTFAQTVAATGRLSSVNPNLQNIPIRTEEGQQIRKAFIARNPEYKIISADYSQ 722

Query: 384 IEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQG 443
           IE R++A +A +   +KAF +GEDI+ +T AK F   +D+V++EQR+  K +   + Y  
Sbjct: 723 IELRLIAQMAQDPVMVKAFQDGEDIHASTAAKIFGVALDEVTREQRSQAKTVNFGIIY-- 780

Query: 444 GAKVFKTMASHCGL 457
           G   F  +A   GL
Sbjct: 781 GVSAF-GLAQQTGL 793


>gi|91777303|ref|YP_552511.1| DNA polymerase I [Burkholderia xenovorans LB400]
 gi|91689963|gb|ABE33161.1| DNA polymerase A [Burkholderia xenovorans LB400]
          Length = 913

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G KLV AD + IE R++A I+G++  + +F+ GEDI+  T A+ F+    +
Sbjct: 674 IREAFIAPAGHKLVSADYSQIELRIMAHISGDESLLHSFSQGEDIHRATAAEIFSVTPLE 733

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           VS +QR + KV+   L Y  G   F  +AS+ G+
Sbjct: 734 VSNDQRRVAKVINFGLIY--GMSSFG-LASNLGI 764


>gi|326793522|ref|YP_004311342.1| DNA polymerase I [Marinomonas mediterranea MMB-1]
 gi|326544286|gb|ADZ89506.1| DNA polymerase I [Marinomonas mediterranea MMB-1]
          Length = 919

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 78/177 (44%), Gaps = 30/177 (16%)

Query: 270 ITQLAKDLILNRLASSGSAILKLNT-----LSEAVSSDGRLRGTLQFYGASRTGRWSGCV 324
           + +LA++  L RL     ++ KL +     L E +   GR+  T      + TGR S   
Sbjct: 606 LQELAENYELPRLIMEHRSLAKLKSTYTDKLPEMIQHTGRIH-TSYHQAVTATGRLSSTD 664

Query: 325 FQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGI 384
              QN+P       I TQ       G  I           R   +A  G KLV AD + I
Sbjct: 665 PNLQNIP-------IRTQ------EGRRI-----------RQAFVAPEGHKLVAADYSQI 700

Query: 385 EARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           E R++A ++ +   + AFA+ ED++  T A+ F   +D V+ EQR   K +   L Y
Sbjct: 701 ELRIMAHLSQDKGLLDAFAHDEDVHKATAAEVFEVAVDDVTAEQRRRAKAINFGLIY 757


>gi|325143690|gb|EGC66009.1| DNA polymerase I [Neisseria meningitidis M01-240013]
          Length = 983

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 105/245 (42%), Gaps = 38/245 (15%)

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTY------ALRMYLFLITGIDLVDMSEGTLKSILS 266
           +A++  +L  +++KL      ++ Q +       L+  LF   GI    + +     I +
Sbjct: 596 LARQSAELGAELMKLEQEAYAAAGQPFNLNSPKQLQEILFDKMGIPTKGLKKTAKGGIST 655

Query: 267 HSNI-TQLAKDLILNRLASSGSAILKLNT-----LSEAVSS-DGRLRGTLQFYGASRTGR 319
           +  +  QLA D  L ++     ++ KL +     L E +S  DGR+  T      + TGR
Sbjct: 656 NEAVLEQLAPDYPLPKIILQNRSLAKLKSTYTDKLPEMISPKDGRVHTTYA-QAVAITGR 714

Query: 320 WSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVA 379
            +      QN+P   R+EE                         VR    A  G  +V A
Sbjct: 715 LASNNPNLQNIPI--RTEE----------------------GRKVRRAFTAPQGSVIVSA 750

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++G+   I AF NGED++  T A+ F T  + VS EQR   K +   L
Sbjct: 751 DYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSSEQRRYAKTINFGL 810

Query: 440 GYQGG 444
            Y  G
Sbjct: 811 IYGMG 815


>gi|251793585|ref|YP_003008314.1| DNA polymerase I [Aggregatibacter aphrophilus NJ8700]
 gi|247534981|gb|ACS98227.1| DNA polymerase I (POL I) [Aggregatibacter aphrophilus NJ8700]
          Length = 985

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K++ AD + IE R++A ++ +   I AFA G+DI+ +T A+ F  P+++
Sbjct: 747 IRQAFIARDGYKIIAADYSQIELRIMAHLSNDAGLINAFAQGKDIHRSTAAELFGLPLEQ 806

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 807 VTSEQRRNAKAINFGLIY 824


>gi|315633357|ref|ZP_07888648.1| DNA-directed DNA polymerase I [Aggregatibacter segnis ATCC 33393]
 gi|315477857|gb|EFU68598.1| DNA-directed DNA polymerase I [Aggregatibacter segnis ATCC 33393]
          Length = 950

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K++ AD + IE R++A ++ +   I AFA G+DI+ +T A+ F  P+++
Sbjct: 712 IRQAFIARDGYKIIAADYSQIELRIMAHLSNDAGLINAFAQGKDIHRSTAAEIFGLPLEQ 771

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 772 VTSEQRRNAKAINFGLIY 789


>gi|316985617|gb|EFV64564.1| DNA polymerase I [Neisseria meningitidis H44/76]
 gi|325139302|gb|EGC61843.1| DNA polymerase I [Neisseria meningitidis CU385]
          Length = 983

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 105/245 (42%), Gaps = 38/245 (15%)

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTY------ALRMYLFLITGIDLVDMSEGTLKSILS 266
           +A++  +L  +++KL      ++ Q +       L+  LF   GI    + +     I +
Sbjct: 596 LARQSAELGAELMKLEQEAYAAAGQPFNLNSPKQLQEILFDKMGIPTKGLKKTAKGGIST 655

Query: 267 HSNI-TQLAKDLILNRLASSGSAILKLNT-----LSEAVSS-DGRLRGTLQFYGASRTGR 319
           +  +  QLA D  L ++     ++ KL +     L E +S  DGR+  T      + TGR
Sbjct: 656 NEAVLEQLAPDYPLPKIILQNRSLAKLKSTYTDKLPEMISPKDGRVHTTYA-QAVAITGR 714

Query: 320 WSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVA 379
            +      QN+P   R+EE                         VR    A  G  +V A
Sbjct: 715 LASNNPNLQNIPI--RTEE----------------------GRKVRRAFTAPQGSVIVSA 750

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++G+   I AF NGED++  T A+ F T  + VS EQR   K +   L
Sbjct: 751 DYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSSEQRRYAKTINFGL 810

Query: 440 GYQGG 444
            Y  G
Sbjct: 811 IYGMG 815


>gi|167771297|ref|ZP_02443350.1| hypothetical protein ANACOL_02655 [Anaerotruncus colihominis DSM
           17241]
 gi|167666548|gb|EDS10678.1| hypothetical protein ANACOL_02655 [Anaerotruncus colihominis DSM
           17241]
          Length = 874

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 80/177 (45%), Gaps = 28/177 (15%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           ++ L + V  DGR+R T Q    +RTGR S      QN+P   R+EE             
Sbjct: 588 VDGLLKVVGPDGRVRSTFQ-QTETRTGRISSTEPNLQNIPI--RTEE------------- 631

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
                       +R    A  G KLV AD + IE RVLA +A +   I AF +GEDI+ T
Sbjct: 632 ---------GSRMRRFFTARPGWKLVDADYSQIELRVLADLADDQNMIAAFQSGEDIHAT 682

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKS 468
           T A+ F  P   V+   R+  K +   + Y  GA    +++   G+ + +    +KS
Sbjct: 683 TAAQVFGMPGGTVTPLMRSRAKAVNFGIVYGIGA---FSLSQDIGVTVSEADSYIKS 736


>gi|260060686|ref|YP_003193766.1| putative DNA polymerase I [Robiginitalea biformata HTCC2501]
 gi|88784816|gb|EAR15985.1| putative DNA polymerase I [Robiginitalea biformata HTCC2501]
          Length = 942

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 130/303 (42%), Gaps = 55/303 (18%)

Query: 153 VQAWQLFGEYCKRDVEATRELFKRL-IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQE 211
           +Q  QLFG   +     T ELFK + IPL     D+ L        G  +D   + KL  
Sbjct: 519 LQLAQLFGPELRE--AQTEELFKEIEIPLLRVLADMEL-------EGINLDTGFLEKLS- 568

Query: 212 LIAQERKKLDEDIVKLTDGIIRSSRQTYAL----RMYLFLITGIDLVDMSEGTLKSILSH 267
                  +L++DI  L   I  ++ + + +    ++   L   + LVD  + T     S 
Sbjct: 569 ------GELEKDIEGLVGKIYEAAGEEFNIGSPKQLGEILFDKMKLVDKPKKTRTGQYST 622

Query: 268 SN--ITQLAKDLILNRLASSGSAILKLNTL------SEAVSSDGRLRGTLQFYGASRTGR 319
           +   ++ LAK+  + ++      + KL +        +   S GR+  T      + TGR
Sbjct: 623 AEDVLSGLAKEHEIVQMVLDYRGLTKLKSTYVDALPQQVAPSTGRVH-TDYMQTVAATGR 681

Query: 320 WSGCVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVV 378
            S      QN+P R ER  +I                         ++ I  S   +L+ 
Sbjct: 682 LSSNNPNLQNIPIRTERGRQIR------------------------KAFIPRSPEYQLLA 717

Query: 379 ADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELA 438
           AD + IE R++A ++ ED  I++F  GEDI+  T A+ F  P+++V++EQR+  K +   
Sbjct: 718 ADYSQIELRIIAALSEEDTMIESFKRGEDIHAATAAQVFQVPLEEVTREQRSNAKTVNFG 777

Query: 439 LGY 441
           + Y
Sbjct: 778 IIY 780


>gi|297624586|ref|YP_003706020.1| DNA polymerase I [Truepera radiovictrix DSM 17093]
 gi|297165766|gb|ADI15477.1| DNA polymerase I [Truepera radiovictrix DSM 17093]
          Length = 867

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G  L+VAD + IE R+LA I GE+  ++ F  GEDI+  T A+ F  P + 
Sbjct: 630 IRRAFVADEGATLLVADYSQIELRILAHITGEEALVETFRRGEDIHRRTAAQIFGVPPEA 689

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ E R + KV+   + Y
Sbjct: 690 VTPEGRRVAKVINFGVLY 707


>gi|299532523|ref|ZP_07045913.1| DNA polymerase I [Comamonas testosteroni S44]
 gi|298719470|gb|EFI60437.1| DNA polymerase I [Comamonas testosteroni S44]
          Length = 937

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           VR   +A  GK +  AD + IE R++A ++G++  + AF NG D++  T A+ F   +D+
Sbjct: 698 VREAFVAPEGKLIASADYSQIELRIMAHLSGDEALLSAFKNGLDVHRATAAEVFGVSVDE 757

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   KV+   L Y
Sbjct: 758 VSSEQRRYAKVINFGLIY 775


>gi|291619508|ref|YP_003522250.1| PolA [Pantoea ananatis LMG 20103]
 gi|291154538|gb|ADD79122.1| PolA [Pantoea ananatis LMG 20103]
          Length = 928

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 79/174 (45%), Gaps = 25/174 (14%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G ++V AD + IE R++A ++ +   + AF+ GEDI+  T ++ F  P+ K
Sbjct: 688 IRQAFVAGKGNRIVAADYSQIELRIMAHLSQDKGLLDAFSQGEDIHRATASEVFGVPLSK 747

Query: 424 VSKEQRAIGKVMELALGY--------------QGGAKVFKTMASHCGLDLQQFSQNVKST 469
           V+ EQR   K +   L Y               G AK +  +       + ++ +N +  
Sbjct: 748 VTGEQRRSAKAINFGLIYGMSAFGLSRQLNIGAGEAKKYMDLYFERYPGVLRYMENTRQL 807

Query: 470 STFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAWRA 512
           +    + E  +   LW+ D     A++ K          + GTA +++K+A  A
Sbjct: 808 AASNGYVETLDGRRLWLPDIKSSNAIRRKAAERAAINAPMQGTAADIIKRAMIA 861


>gi|332044967|gb|EGI81160.1| DNA polymerase I [Lacinutrix algicola 5H-3-7-4]
          Length = 953

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 85/181 (46%), Gaps = 36/181 (19%)

Query: 270 ITQLAKD--LILNRLASSGSAILKLNTLSEAV-----SSDGRLRGTLQFYGASRTGRWSG 322
           ++ LAKD  +I N L   G A LK +T  +A+      S GR+  T      + TGR S 
Sbjct: 638 LSVLAKDHEIIRNILEYRGLAKLK-STYVDALPLQVEESTGRVH-TDYMQTVAATGRLSS 695

Query: 323 CVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGK-KLVVAD 380
                QN+P R ER  +                         VR   I  N    L+ AD
Sbjct: 696 NNPNLQNIPIRTERGRQ-------------------------VRKAFIPRNDDYTLLAAD 730

Query: 381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
            + IE R++A ++ E+  I+AF NGEDI+ +T +K F  PI++V++ QR+  K +   + 
Sbjct: 731 YSQIELRIIAALSKEETMIEAFKNGEDIHASTASKVFGVPIEEVTRAQRSNAKTVNFGII 790

Query: 441 Y 441
           Y
Sbjct: 791 Y 791


>gi|325206887|gb|ADZ02340.1| DNA polymerase I [Neisseria meningitidis M04-240196]
          Length = 938

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 105/245 (42%), Gaps = 38/245 (15%)

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTY------ALRMYLFLITGIDLVDMSEGTLKSILS 266
           +A++  +L  +++KL      ++ Q +       L+  LF   GI    + +     I +
Sbjct: 551 LARQSAELGAELMKLEQEAYAAAGQPFNLNSPKQLQEILFDKMGIPTKGLKKTAKGGIST 610

Query: 267 HSNI-TQLAKDLILNRLASSGSAILKLNT-----LSEAVS-SDGRLRGTLQFYGASRTGR 319
           +  +  QLA D  L ++     ++ KL +     L E +S  DGR+  T      + TGR
Sbjct: 611 NEAVLEQLAPDYPLPKIILQNRSLAKLKSTYTDKLPEMISPKDGRVHTTYA-QAVAITGR 669

Query: 320 WSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVA 379
            +      QN+P   R+EE                         VR    A  G  +V A
Sbjct: 670 LASNNPNLQNIPI--RTEE----------------------GRKVRRAFTAPQGSVIVSA 705

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++G+   I AF NGED++  T A+ F T  + VS EQR   K +   L
Sbjct: 706 DYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSSEQRRYAKTINFGL 765

Query: 440 GYQGG 444
            Y  G
Sbjct: 766 IYGMG 770


>gi|327395816|dbj|BAK13238.1| DNA polymerase I PolA [Pantoea ananatis AJ13355]
          Length = 928

 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 79/174 (45%), Gaps = 25/174 (14%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G ++V AD + IE R++A ++ +   + AF+ GEDI+  T ++ F  P+ K
Sbjct: 688 IRQAFVAGKGNRIVAADYSQIELRIMAHLSQDKGLLDAFSQGEDIHRATASEVFGVPLSK 747

Query: 424 VSKEQRAIGKVMELALGY--------------QGGAKVFKTMASHCGLDLQQFSQNVKST 469
           V+ EQR   K +   L Y               G AK +  +       + ++ +N +  
Sbjct: 748 VTGEQRRSAKAINFGLIYGMSAFGLSRQLNIGAGEAKKYMDLYFERYPGVLRYMENTRQL 807

Query: 470 STFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAWRA 512
           +    + E  +   LW+ D     A++ K          + GTA +++K+A  A
Sbjct: 808 AASNGYVETLDGRRLWLPDIKSSNAIRRKAAERAAINAPMQGTAADIIKRAMIA 861


>gi|325201030|gb|ADY96485.1| DNA polymerase I [Neisseria meningitidis H44/76]
          Length = 916

 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 105/245 (42%), Gaps = 38/245 (15%)

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTY------ALRMYLFLITGIDLVDMSEGTLKSILS 266
           +A++  +L  +++KL      ++ Q +       L+  LF   GI    + +     I +
Sbjct: 529 LARQSAELGAELMKLEQEAYAAAGQPFNLNSPKQLQEILFDKMGIPTKGLKKTAKGGIST 588

Query: 267 HSNI-TQLAKDLILNRLASSGSAILKLNT-----LSEAVS-SDGRLRGTLQFYGASRTGR 319
           +  +  QLA D  L ++     ++ KL +     L E +S  DGR+  T      + TGR
Sbjct: 589 NEAVLEQLAPDYPLPKIILQNRSLAKLKSTYTDKLPEMISPKDGRVHTTYA-QAVAITGR 647

Query: 320 WSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVA 379
            +      QN+P   R+EE                         VR    A  G  +V A
Sbjct: 648 LASNNPNLQNIPI--RTEE----------------------GRKVRRAFTAPQGSVIVSA 683

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++G+   I AF NGED++  T A+ F T  + VS EQR   K +   L
Sbjct: 684 DYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSSEQRRYAKTINFGL 743

Query: 440 GYQGG 444
            Y  G
Sbjct: 744 IYGMG 748


>gi|264677057|ref|YP_003276963.1| DNA polymerase I [Comamonas testosteroni CNB-2]
 gi|262207569|gb|ACY31667.1| DNA polymerase I [Comamonas testosteroni CNB-2]
          Length = 931

 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           VR   +A  GK +  AD + IE R++A ++G++  + AF NG D++  T A+ F   +D+
Sbjct: 692 VREAFVAPEGKLIASADYSQIELRIMAHLSGDEALLSAFKNGLDVHRATAAEVFGVSVDE 751

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   KV+   L Y
Sbjct: 752 VSSEQRRYAKVINFGLIY 769


>gi|313200166|ref|YP_004038824.1| DNA polymerase i [Methylovorus sp. MP688]
 gi|312439482|gb|ADQ83588.1| DNA polymerase I [Methylovorus sp. MP688]
          Length = 918

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (55%), Gaps = 4/102 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G  +V AD + IE R++A ++ +D  + AFA GEDI+  T A+ F    D 
Sbjct: 679 IREAFVAPAGGHIVSADYSQIELRIMAHLSQDDGLLTAFAAGEDIHRATAAEIFGVERDA 738

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQN 465
           VS EQR   KV+   L Y  G   F  +A + G++ +Q +QN
Sbjct: 739 VSSEQRRYAKVINFGLIY--GMSAFG-LAQNLGIE-RQAAQN 776


>gi|319775212|ref|YP_004137700.1| DNA polymerase I [Haemophilus influenzae F3047]
 gi|317449803|emb|CBY86011.1| DNA polymerase I [Haemophilus influenzae F3047]
          Length = 610

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 81/172 (47%), Gaps = 25/172 (14%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 372 IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 431

Query: 424 VSKEQRAIGKVMELALGY--------------QGGAKVFKTMASHCGLDLQQFSQNVKST 469
           V+ EQR   K +   L Y              +  A+ +  +       +QQF  ++++ 
Sbjct: 432 VTSEQRRNAKAINFGLIYGMSAFGLSRQLGISRADAQKYMNLYFQRYPSVQQFMTDIRAK 491

Query: 470 STFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 492 AKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 543


>gi|148826499|ref|YP_001291252.1| DNA polymerase I [Haemophilus influenzae PittEE]
 gi|148716659|gb|ABQ98869.1| DNA polymerase I [Haemophilus influenzae PittEE]
          Length = 930

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 79/172 (45%), Gaps = 25/172 (14%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 692 IRQAFIAHEGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 751

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD--------------LQQFSQNVKST 469
           V+ EQR   K +   L Y   A           LD              +QQF  ++++ 
Sbjct: 752 VTSEQRRNAKAINFGLIYGMSAFGLSRQLGISRLDAQKYMDLYFQRYPSVQQFMTDIRAK 811

Query: 470 STFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 812 AKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 863


>gi|253998100|ref|YP_003050163.1| DNA polymerase I [Methylovorus sp. SIP3-4]
 gi|253984779|gb|ACT49636.1| DNA polymerase I [Methylovorus sp. SIP3-4]
          Length = 918

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (55%), Gaps = 4/102 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G  +V AD + IE R++A ++ +D  + AFA GEDI+  T A+ F    D 
Sbjct: 679 IREAFVAPAGGHIVSADYSQIELRIMAHLSQDDGLLTAFAAGEDIHRATAAEIFGVERDA 738

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQN 465
           VS EQR   KV+   L Y  G   F  +A + G++ +Q +QN
Sbjct: 739 VSSEQRRYAKVINFGLIY--GMSAFG-LAQNLGIE-RQAAQN 776


>gi|206562759|ref|YP_002233522.1| DNA polymerase I [Burkholderia cenocepacia J2315]
 gi|198038799|emb|CAR54761.1| DNA polymerase I [Burkholderia cenocepacia J2315]
          Length = 917

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 84/172 (48%), Gaps = 31/172 (18%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G ++V AD + IE R++A I+G+   ++AF+ GEDI+  T A+ F     +
Sbjct: 678 IREAFIAAPGHRIVSADYSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLE 737

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ +QR I KV+   L Y  G   F  +AS+ G+                  + Q+ ++ 
Sbjct: 738 VNSDQRRIAKVINFGLIY--GMSAFG-LASNLGITRDAAKLYIDRYFARYPGVAQYMEDT 794

Query: 467 KSTSTFEDW-EQAESHHLWMQD---------QYPE-FAVKDKLIGTACELVK 507
           ++T+  + + E      LW+ +         Q  E  A+   + GTA +L+K
Sbjct: 795 RATAKEKGYVETVFGRRLWLPEINGGNGPRRQAAERAAINAPMQGTAADLIK 846


>gi|169629701|ref|YP_001703350.1| DNA polymerase I [Mycobacterium abscessus ATCC 19977]
 gi|169241668|emb|CAM62696.1| DNA polymerase (POL I) [Mycobacterium abscessus]
          Length = 902

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 83/182 (45%), Gaps = 41/182 (22%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H ++T+L                + ++ L ++V++DGR+  T     A+ TGR 
Sbjct: 598 LEHLLTHRDVTRLK---------------VTVDGLLKSVAADGRIHTTFNQTIAA-TGRL 641

Query: 321 SGCVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVA 379
           S      QN+P R E   EI                            ++ +  ++L+  
Sbjct: 642 SSTEPNLQNIPVRTEAGREIRD------------------------GFVVGAGYRELMTV 677

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++ ++  I+AF  GED++    A+AF  PID+V+ E R   K M   L
Sbjct: 678 DYSQIEMRIMAHLSADEGLIEAFNTGEDLHSFVAARAFGVPIDEVTAELRRRVKAMSYGL 737

Query: 440 GY 441
            Y
Sbjct: 738 AY 739


>gi|221068749|ref|ZP_03544854.1| DNA polymerase I [Comamonas testosteroni KF-1]
 gi|220713772|gb|EED69140.1| DNA polymerase I [Comamonas testosteroni KF-1]
          Length = 937

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           VR   +A  GK +  AD + IE R++A ++G++  + AF NG D++  T A+ F   +D+
Sbjct: 698 VREAFVAPEGKLIASADYSQIELRIMAHLSGDEALLSAFKNGLDVHRATAAEVFGVSVDE 757

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   KV+   L Y
Sbjct: 758 VSSEQRRYAKVINFGLIY 775


>gi|145640968|ref|ZP_01796550.1| DNA polymerase I [Haemophilus influenzae R3021]
 gi|145274482|gb|EDK14346.1| DNA polymerase I [Haemophilus influenzae 22.4-21]
          Length = 314

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 82/175 (46%), Gaps = 31/175 (17%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 76  IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 135

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ EQR   K +   L Y  G   F  ++   G+                  +QQF  ++
Sbjct: 136 VTSEQRRNAKAINFGLIY--GMSAF-GLSRQLGISRPDAQKYMDLYFQRYPSVQQFMTDI 192

Query: 467 KSTSTFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           ++ +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 193 RAKAKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 247


>gi|254253595|ref|ZP_04946912.1| DNA polymerase A [Burkholderia dolosa AUO158]
 gi|124898240|gb|EAY70083.1| DNA polymerase A [Burkholderia dolosa AUO158]
          Length = 248

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 84/172 (48%), Gaps = 31/172 (18%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G ++V AD + IE R++A I+G+   ++AF+ GEDI+  T A+ F     +
Sbjct: 9   IREAFIAAPGHRIVSADYSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLE 68

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ +QR I KV+   L Y  G   F  +AS+ G+                  + Q+ +N 
Sbjct: 69  VNADQRRIAKVINFGLIY--GMSAF-GLASNLGITRDAAKLYIDRYFTRYPGVAQYMENT 125

Query: 467 KSTSTFEDW-EQAESHHLWMQD---------QYPE-FAVKDKLIGTACELVK 507
           ++++  + + E      LW+ +         Q  E  A+   + GTA +L+K
Sbjct: 126 RASAKEKGYVETVFGRRLWLPEINGGNGPRRQAAERAAINAPMQGTAADLIK 177


>gi|227113276|ref|ZP_03826932.1| DNA polymerase I [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 929

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   + AFANG DI+  T ++ F   +DK
Sbjct: 690 IRQAFIAPKGYSIVAADYSQIELRIMAHLSGDKGLLNAFANGLDIHRATASEVFGIALDK 749

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 750 VTSEQRRSAKAINFGLIY 767


>gi|330444148|ref|YP_004377134.1| DNA polymerase I [Chlamydophila pecorum E58]
 gi|328807258|gb|AEB41431.1| DNA polymerase I [Chlamydophila pecorum E58]
          Length = 878

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 146/348 (41%), Gaps = 62/348 (17%)

Query: 193 TINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGI--IRSSRQTYALRMYLFLITG 250
           ++   G  +D   ++ L+  + Q+   L E+I  L      I+S +Q   L   L+   G
Sbjct: 494 SMERNGMPLDSKKLVSLEHSLEQDLAILTEEIYTLAGEPFNIKSPKQ---LANILYNKLG 550

Query: 251 IDLVDMSEGTLKSILS-----HSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRL 305
           I  +D ++ T   +L      H  I +L     L +L S+    L      +      R+
Sbjct: 551 ITPLDKAKSTRAEVLEALREEHKIIEKLLMFRALEKLLSTYVKALP----RQVAPQTQRI 606

Query: 306 RGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVR 365
             T +  G + TGR +      QN+P++              +RG ++ +   +  + V 
Sbjct: 607 HATFEQMGTA-TGRLACRDPNLQNIPKRS-------------SRGLSLREAFLVPCETV- 651

Query: 366 SCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVS 425
                      + AD + IE R+LA ++ ++  + AF  GEDI+  T ++ F+ P+D+V+
Sbjct: 652 ---------SFLAADYSQIELRLLAHLSQDEVLLHAFHQGEDIHAFTASQVFSVPLDQVT 702

Query: 426 KEQRAIGKVMELALGY----QGGAKVFKTMASHCGLDLQQFSQNVKSTSTF-EDWEQAES 480
           K+QR   K +   + Y     G +K+ K   S     +Q + +     + F E+   A S
Sbjct: 703 KQQRMYAKTVNFGIIYGQQAYGLSKILKIPLSEAQELIQAYFERYSGVARFVEETIAAAS 762

Query: 481 HHLWMQ------------DQYP-------EFAVKDKLIGTACELVKKA 509
           H L +             D++P         AV  ++ G+A EL+K A
Sbjct: 763 HDLKVTTMLGRERVIDNWDEHPGIRASSGRLAVNTRIQGSAAELIKCA 810


>gi|148828039|ref|YP_001292792.1| DNA polymerase I [Haemophilus influenzae PittGG]
 gi|148719281|gb|ABR00409.1| DNA polymerase I [Haemophilus influenzae PittGG]
          Length = 930

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 81/172 (47%), Gaps = 25/172 (14%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 692 IRQAFIARKGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 751

Query: 424 VSKEQRAIGKVMELALGY--------------QGGAKVFKTMASHCGLDLQQFSQNVKST 469
           V+ EQR   K +   L Y              +  A+ +  +       +QQF  ++++ 
Sbjct: 752 VTSEQRRNAKAINFGLIYGMSAFGLSRQLGISRADAQKYMNLYFQRYPSVQQFMTDIRAK 811

Query: 470 STFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 812 AKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 863


>gi|329122862|ref|ZP_08251434.1| DNA-directed DNA polymerase I [Haemophilus aegyptius ATCC 11116]
 gi|327472126|gb|EGF17564.1| DNA-directed DNA polymerase I [Haemophilus aegyptius ATCC 11116]
          Length = 930

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 81/172 (47%), Gaps = 25/172 (14%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 692 IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLISAFSQGKDIHRSTAAEIFGVSLDE 751

Query: 424 VSKEQRAIGKVMELALGY--------------QGGAKVFKTMASHCGLDLQQFSQNVKST 469
           V+ EQR   K +   L Y              +  A+ +  +       +QQF  ++++ 
Sbjct: 752 VTSEQRRNAKAINFGLIYGMSAFGLSRQLGISRADAQKYMNLYFQRYPSVQQFMTDIRAK 811

Query: 470 STFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 812 AKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 863


>gi|319897650|ref|YP_004135847.1| DNA polymerase i [Haemophilus influenzae F3031]
 gi|317433156|emb|CBY81530.1| DNA polymerase I [Haemophilus influenzae F3031]
          Length = 935

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 81/172 (47%), Gaps = 25/172 (14%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 697 IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 756

Query: 424 VSKEQRAIGKVMELALGY--------------QGGAKVFKTMASHCGLDLQQFSQNVKST 469
           V+ EQR   K +   L Y              +  A+ +  +       +QQF  ++++ 
Sbjct: 757 VTSEQRRNAKAINFGLIYGMSAFGLSRQLGISRADAQKYMNLYFQRYPSVQQFMTDIRAK 816

Query: 470 STFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 817 AKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 868


>gi|300714614|ref|YP_003739417.1| DNA polymerase I [Erwinia billingiae Eb661]
 gi|299060450|emb|CAX57557.1| DNA polymerase I [Erwinia billingiae Eb661]
          Length = 928

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 131/303 (43%), Gaps = 46/303 (15%)

Query: 146 DCTRANHVQAW-QLFGEYCKRDVEATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLD 204
           D T   H++ W +L  E   ++V    E+   L  +S  ER+  L+DQ I     +   +
Sbjct: 502 DVTLQLHLKMWPELEKEQGPKEVFENIEM-PLLTVISRIERNGVLIDQGILAAHSK---E 557

Query: 205 LVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSI 264
           L ++L EL  Q+  +L  +   L+     S +Q   L+  LF   GI     + G   S 
Sbjct: 558 LTIRLAEL-EQKAHELAGEPFNLS-----SPKQ---LQTILFEKQGIKPTKKTPGGAPST 608

Query: 265 LSHSNITQLAKDLILNRLASSGSAILKL-NTLSEAVS-----SDGRLRGTLQFYGASRTG 318
            S   + +LA D  L ++      + KL +T ++ +        GR+  T      + TG
Sbjct: 609 -SEEVLAELALDYPLPKVILENRGLAKLKSTYTDKLPLMINPITGRVH-TSYHQAVTATG 666

Query: 319 RWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVV 378
           R S      QN+P   R+EE                         +R   IAS G K+V 
Sbjct: 667 RLSSTDPNLQNIPV--RNEE----------------------GRRIRQAFIASKGHKIVA 702

Query: 379 ADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELA 438
           AD + IE R++A ++ +   + AFA G DI+  T A+ F   +DKV+ EQR   K +   
Sbjct: 703 ADYSQIELRIMAHLSQDKGLLSAFAEGMDIHRATAAEVFGMALDKVTGEQRRSAKAINFG 762

Query: 439 LGY 441
           L Y
Sbjct: 763 LIY 765


>gi|313115485|ref|ZP_07800950.1| DNA-directed DNA polymerase [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310622195|gb|EFQ05685.1| DNA-directed DNA polymerase [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 864

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 85/187 (45%), Gaps = 35/187 (18%)

Query: 288 AILKLNT-----LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILT 341
           A  KLN+     L + +  DGR+  T     A RTGR S      QN+P R E   ++  
Sbjct: 569 AYQKLNSTYVEGLLKVIGEDGRIHSTFNQTEA-RTGRLSSDNPNLQNIPIRTELGSQL-- 625

Query: 342 QTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKA 401
                                  R+  IA  G  LV AD + IE R+LA I G++   +A
Sbjct: 626 -----------------------RAYFIAKPGCVLVDADYSQIELRILAHITGDEHMQQA 662

Query: 402 FANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQ 461
           F NGEDI+ +T AK +  P ++V+   R+  K +   + Y  GA    ++A   G+ +++
Sbjct: 663 FLNGEDIHRSTAAKIYGIPQEEVTSRLRSSAKAINFGIMYGKGA---YSLAKDIGVSVKE 719

Query: 462 FSQNVKS 468
               +K+
Sbjct: 720 ADAFLKN 726


>gi|229845908|ref|ZP_04466020.1| DNA polymerase I [Haemophilus influenzae 7P49H1]
 gi|229810912|gb|EEP46629.1| DNA polymerase I [Haemophilus influenzae 7P49H1]
 gi|309973653|gb|ADO96854.1| DNA polymerase I [Haemophilus influenzae R2846]
          Length = 930

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 82/175 (46%), Gaps = 31/175 (17%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 692 IRQAFIAHEGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 751

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ EQR   K +   L Y  G   F  ++   G+                  +QQF  ++
Sbjct: 752 VTSEQRRNAKAINFGLIY--GMSAFG-LSRQLGISRPDAQKYMDLYFQRYPSVQQFMTDI 808

Query: 467 KSTSTFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           ++ +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 809 RAKAKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 863


>gi|167856246|ref|ZP_02478980.1| DNA polymerase I (POL I) [Haemophilus parasuis 29755]
 gi|167852633|gb|EDS23913.1| DNA polymerase I (POL I) [Haemophilus parasuis 29755]
          Length = 954

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G  ++ AD + IE R++A +A +   IKAFA G+DI+ +T A+ F  P++ 
Sbjct: 716 IRQAFIARDGYVILAADYSQIELRIMAHLANDANMIKAFAEGKDIHRSTAAEIFGVPLEA 775

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 776 VTSEQRRSAKAINFGLIY 793


>gi|145632225|ref|ZP_01787960.1| DNA polymerase I [Haemophilus influenzae 3655]
 gi|145634721|ref|ZP_01790429.1| DNA polymerase I [Haemophilus influenzae PittAA]
 gi|144987132|gb|EDJ93662.1| DNA polymerase I [Haemophilus influenzae 3655]
 gi|145267887|gb|EDK07883.1| DNA polymerase I [Haemophilus influenzae PittAA]
          Length = 935

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 82/175 (46%), Gaps = 31/175 (17%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 697 IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 756

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ EQR   K +   L Y  G   F  ++   G+                  +QQF  ++
Sbjct: 757 VTSEQRRNAKAINFGLIY--GMSAFG-LSRQLGISRPDAQKYMDLYFQRYPSVQQFMTDI 813

Query: 467 KSTSTFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           ++ +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 814 RAKAKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 868


>gi|83716432|ref|YP_438805.1| DNA polymerase I [Burkholderia thailandensis E264]
 gi|257141887|ref|ZP_05590149.1| DNA polymerase I [Burkholderia thailandensis E264]
 gi|83650257|gb|ABC34321.1| DNA polymerase I [Burkholderia thailandensis E264]
          Length = 926

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 687 IREAFIAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 746

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 747 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 777


>gi|167615322|ref|ZP_02383957.1| DNA polymerase I [Burkholderia thailandensis Bt4]
          Length = 926

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 687 IREAFIAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 746

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 747 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 777


>gi|296395192|ref|YP_003660076.1| DNA polymerase I [Segniliparus rotundus DSM 44985]
 gi|296182339|gb|ADG99245.1| DNA polymerase I [Segniliparus rotundus DSM 44985]
          Length = 903

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 79/176 (44%), Gaps = 32/176 (18%)

Query: 267 HSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQ 326
           H  ++ L +     RL ++   ++K      AV  DGR+  T +    + TGR S     
Sbjct: 596 HPFLSHLLEHRDATRLMTTAQGLIK------AVGPDGRIHTTFR-QDVAATGRLSSTDPN 648

Query: 327 PQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKK-LVVADLAGIE 385
            QN+P   R+EE                      +  +R   +   G + L+ AD + IE
Sbjct: 649 LQNIPV--RTEE----------------------ARRIRGVFVVGEGHEALMTADYSQIE 684

Query: 386 ARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            R++A ++G++  I+AF  GED++    ++AF  PID+V  E R   K M   L Y
Sbjct: 685 MRIMAHLSGDEGLIEAFRTGEDLHNFVASRAFGVPIDQVGAELRRRVKAMSYGLAY 740


>gi|270265261|ref|ZP_06193523.1| DNA polymerase I [Serratia odorifera 4Rx13]
 gi|270040895|gb|EFA13997.1| DNA polymerase I [Serratia odorifera 4Rx13]
          Length = 933

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G ++V AD + IE R++A ++ ++  +KAFA G+DI+  T A+ F   +DK
Sbjct: 693 IRQAFIAPEGYRIVAADYSQIELRIMAHLSQDEGLLKAFAEGKDIHRATAAEVFGVQLDK 752

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 753 VTGEQRRSAKAINFGLIY 770


>gi|89889486|ref|ZP_01200997.1| DNA polymerase I [Flavobacteria bacterium BBFL7]
 gi|89517759|gb|EAS20415.1| DNA  polymerase I [Flavobacteria bacterium BBFL7]
          Length = 946

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 130/301 (43%), Gaps = 49/301 (16%)

Query: 161 EYCKRDVEATRELFKRLIP--LSDGERDLW------LLD--QTINDRGYRIDLDLVLKLQ 210
           EY   D + T +L +   P   S G   L+      LLD    +   G  +D D +  L 
Sbjct: 513 EYAVEDADITLQLKEHFTPELASAGTDKLFKDIEMPLLDVLAAMEIEGINLDEDFLSSLS 572

Query: 211 ELIAQERKKLDEDIVKLT--DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS 268
             +  +  +L++DI ++   +  I S +Q     + + L   + LVD  + T     S +
Sbjct: 573 GDLETDITQLEKDIYEVAGEEFNIGSPKQ-----LGVILFEKLKLVDKPKKTKTGQYSTA 627

Query: 269 N--ITQLAKD--LILNRLASSGSAILK---LNTLSEAVSSDGRLRGTLQFYGASRTGRWS 321
              ++ LAKD  +I N L   G + LK   ++ L   V +  +   T      + TGR S
Sbjct: 628 EDVLSYLAKDHAIIQNVLDYRGLSKLKSTYVDALPNQVDAKTQRIHTNYMQTVAATGRLS 687

Query: 322 GCVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVAD 380
                 QN+P R ER  ++                         ++ I       L+ AD
Sbjct: 688 STDPNLQNIPIRTERGRQVR------------------------KAFIPRDENYTLIAAD 723

Query: 381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
            + IE R++A ++ E+  I AF +GEDI+ +T AK FN  ++ V++EQR+  K +   + 
Sbjct: 724 YSQIELRIIAALSEEENMIAAFQSGEDIHASTAAKVFNVALEDVTREQRSNAKTVNFGII 783

Query: 441 Y 441
           Y
Sbjct: 784 Y 784


>gi|310658711|ref|YP_003936432.1| DNA polymerase I [Clostridium sticklandii DSM 519]
 gi|308825489|emb|CBH21527.1| DNA polymerase I [Clostridium sticklandii]
          Length = 888

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A     LV AD + IE R+LA IA ++  I AF+ G+DI+  T ++ FN P+D+
Sbjct: 649 LRKVFVAPEDMYLVDADYSQIELRILAHIANDEGLIDAFSKGDDIHTITASEVFNVPLDE 708

Query: 424 VSKEQRAIGKVMELALGY 441
           V+KE R+  K +   + Y
Sbjct: 709 VTKELRSAAKAVNFGIVY 726


>gi|167842181|ref|ZP_02468865.1| DNA polymerase I [Burkholderia thailandensis MSMB43]
          Length = 926

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 687 IREAFIAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 746

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 747 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 777


>gi|219870449|ref|YP_002474824.1| DNA polymerase I [Haemophilus parasuis SH0165]
 gi|219690653|gb|ACL31876.1| DNA polymerase I [Haemophilus parasuis SH0165]
          Length = 954

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G  ++ AD + IE R++A +A +   IKAFA G+DI+ +T A+ F  P++ 
Sbjct: 716 IRQAFIARDGYVILAADYSQIELRIMAHLANDANMIKAFAEGKDIHRSTAAEIFGVPLEA 775

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 776 VTSEQRRSAKAINFGLIY 793


>gi|239905004|ref|YP_002951743.1| DNA polymerase I [Desulfovibrio magneticus RS-1]
 gi|239794868|dbj|BAH73857.1| DNA polymerase I [Desulfovibrio magneticus RS-1]
          Length = 888

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R+C  A  G +LV AD + IE RVLA ++GE   + AFA+G DI+  T A  F+ P + 
Sbjct: 649 MRACFTAGPGNRLVAADYSQIELRVLAHLSGESALLDAFAHGADIHARTAAILFDKPEEA 708

Query: 424 VSKEQRAIGKVMELALGYQGGAK 446
           ++ ++R   K +   L Y  G +
Sbjct: 709 IAPDERRQAKTINFGLLYGMGPQ 731


>gi|313813473|gb|EFS51187.1| hypothetical protein HMPREF9587_01282 [Propionibacterium acnes
           HL025PA1]
          Length = 112

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 52/109 (47%), Gaps = 11/109 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLC--AYAWDDEPVKLWDRTEQSAMPSDLL 58
           M ++ IDIET SP PL K GV+ YAE     L    Y+ D  PV++ D      +P ++L
Sbjct: 1   MRQIAIDIETFSPAPLAKTGVYPYAEHPDFRLLIFGYSIDGGPVEVVDLASGGGLPDEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPS---------KRWICTSV 98
             L D  V+  AHN+ FER+     L    P           +W CT V
Sbjct: 61  AALVDPGVVKWAHNAAFERVALSAWLQRHYPELLAAGFLDPSQWRCTMV 109


>gi|238921711|ref|YP_002935226.1| DNA polymerase I [Edwardsiella ictaluri 93-146]
 gi|238871280|gb|ACR70991.1| DNA polymerase I [Edwardsiella ictaluri 93-146]
          Length = 930

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G ++V AD + IE R++A ++G+   ++AFA G+DI+  T A+ F  P++ 
Sbjct: 691 IRQAFIAPVGSRIVAADYSQIELRIMAHLSGDKGLLQAFAAGKDIHRATAAEVFGLPLEA 750

Query: 424 VSKEQRAIGKVMELALGY 441
           VS +QR   K +   L Y
Sbjct: 751 VSADQRRSAKAINFGLIY 768


>gi|307249709|ref|ZP_07531688.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 4 str.
           M62]
 gi|306858217|gb|EFM90294.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 4 str.
           M62]
          Length = 180

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K+V AD + IE R++A +A ++  I AFA G+DI+  T A+ F   +D+
Sbjct: 11  IRQAFIARDGYKIVAADYSQIELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQ 70

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 71  VTSEQRRSAKAINFGLIY 88


>gi|467163|gb|AAA50927.1| polI [Mycobacterium leprae]
          Length = 907

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 93/207 (44%), Gaps = 42/207 (20%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H ++T+L                + ++ L  AV++DGR+  T     A+ TGR 
Sbjct: 600 LQHLLTHRDVTRLK---------------VTVDGLLNAVAADGRIHTTFNQTIAT-TGRL 643

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG-KKLVVA 379
           S      QN+P +              N G  I D   + S+        +NG  +L+ A
Sbjct: 644 SSTEPNLQNIPIRT-------------NAGRQIRDAFVVGSE--------NNGYTELMTA 682

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++ ++  I+AF  GED++    ++AF  PI+ ++ E R   K M   L
Sbjct: 683 DYSQIEMRIMAHLSRDEGLIEAFHTGEDLHSFVASRAFGIPIEDITPELRRRVKAMSYGL 742

Query: 440 GY----QGGAKVFKTMASHCGLDLQQF 462
            Y     G A   K       L ++Q+
Sbjct: 743 AYGLSAYGLATQLKISTEEAKLQMEQY 769


>gi|221212339|ref|ZP_03585316.1| DNA polymerase I [Burkholderia multivorans CGD1]
 gi|221167438|gb|EED99907.1| DNA polymerase I [Burkholderia multivorans CGD1]
          Length = 920

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G ++V AD + IE R++A I+G+   ++AF+ GEDI+  T A+ F     +
Sbjct: 681 IREAFIAAPGHRIVSADYSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLE 740

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 741 VNADQRRIAKVINFGLIY--GMSAFG-LASNLGI 771


>gi|161521363|ref|YP_001584790.1| DNA polymerase I [Burkholderia multivorans ATCC 17616]
 gi|189352470|ref|YP_001948097.1| DNA polymerase I [Burkholderia multivorans ATCC 17616]
 gi|160345413|gb|ABX18498.1| DNA polymerase I [Burkholderia multivorans ATCC 17616]
 gi|189336492|dbj|BAG45561.1| DNA polymerase I [Burkholderia multivorans ATCC 17616]
          Length = 917

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G ++V AD + IE R++A I+G+   ++AF+ GEDI+  T A+ F     +
Sbjct: 678 IREAFIAAPGHRIVSADYSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLE 737

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 738 VNADQRRIAKVINFGLIY--GMSAFG-LASNLGI 768


>gi|229844734|ref|ZP_04464873.1| DNA polymerase I [Haemophilus influenzae 6P18H1]
 gi|229812448|gb|EEP48138.1| DNA polymerase I [Haemophilus influenzae 6P18H1]
          Length = 930

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 82/175 (46%), Gaps = 31/175 (17%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 692 IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 751

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ EQR   K +   L Y  G   F  ++   G+                  +QQF  ++
Sbjct: 752 VTSEQRRNAKAINFGLIY--GMSAFG-LSRQLGISRPDAQKYMDLYFQRYPSVQQFMTDI 808

Query: 467 KSTSTFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           ++ +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 809 RAKAKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 863


>gi|294634243|ref|ZP_06712786.1| DNA polymerase I [Edwardsiella tarda ATCC 23685]
 gi|291092330|gb|EFE24891.1| DNA polymerase I [Edwardsiella tarda ATCC 23685]
          Length = 930

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G K+V AD + IE R++A ++G+   ++AFA G+DI+  T A+ F  P++ 
Sbjct: 691 IRQAFIAPAGSKIVAADYSQIELRIMAHLSGDRGLLEAFAAGKDIHRATAAEVFGLPLEA 750

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ +QR   K +   L Y
Sbjct: 751 VTADQRRSAKAINFGLIY 768


>gi|197286655|ref|YP_002152527.1| DNA polymerase I [Proteus mirabilis HI4320]
 gi|194684142|emb|CAR45571.1| DNA polymerase I [Proteus mirabilis HI4320]
          Length = 932

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K+V AD + IE R++A ++ +   + AFA G+DI+  T ++ F  P+D+
Sbjct: 692 IRQAFIARDGFKIVAADYSQIELRIMAHLSQDKGLLDAFAQGKDIHRATASEVFGIPLDE 751

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 752 VTSEQRRSAKAINFGLIY 769


>gi|54023843|ref|YP_118085.1| DNA polymerase I [Nocardia farcinica IFM 10152]
 gi|54015351|dbj|BAD56721.1| putative DNA polymerase I [Nocardia farcinica IFM 10152]
          Length = 910

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 85/181 (46%), Gaps = 39/181 (21%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H + T+L                + ++ L ++V+ DGR+  T     A+ TGR 
Sbjct: 606 LEHLLAHRDATRLK---------------VTVDGLLKSVADDGRIHTTFNQTIAA-TGRL 649

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVAD 380
           S      QN+P       I T T      G  I D          + ++     +L+ AD
Sbjct: 650 SSTEPNLQNIP-------IRTDT------GRMIRD----------TFVVGPGYAELMTAD 686

Query: 381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
            + IE R++A ++G++  I+AF +GED++    +KAF+ PI +VS E R   K M   L 
Sbjct: 687 YSQIEMRIMAHLSGDEGLIEAFNSGEDLHSFVASKAFDIPIAEVSPELRRRIKAMSYGLA 746

Query: 441 Y 441
           Y
Sbjct: 747 Y 747


>gi|145589891|ref|YP_001156488.1| DNA polymerase I [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145048297|gb|ABP34924.1| DNA polymerase I [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 943

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   I ++G KL+ AD + IE R++A IA ++  + AF  G+D++  T A+ F  P+D 
Sbjct: 704 IREAFIPADGCKLLSADYSQIELRIMAHIAEDENLLTAFKEGKDVHQATAAEIFGIPLDD 763

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           V+ EQR   KV+   L Y  G   F  +A + G++
Sbjct: 764 VNSEQRRYAKVINFGLIY--GMSAF-GLAGNLGIE 795


>gi|221197067|ref|ZP_03570114.1| DNA polymerase I [Burkholderia multivorans CGD2M]
 gi|221203739|ref|ZP_03576757.1| DNA polymerase I [Burkholderia multivorans CGD2]
 gi|221175905|gb|EEE08334.1| DNA polymerase I [Burkholderia multivorans CGD2]
 gi|221183621|gb|EEE16021.1| DNA polymerase I [Burkholderia multivorans CGD2M]
          Length = 920

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G ++V AD + IE R++A I+G+   ++AF+ GEDI+  T A+ F     +
Sbjct: 681 IREAFIAAPGHRIVSADYSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLE 740

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 741 VNADQRRIAKVINFGLIY--GMSAF-GLASNLGI 771


>gi|217975428|ref|YP_002360179.1| DNA polymerase I [Shewanella baltica OS223]
 gi|217500563|gb|ACK48756.1| DNA polymerase I [Shewanella baltica OS223]
          Length = 921

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (61%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G+K++ AD + IE R++A ++ +   +KAFA G+DI+  T A+ F T  D+
Sbjct: 681 IRQAFIAPDGRKILAADYSQIELRIMAHLSQDAGLLKAFAEGKDIHRATAAEVFGTDFDE 740

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 741 VTTEQRRRAKAVNFGLIY 758


>gi|326335129|ref|ZP_08201326.1| DNA-directed DNA polymerase I [Capnocytophaga sp. oral taxon 338
           str. F0234]
 gi|325692659|gb|EGD34601.1| DNA-directed DNA polymerase I [Capnocytophaga sp. oral taxon 338
           str. F0234]
          Length = 929

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 129/309 (41%), Gaps = 57/309 (18%)

Query: 157 QLFGEYCKRDVEATRELFKRLIPLSDGERDLWLLDQT----------INDRGYRIDLDLV 206
           +L  EY   D + T +L    +PL + ++ L L  +           +   G R+D    
Sbjct: 492 ELQKEYAVEDTDVTLQLKHVFLPLLEKDQMLSLFRKVEAPLVEVLAQMEYEGIRVD---- 547

Query: 207 LKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRM------YLFLITGIDLVDMSEGT 260
                 +AQ  K++  D++ L   I   + +++ L         LF    +        T
Sbjct: 548 ---THFLAQLSKEIAADLIGLEKTIFSQAEESFNLSSPKQLGDILFEKLKLLSKPKKTKT 604

Query: 261 LKSILSHSNITQLA--KDLILNRLASSGSAILKL-NTLSEAVSSD-----GRLRGTLQFY 312
            +   S   +++LA   +++ N L     A+ KL +T  EA+  +     GR+  T    
Sbjct: 605 GQYATSEEVLSELASKHEIVANVL--EFRALQKLQSTYIEALPREVNPHTGRIHTTF-MQ 661

Query: 313 GASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASN 372
             + TGR S      QN+P                     I  P G  S   ++ +  + 
Sbjct: 662 AVTATGRLSSNQPNLQNIP---------------------IRTPRG--SQIRKAFVPRNE 698

Query: 373 GKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIG 432
              L+ AD + IE R++A ++ ED  I+AF  G+DI+ +T AK F  P++ V+KEQR+  
Sbjct: 699 DYTLLSADYSQIELRIIAALSEEDHMIEAFLEGQDIHRSTAAKVFGVPLEAVTKEQRSHA 758

Query: 433 KVMELALGY 441
           K +   + Y
Sbjct: 759 KTVNFGIIY 767


>gi|126172309|ref|YP_001048458.1| DNA polymerase I [Shewanella baltica OS155]
 gi|125995514|gb|ABN59589.1| DNA polymerase I [Shewanella baltica OS155]
          Length = 921

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (61%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G+K++ AD + IE R++A ++ +   +KAFA G+DI+  T A+ F T  D+
Sbjct: 681 IRQAFIAPDGRKILAADYSQIELRIMAHLSQDAGLLKAFAEGKDIHRATAAEVFGTDFDE 740

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 741 VTTEQRRRAKAVNFGLIY 758


>gi|160877586|ref|YP_001556902.1| DNA polymerase I [Shewanella baltica OS195]
 gi|160863108|gb|ABX51642.1| DNA polymerase I [Shewanella baltica OS195]
 gi|315269784|gb|ADT96637.1| DNA polymerase I [Shewanella baltica OS678]
          Length = 921

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (61%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G+K++ AD + IE R++A ++ +   +KAFA G+DI+  T A+ F T  D+
Sbjct: 681 IRQAFIAPDGRKILAADYSQIELRIMAHLSQDAGLLKAFAEGKDIHRATAAEVFGTDFDE 740

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 741 VTTEQRRRAKAVNFGLIY 758


>gi|15677811|ref|NP_274975.1| DNA polymerase I [Neisseria meningitidis MC58]
 gi|7227243|gb|AAF42310.1| DNA polymerase I [Neisseria meningitidis MC58]
          Length = 938

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 105/245 (42%), Gaps = 38/245 (15%)

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTY------ALRMYLFLITGIDLVDMSEGTLKSILS 266
           +A++  +L  +++KL      ++ Q +       L+  LF   GI    + +     I +
Sbjct: 551 LARQSAELGAELMKLEQEAYAAAGQPFNLNSPKQLQEILFDKMGIPTKGLKKTAKGGIST 610

Query: 267 HSNI-TQLAKDLILNRLASSGSAILKLNT-----LSEAVS-SDGRLRGTLQFYGASRTGR 319
           +  +  QLA D  L ++     ++ KL +     L E +S  DGR+  T      + TGR
Sbjct: 611 NEAVLEQLAPDYPLPKIILQNRSLAKLKSTYTDKLPEMISPKDGRVHTTYA-QAVAITGR 669

Query: 320 WSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVA 379
            +      QN+P   R+EE                         VR    A  G  +V A
Sbjct: 670 LASNNPNLQNIPI--RTEE----------------------GRKVRRAFTAPQGSVIVSA 705

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++G+   I AF NGED++  T A+ F T  + VS EQR   K +   L
Sbjct: 706 DYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSSEQRRYAKSINFGL 765

Query: 440 GYQGG 444
            Y  G
Sbjct: 766 IYGMG 770


>gi|153002841|ref|YP_001368522.1| DNA polymerase I [Shewanella baltica OS185]
 gi|151367459|gb|ABS10459.1| DNA polymerase I [Shewanella baltica OS185]
          Length = 935

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (61%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G+K++ AD + IE R++A ++ +   +KAFA G+DI+  T A+ F T  D+
Sbjct: 695 IRQAFIAPDGRKILAADYSQIELRIMAHLSQDAGLLKAFAEGKDIHRATAAEVFGTDFDE 754

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 755 VTTEQRRRAKAVNFGLIY 772


>gi|304411973|ref|ZP_07393583.1| DNA polymerase I [Shewanella baltica OS183]
 gi|307305868|ref|ZP_07585614.1| DNA polymerase I [Shewanella baltica BA175]
 gi|304349523|gb|EFM13931.1| DNA polymerase I [Shewanella baltica OS183]
 gi|306911361|gb|EFN41787.1| DNA polymerase I [Shewanella baltica BA175]
          Length = 921

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (61%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G+K++ AD + IE R++A ++ +   +KAFA G+DI+  T A+ F T  D+
Sbjct: 681 IRQAFIAPDGRKILAADYSQIELRIMAHLSQDAGLLKAFAEGKDIHRATAAEVFGTDFDE 740

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 741 VTTEQRRRAKAVNFGLIY 758


>gi|15827719|ref|NP_301982.1| DNA polymerase I [Mycobacterium leprae TN]
 gi|221230196|ref|YP_002503612.1| DNA polymerase I [Mycobacterium leprae Br4923]
 gi|1169403|sp|P46835|DPO1_MYCLE RecName: Full=DNA polymerase I; Short=POL I
 gi|559913|emb|CAA86364.1| DNA polymerase I [Mycobacterium leprae]
 gi|13093270|emb|CAC31762.1| DNA polymerase I [Mycobacterium leprae]
 gi|219933303|emb|CAR71476.1| DNA polymerase I [Mycobacterium leprae Br4923]
          Length = 911

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 93/207 (44%), Gaps = 42/207 (20%)

Query: 261 LKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRW 320
           L+ +L+H ++T+L                + ++ L  AV++DGR+  T     A+ TGR 
Sbjct: 604 LQHLLTHRDVTRLK---------------VTVDGLLNAVAADGRIHTTFNQTIAT-TGRL 647

Query: 321 SGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG-KKLVVA 379
           S      QN+P +              N G  I D   + S+        +NG  +L+ A
Sbjct: 648 SSTEPNLQNIPIRT-------------NAGRQIRDAFVVGSE--------NNGYTELMTA 686

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++ ++  I+AF  GED++    ++AF  PI+ ++ E R   K M   L
Sbjct: 687 DYSQIEMRIMAHLSRDEGLIEAFHTGEDLHSFVASRAFGIPIEDITPELRRRVKAMSYGL 746

Query: 440 GY----QGGAKVFKTMASHCGLDLQQF 462
            Y     G A   K       L ++Q+
Sbjct: 747 AYGLSAYGLATQLKISTEEAKLQMEQY 773


>gi|109896347|ref|YP_659602.1| DNA polymerase I [Pseudoalteromonas atlantica T6c]
 gi|109698628|gb|ABG38548.1| DNA polymerase I [Pseudoalteromonas atlantica T6c]
          Length = 928

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           VR   IA  G K+V AD + IE R++A ++ ++  +KAF+ G+DI+  T A+ FN  + +
Sbjct: 688 VRQAFIARPGYKIVAADYSQIELRIMAHLSQDEGLLKAFSQGKDIHTATAAEVFNVSLTE 747

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 748 VTTEQRRNAKAINFGLIY 765


>gi|238794563|ref|ZP_04638171.1| DNA polymerase I [Yersinia intermedia ATCC 29909]
 gi|238726143|gb|EEQ17689.1| DNA polymerase I [Yersinia intermedia ATCC 29909]
          Length = 932

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G +++ AD + IE R++A ++ +   + AFA G+DI+  T A+ F TP++K
Sbjct: 692 IRQAFIAPKGYRIMAADYSQIELRIMAHLSQDKGLLAAFAAGKDIHRATAAEVFGTPLEK 751

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 752 VTTEQRRSAKAINFGLIY 769


>gi|260581683|ref|ZP_05849480.1| DNA polymerase I [Haemophilus influenzae NT127]
 gi|260095276|gb|EEW79167.1| DNA polymerase I [Haemophilus influenzae NT127]
          Length = 930

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 80/172 (46%), Gaps = 25/172 (14%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 692 IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 751

Query: 424 VSKEQRAIGKVMELALGY--------------QGGAKVFKTMASHCGLDLQQFSQNVKST 469
           V+ EQR   K +   L Y              +  A+ +  +       +QQF  +++  
Sbjct: 752 VTSEQRRNAKAINFGLIYGMSAFGLSRQLGISRADAQKYMNLYFQRYPSVQQFMTDIREK 811

Query: 470 STFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 812 AKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 863


>gi|160900757|ref|YP_001566339.1| DNA polymerase I [Delftia acidovorans SPH-1]
 gi|160366341|gb|ABX37954.1| DNA polymerase I [Delftia acidovorans SPH-1]
          Length = 947

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 129/293 (44%), Gaps = 37/293 (12%)

Query: 162 YCKRDVEATRELFKRLIP---LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           Y   D + T ++ + L P    +DG R ++ L+   ++  +RI+ + VL     +A++  
Sbjct: 517 YACEDADQTLDVHRVLWPQLQANDGLRGVYELEIATSEALFRIERNGVLIDAATLARQSN 576

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRM------YLFLITGIDLVDMSEGTLKSILSHSNITQ 272
            L + IV+L       + Q + L          F   G+ +V  +    +S      + +
Sbjct: 577 DLGQRIVQLEQEAYDIAGQPFNLASPKQLGEIFFDKLGMPVVKKTATGARST-DEEVLEK 635

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGT----LQFYGASRTGRWSGCVFQPQ 328
           LA+D  L       + +L+  +LS       +L+GT    L      RTGR      Q  
Sbjct: 636 LAEDYPLP------AKLLEHRSLS-------KLKGTYTDKLAQLALPRTGRVHTHYAQAV 682

Query: 329 NLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARV 388
            +  +  S +   Q I        I  P G     VR   IA+ G  +  AD + IE R+
Sbjct: 683 AVTGRLSSNDPNLQNI-------PIRTPEGRR---VREAFIAAPGHVIASADYSQIELRI 732

Query: 389 LAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           +A ++G++  ++AF  G D++  T ++ FN  +++VS EQR   KV+   L Y
Sbjct: 733 MAHLSGDESLLRAFHEGRDVHRATASEVFNVELEQVSSEQRRYAKVINFGLIY 785


>gi|269140843|ref|YP_003297544.1| DNA polymerase I [Edwardsiella tarda EIB202]
 gi|267986504|gb|ACY86333.1| DNA polymerase I [Edwardsiella tarda EIB202]
 gi|304560602|gb|ADM43266.1| DNA polymerase I [Edwardsiella tarda FL6-60]
          Length = 930

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G ++V AD + IE R++A ++G+   + AFA G+DI+  T A+ F  P++ 
Sbjct: 691 IRQAFIAPAGSRIVAADYSQIELRIMAHLSGDKGLLAAFAAGKDIHRATAAEVFGLPLEA 750

Query: 424 VSKEQRAIGKVMELALGY 441
           VS +QR   K +   L Y
Sbjct: 751 VSADQRRSAKAINFGLIY 768


>gi|68249450|ref|YP_248562.1| DNA polymerase I [Haemophilus influenzae 86-028NP]
 gi|68057649|gb|AAX87902.1| DNA polymerase I [Haemophilus influenzae 86-028NP]
          Length = 930

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 80/172 (46%), Gaps = 25/172 (14%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 692 IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 751

Query: 424 VSKEQRAIGKVMELALGY--------------QGGAKVFKTMASHCGLDLQQFSQNVKST 469
           V+ EQR   K +   L Y              +  AK +  +       +QQF  +++  
Sbjct: 752 VTSEQRRNAKAINFGLIYGMSAFGLSRQLDISRPDAKKYMDLYFQRYPSVQQFMTDIREK 811

Query: 470 STFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 812 AKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 863


>gi|88802075|ref|ZP_01117603.1| DNA polymerase I [Polaribacter irgensii 23-P]
 gi|88782733|gb|EAR13910.1| DNA polymerase I [Polaribacter irgensii 23-P]
          Length = 980

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 45/66 (68%)

Query: 376 LVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVM 435
           L+ AD + IE R++A ++ E+  I AF NGEDI+ +T AK FN P+++V+++QR+  K +
Sbjct: 753 LLAADYSQIELRIIAALSEEENMINAFKNGEDIHASTAAKVFNVPLNEVTRDQRSNAKTV 812

Query: 436 ELALGY 441
              + Y
Sbjct: 813 NFGIVY 818


>gi|167899173|ref|ZP_02486574.1| DNA polymerase I [Burkholderia pseudomallei 7894]
          Length = 625

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 386 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 445

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 446 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 476


>gi|167850580|ref|ZP_02476088.1| DNA polymerase I [Burkholderia pseudomallei B7210]
          Length = 622

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 383 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 442

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 443 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 473


>gi|145630606|ref|ZP_01786386.1| DNA polymerase I [Haemophilus influenzae R3021]
 gi|144983996|gb|EDJ91438.1| DNA polymerase I [Haemophilus influenzae R3021]
          Length = 743

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 82/174 (47%), Gaps = 31/174 (17%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 505 IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 564

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ EQR   K +   L Y  G   F  ++   G+                  +QQF  ++
Sbjct: 565 VTSEQRRNAKAINFGLIY--GMSAF-GLSRQLGISRPDAQKYMDLYFQRYPSVQQFMTDI 621

Query: 467 KSTSTFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKA 509
           ++ +  + + E      L++ D     A++ K          + GTA +++K+A
Sbjct: 622 RAKAKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRA 675


>gi|167820743|ref|ZP_02452423.1| DNA polymerase I [Burkholderia pseudomallei 91]
          Length = 622

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 383 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 442

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 443 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 473


>gi|89897107|ref|YP_520594.1| hypothetical protein DSY4361 [Desulfitobacterium hafniense Y51]
 gi|89336555|dbj|BAE86150.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 578

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 79/165 (47%), Gaps = 20/165 (12%)

Query: 365 RSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV 424
           R+C  A  G+KL++AD + IE RV A I+G+   I A+  GED+++ T +   + PI ++
Sbjct: 345 RACFAAPPGRKLILADYSQIELRVAAQISGDTRMISAYQQGEDLHLLTASLVAHKPIAEI 404

Query: 425 SKEQRAIGKVMELALGYQGGAKVFKTMASH---CGLDLQQFSQ----NVKSTSTFEDWEQ 477
           + ++R   K +   L +  GA   +  A       + L+Q ++      K+ +    W Q
Sbjct: 405 TPQERQAAKAVNFGLIFGMGAPGLQQYAQQNYGVEMSLEQATEFRERFFKAYTGIHRWHQ 464

Query: 478 AESHHLWMQDQ--------YPEFA-----VKDKLIGTACELVKKA 509
           +   HL  + +        Y E A         + GTA ++VKKA
Sbjct: 465 SIKAHLPKEGRTLAGRKFVYYEKAGLPGYYNTPVQGTAADIVKKA 509


>gi|167915856|ref|ZP_02502947.1| DNA polymerase I [Burkholderia pseudomallei 112]
          Length = 618

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 379 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 438

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 439 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 469


>gi|297587691|ref|ZP_06946335.1| DNA-directed DNA polymerase I [Finegoldia magna ATCC 53516]
 gi|297574380|gb|EFH93100.1| DNA-directed DNA polymerase I [Finegoldia magna ATCC 53516]
          Length = 875

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 69/153 (45%), Gaps = 25/153 (16%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           ++ + + +  DG++  T Q    ++TGR S      QN+P   R+EE             
Sbjct: 589 IDGMVDLIKEDGKIHTTFQ-QTIAQTGRISSTNPNLQNIPI--RTEE------------- 632

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
                       +R   + S G  L+ AD + IE RVLA +A ++  I AF NG DI+  
Sbjct: 633 ---------GRLIRKAFVPSQGSVLLDADYSQIELRVLADLANDEVMIDAFKNGADIHRK 683

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGG 444
           T ++ F    DKV+  QR+  K +   + Y  G
Sbjct: 684 TASEVFKVDFDKVTSLQRSNAKAVNFGIVYGIG 716


>gi|301169575|emb|CBW29176.1| fused DNA polymerase I 5'->3' exonuclease/3'->5' polymerase/3'->5'
           exonuclease [Haemophilus influenzae 10810]
          Length = 935

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 81/175 (46%), Gaps = 31/175 (17%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 697 IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 756

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ EQR   K +   L Y  G   F  ++   G+                  +QQF  ++
Sbjct: 757 VTSEQRRNAKAINFGLIY--GMSAFG-LSRQLGISRPDAQKYMDLYFQRYPSVQQFMTDI 813

Query: 467 KSTSTFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           +  +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 814 REKAKTQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 868


>gi|167724604|ref|ZP_02407840.1| DNA polymerase I [Burkholderia pseudomallei DM98]
          Length = 620

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 381 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 440

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 441 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 471


>gi|167743555|ref|ZP_02416329.1| DNA polymerase I [Burkholderia pseudomallei 14]
          Length = 619

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 380 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 439

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 440 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 470


>gi|256830888|ref|YP_003159616.1| DNA polymerase I [Desulfomicrobium baculatum DSM 4028]
 gi|256580064|gb|ACU91200.1| DNA polymerase I [Desulfomicrobium baculatum DSM 4028]
          Length = 861

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 100/246 (40%), Gaps = 58/246 (23%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           L  + +    +GR+  T     A+ TGR S      QN+P +                  
Sbjct: 576 LEPMPQLADKNGRIHTTFNQL-ATATGRLSSSNPNLQNIPIR------------------ 616

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
                 G     +RSC +AS G +LV AD + IE RVLA ++G+    +AFA G+DI+  
Sbjct: 617 ------GALGPRMRSCFVASPGNRLVAADYSQIELRVLAHMSGDQTLTEAFAAGDDIHAR 670

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQ--------FS 463
           T    F+T   +VS ++R   K +   L Y  G    + +    G+ L++        FS
Sbjct: 671 TAGILFDT--TEVSADERRKAKTINFGLLYGMGP---QKLGRELGISLKEAKEFIAVYFS 725

Query: 464 QNVKSTSTFEDWE--------------------QAESHHLWMQDQYPEFAVKDKLIGTAC 503
           +  +    +E+ E                    +  S +  M  Q    A+   + G+A 
Sbjct: 726 KLSRVREFYEEIEAGAKSLGYVTTLAGRRRMLPEINSRNTNMAQQARRMAINTVVQGSAA 785

Query: 504 ELVKKA 509
           +++KKA
Sbjct: 786 DIIKKA 791


>gi|330821221|ref|YP_004350083.1| DNA polymerase I [Burkholderia gladioli BSR3]
 gi|327373216|gb|AEA64571.1| DNA polymerase I [Burkholderia gladioli BSR3]
          Length = 919

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IAS G ++V AD + IE R++A I+ ++  ++AF+ GEDI+  T A+ F     +
Sbjct: 680 IREAFIASPGCRIVSADYSQIELRIMAHISEDESLLRAFSQGEDIHRATAAEVFGVTPLE 739

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           VS +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 740 VSNDQRRIAKVINFGLIY--GMSAFG-LASNLGI 770


>gi|260220821|emb|CBA28770.1| DNA polymerase I [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 542

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 54/95 (56%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           VR   +A+ G  +  AD + IE R++A I+ +   ++AF +G D++  T A+ F  P+D+
Sbjct: 303 VREAFVAAPGCVIASADYSQIELRIMAHISDDPALLRAFHDGLDVHRATAAEVFGVPVDQ 362

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           VS EQR   KV+   L Y  G   F  +A + G+D
Sbjct: 363 VSSEQRRYAKVINFGLIY--GMSAF-GLARNLGID 394


>gi|331006814|ref|ZP_08330074.1| DNA polymerase I [gamma proteobacterium IMCC1989]
 gi|330419366|gb|EGG93772.1| DNA polymerase I [gamma proteobacterium IMCC1989]
          Length = 782

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 58/102 (56%), Gaps = 6/102 (5%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K++ AD + IE R++A ++G++  ++AF  G+D++  T A+ F   +D+
Sbjct: 537 IRQAFVAPKGYKILAADYSQIELRIMAHLSGDEGLLEAFNQGKDVHSATAAEVFGVELDQ 596

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL---DLQQF 462
           V++EQR   K +   L Y  G   F  +A   G+   D QQ+
Sbjct: 597 VTQEQRRRAKAINFGLIY--GMSAFG-LAKQLGVGRNDAQQY 635


>gi|126456399|ref|YP_001076435.1| DNA polymerase I [Burkholderia pseudomallei 1106a]
 gi|242312260|ref|ZP_04811277.1| DNA polymerase I [Burkholderia pseudomallei 1106b]
 gi|126230167|gb|ABN93580.1| DNA polymerase I [Burkholderia pseudomallei 1106a]
 gi|242135499|gb|EES21902.1| DNA polymerase I [Burkholderia pseudomallei 1106b]
          Length = 923

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 774


>gi|261366357|ref|ZP_05979240.1| DNA polymerase I [Subdoligranulum variabile DSM 15176]
 gi|282571960|gb|EFB77495.1| DNA polymerase I [Subdoligranulum variabile DSM 15176]
          Length = 837

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 87/187 (46%), Gaps = 31/187 (16%)

Query: 260 TLKSILSHSN-ITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTG 318
           TL+S+  +S  I Q+ K     +L S+      +  L  A ++DGR+  T      +RTG
Sbjct: 523 TLESLRPYSPVIDQILKYRTYAKLLST-----YVEGLLSAQAADGRVHSTF-IQTEARTG 576

Query: 319 RWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVV 378
           R S      QN+P                     I   LG     +R   +A  GK+LV 
Sbjct: 577 RISSTEPNLQNIP---------------------IRTELG---SRLRGFFVAGAGKELVD 612

Query: 379 ADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELA 438
           AD + IE R+LA I G++   +AF +G DI+ +T AK ++ P  +V+ + R+  K +   
Sbjct: 613 ADYSQIELRILAHITGDEAMQQAFLHGADIHRSTAAKIYHIPESEVTPQLRSASKAINFG 672

Query: 439 LGYQGGA 445
           + Y  GA
Sbjct: 673 IMYGKGA 679


>gi|167829103|ref|ZP_02460574.1| DNA polymerase I [Burkholderia pseudomallei 9]
          Length = 923

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 774


>gi|226195875|ref|ZP_03791462.1| DNA polymerase I [Burkholderia pseudomallei Pakistan 9]
 gi|225932360|gb|EEH28360.1| DNA polymerase I [Burkholderia pseudomallei Pakistan 9]
          Length = 876

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 637 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 696

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 697 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 727


>gi|53716619|ref|YP_105127.1| DNA polymerase I [Burkholderia mallei ATCC 23344]
 gi|121597404|ref|YP_991095.1| DNA polymerase I [Burkholderia mallei SAVP1]
 gi|124381759|ref|YP_001025495.1| DNA polymerase I [Burkholderia mallei NCTC 10229]
 gi|126446346|ref|YP_001077557.1| DNA polymerase I [Burkholderia mallei NCTC 10247]
 gi|167000295|ref|ZP_02266114.1| DNA polymerase I [Burkholderia mallei PRL-20]
 gi|238561508|ref|ZP_00441953.2| DNA polymerase I [Burkholderia mallei GB8 horse 4]
 gi|254177233|ref|ZP_04883889.1| DNA polymerase I [Burkholderia mallei ATCC 10399]
 gi|254203066|ref|ZP_04909428.1| DNA polymerase I [Burkholderia mallei FMH]
 gi|254208399|ref|ZP_04914748.1| DNA polymerase I [Burkholderia mallei JHU]
 gi|254359414|ref|ZP_04975686.1| DNA polymerase I [Burkholderia mallei 2002721280]
 gi|52422589|gb|AAU46159.1| DNA polymerase I [Burkholderia mallei ATCC 23344]
 gi|121225202|gb|ABM48733.1| DNA polymerase I [Burkholderia mallei SAVP1]
 gi|126239200|gb|ABO02312.1| DNA-directed DNA polymerase [Burkholderia mallei NCTC 10247]
 gi|147746111|gb|EDK53189.1| DNA polymerase I [Burkholderia mallei FMH]
 gi|147751086|gb|EDK58154.1| DNA polymerase I [Burkholderia mallei JHU]
 gi|148028601|gb|EDK86561.1| DNA polymerase I [Burkholderia mallei 2002721280]
 gi|160698273|gb|EDP88243.1| DNA polymerase I [Burkholderia mallei ATCC 10399]
 gi|238524488|gb|EEP87921.1| DNA polymerase I [Burkholderia mallei GB8 horse 4]
 gi|243063777|gb|EES45963.1| DNA polymerase I [Burkholderia mallei PRL-20]
 gi|261826488|gb|ABN00542.2| DNA-directed DNA polymerase [Burkholderia mallei NCTC 10229]
          Length = 926

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 687 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 746

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 747 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 777


>gi|237507804|ref|ZP_04520519.1| DNA polymerase I [Burkholderia pseudomallei MSHR346]
 gi|235000009|gb|EEP49433.1| DNA polymerase I [Burkholderia pseudomallei MSHR346]
          Length = 923

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 774


>gi|167907515|ref|ZP_02494720.1| DNA polymerase I [Burkholderia pseudomallei NCTC 13177]
 gi|217422462|ref|ZP_03453965.1| DNA-directed DNA polymerase [Burkholderia pseudomallei 576]
 gi|254184913|ref|ZP_04891502.1| DNA polymerase I [Burkholderia pseudomallei 1655]
 gi|184215505|gb|EDU12486.1| DNA polymerase I [Burkholderia pseudomallei 1655]
 gi|217394693|gb|EEC34712.1| DNA-directed DNA polymerase [Burkholderia pseudomallei 576]
          Length = 923

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 774


>gi|291007053|ref|ZP_06565026.1| DNA polymerase I [Saccharopolyspora erythraea NRRL 2338]
          Length = 894

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 26/151 (17%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           ++ L ++++ DGR+  TL    A+ TGR S      QN+P   R+EE             
Sbjct: 608 VDGLVKSIADDGRIHTTLNQTIAA-TGRLSSTEPNLQNIPI--RTEE------------- 651

Query: 352 TIADPLGLASDCVRSCIIASNG-KKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYV 410
                       +R   +   G  +L+ AD + IE R++A ++G++  I+AF  GED++ 
Sbjct: 652 ---------GRRIREVFVVGEGYSELMTADYSQIEMRIMAHLSGDEGLIEAFRTGEDLHN 702

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
              ++AF  PID+V  E R   K M   L Y
Sbjct: 703 YVASRAFGVPIDEVDHELRRRVKAMSYGLAY 733


>gi|167923694|ref|ZP_02510785.1| DNA polymerase I [Burkholderia pseudomallei BCC215]
          Length = 923

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 774


>gi|134101936|ref|YP_001107597.1| DNA polymerase I [Saccharopolyspora erythraea NRRL 2338]
 gi|133914559|emb|CAM04672.1| DNA polymerase I [Saccharopolyspora erythraea NRRL 2338]
          Length = 895

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 26/151 (17%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           ++ L ++++ DGR+  TL    A+ TGR S      QN+P   R+EE             
Sbjct: 609 VDGLVKSIADDGRIHTTLNQTIAA-TGRLSSTEPNLQNIPI--RTEE------------- 652

Query: 352 TIADPLGLASDCVRSCIIASNG-KKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYV 410
                       +R   +   G  +L+ AD + IE R++A ++G++  I+AF  GED++ 
Sbjct: 653 ---------GRRIREVFVVGEGYSELMTADYSQIEMRIMAHLSGDEGLIEAFRTGEDLHN 703

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
              ++AF  PID+V  E R   K M   L Y
Sbjct: 704 YVASRAFGVPIDEVDHELRRRVKAMSYGLAY 734


>gi|126443368|ref|YP_001063539.1| DNA polymerase I [Burkholderia pseudomallei 668]
 gi|126222859|gb|ABN86364.1| DNA-directed DNA polymerase [Burkholderia pseudomallei 668]
          Length = 923

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 774


>gi|120553478|ref|YP_957829.1| DNA polymerase I [Marinobacter aquaeolei VT8]
 gi|120323327|gb|ABM17642.1| DNA polymerase I [Marinobacter aquaeolei VT8]
          Length = 908

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G KL+ AD + IE R++A ++G+   + AF +GEDI+  T A+ F   +D+
Sbjct: 668 IRQAFIAPKGYKLLAADYSQIELRIMAHLSGDRGLLTAFEHGEDIHKATAAEVFGVTVDE 727

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ +QR   K +   L Y
Sbjct: 728 VTGDQRRSAKAINFGLIY 745


>gi|303327432|ref|ZP_07357873.1| DNA polymerase I [Desulfovibrio sp. 3_1_syn3]
 gi|302862372|gb|EFL85305.1| DNA polymerase I [Desulfovibrio sp. 3_1_syn3]
          Length = 922

 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 69/155 (44%), Gaps = 25/155 (16%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           L+ L   V   GR+  T     A+ TGR S      QN+P                    
Sbjct: 632 LDPLPRLVDGQGRIHTTFN-QKATATGRLSSSNPNLQNIP-------------------- 670

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
            +  PLG     +R+C IA  G+ LV AD + +E RVLA ++ +   + AF  GEDI+  
Sbjct: 671 -VRGPLG---KRMRACFIAGPGRTLVSADYSQVELRVLAHMSQDAALLDAFRQGEDIHAR 726

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAK 446
           T A  ++    +VS +QR   K +   L Y  GA+
Sbjct: 727 TAALIYDLQAGEVSPDQRRNAKTINFGLIYGMGAQ 761


>gi|254193866|ref|ZP_04900298.1| DNA polymerase I [Burkholderia pseudomallei S13]
 gi|169650617|gb|EDS83310.1| DNA polymerase I [Burkholderia pseudomallei S13]
          Length = 923

 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 774


>gi|254301196|ref|ZP_04968640.1| DNA polymerase I [Burkholderia pseudomallei 406e]
 gi|157811158|gb|EDO88328.1| DNA polymerase I [Burkholderia pseudomallei 406e]
          Length = 923

 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 774


>gi|76818134|ref|YP_336009.1| DNA polymerase I [Burkholderia pseudomallei 1710b]
 gi|254186142|ref|ZP_04892660.1| DNA polymerase I [Burkholderia pseudomallei Pasteur 52237]
 gi|254264752|ref|ZP_04955617.1| DNA polymerase I [Burkholderia pseudomallei 1710a]
 gi|76582607|gb|ABA52081.1| DNA polymerase I [Burkholderia pseudomallei 1710b]
 gi|157933828|gb|EDO89498.1| DNA polymerase I [Burkholderia pseudomallei Pasteur 52237]
 gi|254215754|gb|EET05139.1| DNA polymerase I [Burkholderia pseudomallei 1710a]
          Length = 923

 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 774


>gi|53722791|ref|YP_111776.1| DNA polymerase I [Burkholderia pseudomallei K96243]
 gi|134278161|ref|ZP_01764875.1| DNA polymerase I [Burkholderia pseudomallei 305]
 gi|52213205|emb|CAH39245.1| DNA polymerase I [Burkholderia pseudomallei K96243]
 gi|134249945|gb|EBA50025.1| DNA polymerase I [Burkholderia pseudomallei 305]
          Length = 923

 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 774


>gi|322514149|ref|ZP_08067216.1| DNA-directed DNA polymerase I [Actinobacillus ureae ATCC 25976]
 gi|322119989|gb|EFX91987.1| DNA-directed DNA polymerase I [Actinobacillus ureae ATCC 25976]
          Length = 957

 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   I + G K+V AD + IE R++A +A ++  I AFA G+DI+  T A+ F   +D+
Sbjct: 719 IRQAFITNKGYKIVAADYSQIELRIMAHLANDEGMIIAFAEGKDIHRATAAEIFGLALDQ 778

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 779 VTSEQRRSAKAINFGLIY 796


>gi|16272796|ref|NP_439016.1| DNA polymerase I [Haemophilus influenzae Rd KW20]
 gi|260579947|ref|ZP_05847777.1| DNA-directed DNA polymerase I [Haemophilus influenzae RdAW]
 gi|1169402|sp|P43741|DPO1_HAEIN RecName: Full=DNA polymerase I; Short=POL I
 gi|1573871|gb|AAC22515.1| DNA polymerase I (polA) [Haemophilus influenzae Rd KW20]
 gi|260093231|gb|EEW77164.1| DNA-directed DNA polymerase I [Haemophilus influenzae RdAW]
          Length = 930

 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 81/175 (46%), Gaps = 31/175 (17%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 692 IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 751

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ EQR   K +   L Y  G   F  ++   G+                  +QQF  ++
Sbjct: 752 VTSEQRRNAKAINFGLIY--GMSAFG-LSRQLGISRADAQKYMDLYFQRYPSVQQFMTDI 808

Query: 467 KSTSTFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           +  +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 809 REKAKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 863


>gi|300309795|ref|YP_003773887.1| DNA polymerase I protein [Herbaspirillum seropedicae SmR1]
 gi|300072580|gb|ADJ61979.1| DNA polymerase I protein [Herbaspirillum seropedicae SmR1]
          Length = 920

 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 54/95 (56%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G  +V AD + IE R++A I+ ++  +KAFAN EDI+  T A+ F    ++
Sbjct: 681 IREAFVAPEGSVIVSADYSQIELRIMAHISEDENMLKAFANNEDIHRATAAEIFGIAPEQ 740

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           V  EQR   KV+   L Y  G   F  +AS+ G++
Sbjct: 741 VESEQRRYAKVINFGLIY--GMSAFG-LASNLGIE 772


>gi|145636579|ref|ZP_01792246.1| DNA polymerase I [Haemophilus influenzae PittHH]
 gi|145270105|gb|EDK10041.1| DNA polymerase I [Haemophilus influenzae PittHH]
          Length = 930

 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 81/175 (46%), Gaps = 31/175 (17%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 692 IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 751

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           V+ EQR   K +   L Y  G   F  ++   G+                  +QQF  ++
Sbjct: 752 VTSEQRRNAKAINFGLIY--GMSAFG-LSRQLGISRPDAQKYMDLYFQRYPSVQQFMTDI 808

Query: 467 KSTSTFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           +  +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 809 REKAKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 863


>gi|183597070|ref|ZP_02958563.1| hypothetical protein PROSTU_00309 [Providencia stuartii ATCC 25827]
 gi|188023732|gb|EDU61772.1| hypothetical protein PROSTU_00309 [Providencia stuartii ATCC 25827]
          Length = 930

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G K+V AD + IE R++A ++ +   + AFA G+DI+  T A+ F  P+D+
Sbjct: 691 IRQAFIARKGYKVVAADYSQIELRIMAHLSQDKGLLTAFAEGKDIHRATAAEVFGVPLDE 750

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ +QR   K +   L Y
Sbjct: 751 VTSDQRRSAKAINFGLIY 768


>gi|322835075|ref|YP_004215102.1| DNA polymerase I [Rahnella sp. Y9602]
 gi|321170276|gb|ADW75975.1| DNA polymerase I [Rahnella sp. Y9602]
          Length = 934

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA     ++ AD + IE R++A ++ ++  +KAFA G+DI+  T A+ F TP++K
Sbjct: 694 IRQAFIAPKDYIILAADYSQIELRIMAHLSKDEGLLKAFAEGKDIHRATAAEVFGTPLEK 753

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 754 VSGEQRRSAKAINFGLIY 771


>gi|317509158|ref|ZP_07966782.1| DNA polymerase I [Segniliparus rugosus ATCC BAA-974]
 gi|316252515|gb|EFV11961.1| DNA polymerase I [Segniliparus rugosus ATCC BAA-974]
          Length = 904

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 81/179 (45%), Gaps = 35/179 (19%)

Query: 280 NRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEI 339
            RL ++   ++K      A+  DGR+  T +    + TGR S      QN+P   R++E 
Sbjct: 610 TRLMTTAQGLIK------AIGPDGRIHTTFR-QDVAATGRLSSTDPNLQNIPV--RTDE- 659

Query: 340 LTQTIQALNRGETIADPLGLASDCVRSCIIASNGKK-LVVADLAGIEARVLAWIAGEDWK 398
                                +  +R   +   G + L+ AD + IE R++A ++G+D  
Sbjct: 660 ---------------------ARRIRGVFVVGEGHEALMTADYSQIEMRIMAHLSGDDGL 698

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           I+AF  GED++    ++AF  PID+V  E R   K M   L Y  G   F  +AS  G+
Sbjct: 699 IEAFRTGEDLHNFVASRAFGVPIDEVGAELRRRVKAMSYGLAY--GLSAFG-LASQLGV 754


>gi|271502639|ref|YP_003335665.1| DNA polymerase I [Dickeya dadantii Ech586]
 gi|270346194|gb|ACZ78959.1| DNA polymerase I [Dickeya dadantii Ech586]
          Length = 929

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G +++ AD + IE R++A ++ +   +KAF++G DI+  T A+ F  P+DK
Sbjct: 690 IRQAFIAPQGYQILAADYSQIELRIMAHLSRDAGLLKAFSDGLDIHRATAAEVFGLPLDK 749

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 750 VTTEQRRSAKAINFGLIY 767


>gi|302528122|ref|ZP_07280464.1| DNA polymerase I [Streptomyces sp. AA4]
 gi|302437017|gb|EFL08833.1| DNA polymerase I [Streptomyces sp. AA4]
          Length = 912

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 88/187 (47%), Gaps = 39/187 (20%)

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIA 354
           L ++V+ DGR+  TLQ   A+ TGR S      QN+P   R+EE           G  I 
Sbjct: 627 LIKSVADDGRIHTTLQQTIAA-TGRLSSIEPNLQNIPV--RTEE-----------GRRIR 672

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYA 414
           D          + ++     +L+ AD + IE R++A ++ ++  I+AF +GED++    +
Sbjct: 673 D----------AFVVGDGYAELMTADYSQIEMRIMAHLSKDEGLIEAFNSGEDLHTFVAS 722

Query: 415 KAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFED 474
           +AF+ P  +++ EQR   K M   L Y              GL     SQ +K  ST + 
Sbjct: 723 RAFSVPAAEITPEQRYRVKAMSYGLAY--------------GLSAYGLSQQLK-ISTEDA 767

Query: 475 WEQAESH 481
            EQ E++
Sbjct: 768 KEQMEAY 774


>gi|294084835|ref|YP_003551595.1| DNA polymerase I [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664410|gb|ADE39511.1| DNA polymerase I [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 976

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 63/140 (45%), Gaps = 27/140 (19%)

Query: 303 GRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLAS 361
           GR+  +    GAS TGR S      QN+P R     +I                      
Sbjct: 697 GRVHTSFSMVGAS-TGRLSSSDPNVQNIPIRTSEGRQI---------------------- 733

Query: 362 DCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPI 421
              R+  IA+ G KL+  D + IE R++A +AGE   I+AF +G DI+  T ++ F  P+
Sbjct: 734 ---RTAFIAAEGCKLISVDYSQIELRLVAHVAGEQSMIEAFKDGIDIHARTASEVFGIPL 790

Query: 422 DKVSKEQRAIGKVMELALGY 441
           D++  E R   K +   + Y
Sbjct: 791 DQMDSETRRRAKAINFGIIY 810


>gi|294777402|ref|ZP_06742853.1| DNA-directed DNA polymerase [Bacteroides vulgatus PC510]
 gi|294448470|gb|EFG17019.1| DNA-directed DNA polymerase [Bacteroides vulgatus PC510]
          Length = 971

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 62/118 (52%), Gaps = 5/118 (4%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   I  +G +   AD + IE R++A ++G+   I+AF  G+DI+  T AK +   IDK
Sbjct: 732 IRKAFIPDDGCEFFSADYSQIELRIMAHLSGDTNMIEAFKEGDDIHAATAAKVYKISIDK 791

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
           V++EQR+  K     + Y  G  VF  +A    +D ++  + +     FE + Q + +
Sbjct: 792 VTREQRSKAKTANFGIIY--GISVF-GLAERMNVDRKEAKELID--GYFETYPQIKEY 844


>gi|167566520|ref|ZP_02359436.1| DNA polymerase I [Burkholderia oklahomensis EO147]
          Length = 923

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 684 IREAFIAAPGCKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 774


>gi|313631120|gb|EFR98660.1| DNA polymerase [Listeria seeligeri FSL N1-067]
          Length = 80

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 42/69 (60%)

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           S  +R+  IA +G    + D + IEARV+AW+AGE W++  F +   IY  + ++ F+ P
Sbjct: 11  SQLIRTAFIAEDGYTFDITDFSAIEARVIAWLAGEQWRLDVFNSHGKIYEASASQMFHIP 70

Query: 421 IDKVSKEQR 429
           I++V K  R
Sbjct: 71  IEEVDKNLR 79


>gi|256823707|ref|YP_003147670.1| DNA polymerase I [Kangiella koreensis DSM 16069]
 gi|256797246|gb|ACV27902.1| DNA polymerase I [Kangiella koreensis DSM 16069]
          Length = 915

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%)

Query: 363 CVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPID 422
            +R+  IA  G K++ AD + IE R++A ++ ++  +KAF  G D++  T A+ F+ P+D
Sbjct: 676 SIRTAFIAPKGSKILAADYSQIELRIMAHLSQDEGLLKAFEEGLDVHSATAAEVFDVPLD 735

Query: 423 KVSKEQRAIGKVMELALGY 441
           +V+  QR   K +   L Y
Sbjct: 736 EVTSNQRRNAKAINFGLIY 754


>gi|167573600|ref|ZP_02366474.1| DNA polymerase I [Burkholderia oklahomensis C6786]
          Length = 923

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G K+V AD + IE R++A I+ ++  ++AFA+GEDI+  T A+ F     +
Sbjct: 684 IREAFIAAPGCKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           V+ +QR I KV+   L Y  G   F  +AS+ G+
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSFG-LASNLGI 774


>gi|113972232|ref|YP_736025.1| DNA polymerase I [Shewanella sp. MR-4]
 gi|113886916|gb|ABI40968.1| DNA polymerase I [Shewanella sp. MR-4]
          Length = 922

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G+K++ AD + IE R++A ++ +   +KAFA G+DI+  T A+ F T  D 
Sbjct: 682 IRQAFIAPQGRKILAADYSQIELRIMAHLSQDAGLLKAFAEGKDIHRATAAEVFGTDFDS 741

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 742 VTSEQRRRAKAVNFGLIY 759


>gi|117922540|ref|YP_871732.1| DNA polymerase I [Shewanella sp. ANA-3]
 gi|117614872|gb|ABK50326.1| DNA polymerase I [Shewanella sp. ANA-3]
          Length = 922

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G+K++ AD + IE R++A ++ +   +KAFA G+DI+  T A+ F T  D 
Sbjct: 682 IRQAFIAPQGRKILAADYSQIELRIMAHLSQDAGLLKAFAEGKDIHRATAAEVFGTDFDS 741

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 742 VTSEQRRRAKAVNFGLIY 759


>gi|150003775|ref|YP_001298519.1| DNA polymerase I [Bacteroides vulgatus ATCC 8482]
 gi|149932199|gb|ABR38897.1| DNA polymerase I [Bacteroides vulgatus ATCC 8482]
          Length = 971

 Score = 61.6 bits (148), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 62/118 (52%), Gaps = 5/118 (4%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   I  +G +   AD + IE R++A ++G+   I+AF  G+DI+  T AK +   IDK
Sbjct: 732 IRKAFIPDDGCEFFSADYSQIELRIMAHLSGDTNMIEAFKEGDDIHAATAAKVYKISIDK 791

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
           V++EQR+  K     + Y  G  VF  +A    +D ++  + +     FE + Q + +
Sbjct: 792 VTREQRSKAKTANFGIIY--GISVF-GLAERMNVDRKEAKELID--GYFETYPQIKEY 844


>gi|114049481|ref|YP_740031.1| DNA polymerase I [Shewanella sp. MR-7]
 gi|113890923|gb|ABI44974.1| DNA polymerase I [Shewanella sp. MR-7]
          Length = 922

 Score = 61.6 bits (148), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G+K++ AD + IE R++A ++ +   +KAFA G+DI+  T A+ F T  D 
Sbjct: 682 IRQAFIAPQGRKILAADYSQIELRIMAHLSQDAGLLKAFAEGKDIHRATAAEVFGTDFDS 741

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 742 VTSEQRRRAKAVNFGLIY 759


>gi|121587745|ref|ZP_01677506.1| DNA polymerase I [Vibrio cholerae 2740-80]
 gi|121548044|gb|EAX58122.1| DNA polymerase I [Vibrio cholerae 2740-80]
          Length = 525

 Score = 61.6 bits (148), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 3/94 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 285 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 344

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           VS EQR   K +   L Y  G   F  +A   G+
Sbjct: 345 VSSEQRRRAKAVNFGLIY--GMSAF-GLAKQLGI 375


>gi|160901568|ref|YP_001567149.1| DNA polymerase I [Petrotoga mobilis SJ95]
 gi|160359212|gb|ABX30826.1| DNA polymerase I [Petrotoga mobilis SJ95]
          Length = 896

 Score = 61.6 bits (148), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 62/139 (44%), Gaps = 24/139 (17%)

Query: 303 GRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASD 362
           GR+  +    G + TGR S      QNLP +E   E +  T++A               D
Sbjct: 629 GRVHTSFNQTGTA-TGRLSSSEPNLQNLPIREEDGERIRSTVKAQK------------DD 675

Query: 363 CVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPID 422
            V           L+ AD + IE RVLA +  ++  I AF NGEDI+  T A  F   ID
Sbjct: 676 YV-----------LLSADYSQIELRVLAHLTNDETLINAFNNGEDIHALTAAAIFGVKID 724

Query: 423 KVSKEQRAIGKVMELALGY 441
            V    R +GKV+  +L Y
Sbjct: 725 DVDYNMRRVGKVVNFSLVY 743


>gi|254463214|ref|ZP_05076630.1| DNA polymerase I superfamily [Rhodobacterales bacterium HTCC2083]
 gi|206679803|gb|EDZ44290.1| DNA polymerase I superfamily [Rhodobacteraceae bacterium HTCC2083]
          Length = 945

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 70/150 (46%), Gaps = 26/150 (17%)

Query: 293 NTLSEAVSSD-GRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           + L + ++ D GR+  +    GAS TGR +      QN+P   RSEE             
Sbjct: 658 DALQDHINPDTGRVHTSYSIAGAS-TGRLASTDPNLQNIPI--RSEE------------- 701

Query: 352 TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
                       +R   IA  GK LV  D + IE R+LA +AG D   +AF +G DI+  
Sbjct: 702 ---------GRRIREAFIAEEGKVLVALDYSQIELRILAHVAGIDSLKQAFRDGHDIHAM 752

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
           T ++ F+ P+D+++ + R   K +   + Y
Sbjct: 753 TASEMFDVPLDEMTADVRRQAKAINFGVIY 782


>gi|160944566|ref|ZP_02091794.1| hypothetical protein FAEPRAM212_02080 [Faecalibacterium prausnitzii
           M21/2]
 gi|158444348|gb|EDP21352.1| hypothetical protein FAEPRAM212_02080 [Faecalibacterium prausnitzii
           M21/2]
          Length = 857

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 73/164 (44%), Gaps = 32/164 (19%)

Query: 288 AILKLNT-----LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILT 341
           A  KLN+     L + +  DGR+  T     A RTGR S      QN+P R E   ++  
Sbjct: 562 AYQKLNSTYVEGLLKVIGEDGRIHSTFNQTEA-RTGRLSSDNPNLQNIPIRTELGSQL-- 618

Query: 342 QTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKA 401
                                  R+  +A  G  LV AD + IE R+LA I G++   +A
Sbjct: 619 -----------------------RAYFVAKPGCVLVDADYSQIELRILAHITGDEHMQQA 655

Query: 402 FANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGA 445
           F NGEDI+ +T AK +  P  +V+   R+  K +   + Y  GA
Sbjct: 656 FLNGEDIHRSTAAKIYGIPQSEVTPRLRSSAKAINFGIMYGKGA 699


>gi|242241361|ref|YP_002989542.1| DNA polymerase I [Dickeya dadantii Ech703]
 gi|242133418|gb|ACS87720.1| DNA polymerase I [Dickeya dadantii Ech703]
          Length = 931

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++ +   +KAF++G DI+  T A+ F  PIDK
Sbjct: 691 IRQAFIAPEGYCIVAADYSQIELRIMAHLSCDAGLLKAFSDGLDIHRATAAEVFGLPIDK 750

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 751 VTAEQRRSAKAINFGLIY 768


>gi|152980489|ref|YP_001352013.1| DNA polymerase I [Janthinobacterium sp. Marseille]
 gi|151280566|gb|ABR88976.1| DNA polymerase I [Janthinobacterium sp. Marseille]
          Length = 912

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 54/95 (56%), Gaps = 3/95 (3%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA+ G  +V AD + IE R++A I+G++  ++AFA+GEDI+  T A+ F      
Sbjct: 673 IREAFIAAPGNVIVSADYSQIELRIMAHISGDENMLQAFADGEDIHRATAAEIFGVERRA 732

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
           V  EQR   KV+   L Y  G   F  +A + G++
Sbjct: 733 VDSEQRRYAKVINFGLIY--GMSAF-GLAGNLGIE 764


>gi|323493194|ref|ZP_08098324.1| DNA polymerase I [Vibrio brasiliensis LMG 20546]
 gi|323312541|gb|EGA65675.1| DNA polymerase I [Vibrio brasiliensis LMG 20546]
          Length = 931

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 125/301 (41%), Gaps = 52/301 (17%)

Query: 162 YCKRDVEATRELFKRLIPLSDGERDLWLLDQTIN-------DRGYRI-----DLDLVLKL 209
           Y   D + T  L  RL+   D +  L  + Q I         R  R      D+ L  + 
Sbjct: 499 YAAEDADVTLRLHNRLMENIDQDEKLKAIYQDIEVPLVPVLSRIERTGVLIDDMKLAAQS 558

Query: 210 QELIAQERKKLDEDIVKLTDG--IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSH 267
           QE IAQ   +L++   ++ +    + S +Q  AL   LF   G+ ++  +     S  + 
Sbjct: 559 QE-IAQRLDELEQKAYEIAEQEFNMNSPKQLQAL---LFEKMGLPVIKKTPSGTPST-NE 613

Query: 268 SNITQLAKDLILNRLASSGSAILKLNT-----LSEAVSSD-GRLRGTLQFYGASRTGRWS 321
             + +LA D  L +L      + KL +     L + ++S+ GR+  T      + TGR S
Sbjct: 614 EVLQELALDYPLPKLILEYRGLAKLKSTYTDKLPKMINSETGRVH-TSYHQAVTATGRLS 672

Query: 322 GCVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVAD 380
                 QN+P R E    I                         R   +A +G K++  D
Sbjct: 673 STDPNLQNIPIRNEEGRRI-------------------------RQAFVAPHGYKIMAVD 707

Query: 381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALG 440
            + IE R++A ++G+   + AF  G+DI+  T A+   T ID+VS EQR   K +   L 
Sbjct: 708 YSQIELRIMAHLSGDQALLDAFQQGKDIHAATAAEIMGTTIDQVSSEQRRRAKAVNFGLI 767

Query: 441 Y 441
           Y
Sbjct: 768 Y 768


>gi|237709129|ref|ZP_04539610.1| DNA polymerase I [Bacteroides sp. 9_1_42FAA]
 gi|229456825|gb|EEO62546.1| DNA polymerase I [Bacteroides sp. 9_1_42FAA]
          Length = 971

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 62/118 (52%), Gaps = 5/118 (4%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   I  +G +   AD + IE R++A ++G+   I+AF  G+DI+  T AK +   IDK
Sbjct: 732 IRKAFIPDDGCEFFSADYSQIELRIMAHLSGDANMIEAFKEGDDIHAATAAKVYKISIDK 791

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
           V++EQR+  K     + Y  G  VF  +A    +D ++  + +     FE + Q + +
Sbjct: 792 VTREQRSKAKTANFGIIY--GISVF-GLAERMNVDRKEAKELID--GYFETYPQIKEY 844


>gi|238797621|ref|ZP_04641117.1| DNA polymerase I [Yersinia mollaretii ATCC 43969]
 gi|238718485|gb|EEQ10305.1| DNA polymerase I [Yersinia mollaretii ATCC 43969]
          Length = 932

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G +++ AD + IE R++A ++ ++  + AFA G+DI+  T A+ F  P++K
Sbjct: 692 IRQAFIAPQGYRIMAADYSQIELRIMAHLSQDEGLLTAFAAGKDIHRATAAEVFGLPLEK 751

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 752 VTSEQRRSAKAINFGLIY 769


>gi|145628242|ref|ZP_01784043.1| DNA polymerase I [Haemophilus influenzae 22.1-21]
 gi|145638340|ref|ZP_01793950.1| DNA polymerase I [Haemophilus influenzae PittII]
 gi|144980017|gb|EDJ89676.1| DNA polymerase I [Haemophilus influenzae 22.1-21]
 gi|145272669|gb|EDK12576.1| DNA polymerase I [Haemophilus influenzae PittII]
 gi|309751482|gb|ADO81466.1| DNA polymerase I [Haemophilus influenzae R2866]
          Length = 935

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 81/175 (46%), Gaps = 31/175 (17%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  +V AD + IE R++A ++G+   I AF+ G+DI+ +T A+ F   +D+
Sbjct: 697 IRQAFIAREGYSIVAADYSQIELRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDE 756

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           ++ EQR   K +   L Y  G   F  ++   G+                  +QQF  ++
Sbjct: 757 ITSEQRRNAKAINFGLIY--GMSAFG-LSRQLGISRADAQKYMDLYFQRYPSVQQFMTDI 813

Query: 467 KSTSTFEDW-EQAESHHLWMQDQYPEFAVKDK----------LIGTACELVKKAW 510
           +  +  + + E      L++ D     A++ K          + GTA +++K+A 
Sbjct: 814 REKAKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQGTAADIIKRAM 868


>gi|261250089|ref|ZP_05942666.1| DNA polymerase I [Vibrio orientalis CIP 102891]
 gi|260939593|gb|EEX95578.1| DNA polymerase I [Vibrio orientalis CIP 102891]
          Length = 931

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 81/174 (46%), Gaps = 31/174 (17%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA +G K++  D + IE R++A ++G+   ++AF  G+DI+  T A+   T ID+
Sbjct: 691 IRQAFIAPHGYKIMAVDYSQIELRIMAHLSGDKALLEAFQQGKDIHAATAAEIMGTTIDQ 750

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL-----------------DLQQFSQNV 466
           VS EQR   K +   L Y  G   F  +A   G+                  + Q+ ++ 
Sbjct: 751 VSSEQRRRAKAVNFGLIY--GMSAF-GLAKQLGIPRGEAQDYMNKYFERYPGVMQYMEDT 807

Query: 467 KSTSTFEDW-----------EQAESHHLWMQDQYPEFAVKDKLIGTACELVKKA 509
           +ST++ + +            + +S +   +      A+   + GTA +++KKA
Sbjct: 808 RSTASEQGYVETIYGRRLHLPEIQSRNGMRRKAAERAAINAPMQGTAADIIKKA 861


>gi|265752656|ref|ZP_06088225.1| DNA polymerase I [Bacteroides sp. 3_1_33FAA]
 gi|263235842|gb|EEZ21337.1| DNA polymerase I [Bacteroides sp. 3_1_33FAA]
          Length = 971

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 62/118 (52%), Gaps = 5/118 (4%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   I  +G +   AD + IE R++A ++G+   I+AF  G+DI+  T AK +   IDK
Sbjct: 732 IRKAFIPDDGCEFFSADYSQIELRIMAHLSGDANMIEAFKEGDDIHAATAAKVYKISIDK 791

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
           V++EQR+  K     + Y  G  VF  +A    +D ++  + +     FE + Q + +
Sbjct: 792 VTREQRSKAKTANFGIIY--GISVF-GLAERMNVDRKEAKELID--GYFETYPQIKEY 844


>gi|237724388|ref|ZP_04554869.1| DNA polymerase I [Bacteroides sp. D4]
 gi|229437257|gb|EEO47334.1| DNA polymerase I [Bacteroides dorei 5_1_36/D4]
          Length = 971

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 62/118 (52%), Gaps = 5/118 (4%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   I  +G +   AD + IE R++A ++G+   I+AF  G+DI+  T AK +   IDK
Sbjct: 732 IRKAFIPDDGCEFFSADYSQIELRIMAHLSGDANMIEAFKEGDDIHAATAAKVYKISIDK 791

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
           V++EQR+  K     + Y  G  VF  +A    +D ++  + +     FE + Q + +
Sbjct: 792 VTREQRSKAKTANFGIIY--GISVF-GLAERMNVDRKEAKELID--GYFETYPQIKEY 844


>gi|212692553|ref|ZP_03300681.1| hypothetical protein BACDOR_02050 [Bacteroides dorei DSM 17855]
 gi|212664838|gb|EEB25410.1| hypothetical protein BACDOR_02050 [Bacteroides dorei DSM 17855]
          Length = 971

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 62/118 (52%), Gaps = 5/118 (4%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   I  +G +   AD + IE R++A ++G+   I+AF  G+DI+  T AK +   IDK
Sbjct: 732 IRKAFIPDDGCEFFSADYSQIELRIMAHLSGDANMIEAFKEGDDIHAATAAKVYKISIDK 791

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
           V++EQR+  K     + Y  G  VF  +A    +D ++  + +     FE + Q + +
Sbjct: 792 VTREQRSKAKTANFGIIY--GISVF-GLAERMNVDRKEAKELID--GYFETYPQIKEY 844


>gi|261379438|ref|ZP_05984011.1| DNA polymerase I [Neisseria subflava NJ9703]
 gi|284797890|gb|EFC53237.1| DNA polymerase I [Neisseria subflava NJ9703]
          Length = 938

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 104/245 (42%), Gaps = 38/245 (15%)

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTY------ALRMYLFLITGIDLVDMSEGTLKSILS 266
           +A++  +L  +++KL      ++ Q +       L+  LF   GI    + +     I +
Sbjct: 551 LARQSAELGAELMKLEQEAYAAAGQPFNLNSPKQLQEILFDKMGIPTKGLKKTAKGGIST 610

Query: 267 HSNI-TQLAKDLILNRLASSGSAILKLNT-----LSEAVSS-DGRLRGTLQFYGASRTGR 319
           +  +  QLA D  L ++     ++ KL +     L E +S  DGR+  T      + TGR
Sbjct: 611 NEAVLEQLAPDYPLPKIILQNRSLAKLKSTYTDKLPEMISPKDGRVHTTYA-QAVAITGR 669

Query: 320 WSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVA 379
            +      QN+P   R+ E                         VR    A  G  +V A
Sbjct: 670 LASNNPNLQNIPI--RTAE----------------------GRRVRRAFTAPQGSVIVSA 705

Query: 380 DLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELAL 439
           D + IE R++A ++G+   I AF NGED++  T A+ F T  + VS EQR   K +   L
Sbjct: 706 DYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSSEQRRYAKTINFGL 765

Query: 440 GYQGG 444
            Y  G
Sbjct: 766 IYGMG 770


>gi|310826548|ref|YP_003958905.1| hypothetical protein ELI_0933 [Eubacterium limosum KIST612]
 gi|308738282|gb|ADO35942.1| hypothetical protein ELI_0933 [Eubacterium limosum KIST612]
          Length = 885

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 331 PRQERSEEILTQTIQALNRGETIADP----LGLASDC---VRSCIIASNGKKLVV-ADLA 382
           P+  +      QT+ A  R  + +DP    + + ++    +R   + S G +++V AD +
Sbjct: 606 PKTHKIYSTFNQTVTATGRLSS-SDPNLQNIPVKTEMGREIRKVFVPSAGDRVLVDADYS 664

Query: 383 GIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQ 442
            IE RVLA ++G++  I  F   +DI+  T ++ FN P+D VS+EQR+  K +   L Y 
Sbjct: 665 QIELRVLAHLSGDENLIDTFVKNQDIHTRTASEIFNVPMDAVSREQRSHAKAINFGLIY- 723

Query: 443 GGAKVF 448
            G + F
Sbjct: 724 -GKQAF 728


>gi|149917649|ref|ZP_01906145.1| DNA polymerase I [Plesiocystis pacifica SIR-1]
 gi|149821431|gb|EDM80831.1| DNA polymerase I [Plesiocystis pacifica SIR-1]
          Length = 898

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 136/314 (43%), Gaps = 46/314 (14%)

Query: 144 PYDCTRANHVQAWQLFGEYCKR-DVEATRELFKRL-IPLSDGERDLWLLDQTINDRGYRI 201
           P+ CT+   V A   F E  +R D E  R+  +++ +PLS      W+L Q   D G  I
Sbjct: 461 PWCCTQVEAVAA--AFVEIRERLDAEGHRDTLEQVSLPLS------WVLGQMELD-GVAI 511

Query: 202 DLDLVLKLQELIAQERKKLDEDIVKLT--DGIIRSSRQTYALRMYLFLITGIDLVDMSEG 259
           D + + K+ E   +   KL++ I ++   +  I SS+Q  A+      +  I        
Sbjct: 512 DSEDLGKMSEEFGERLAKLEKTIFEIAGREFNIASSKQLGAVLFDELELPVIKRTKTGYS 571

Query: 260 TLKSILSH-SNITQLAKDLILNRLASSGSAILKLNT----LSEAVSSD-GRLRGTLQFYG 313
           T   +L   +  T+  K  I   L         +NT    L  AV+ D GR+  T Q   
Sbjct: 572 TNAEVLERLAGKTKHPKHTIAKYLLEHRKLAKLINTYTDVLQAAVNPDSGRIHATFQ--- 628

Query: 314 ASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG 373
             +T   SG +   +  P  +R+                I  P G     VR   +   G
Sbjct: 629 --QTAGVSGRLITTE--PDLQRT---------------PIKTPEG---KRVRQAFVTRPG 666

Query: 374 KKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNT--PIDKVSKEQRAI 431
            KL+ AD + IE R+LA  + +   ++AFA G D++  T A+ F      +KVS+EQR +
Sbjct: 667 YKLISADWSQIELRLLAHFSSDAHLVEAFAKGLDVHARTAAQLFEVGGGPEKVSREQRGV 726

Query: 432 GKVMELALGYQGGA 445
           GK++  A  Y  GA
Sbjct: 727 GKLVNFATIYGQGA 740


>gi|254880993|ref|ZP_05253703.1| DNA polymerase I [Bacteroides sp. 4_3_47FAA]
 gi|319640001|ref|ZP_07994728.1| DNA polymerase I [Bacteroides sp. 3_1_40A]
 gi|254833786|gb|EET14095.1| DNA polymerase I [Bacteroides sp. 4_3_47FAA]
 gi|317388279|gb|EFV69131.1| DNA polymerase I [Bacteroides sp. 3_1_40A]
          Length = 971

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 62/118 (52%), Gaps = 5/118 (4%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   I  +G +   AD + IE R++A ++G+   I+AF  G+DI+  T AK +   IDK
Sbjct: 732 IRKAFIPDDGCEFFSADYSQIELRIMAHLSGDANMIEAFKEGDDIHAATAAKVYKISIDK 791

Query: 424 VSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESH 481
           V++EQR+  K     + Y  G  VF  +A    +D ++  + +     FE + Q + +
Sbjct: 792 VTREQRSKAKTANFGIIY--GISVF-GLAERMNVDRKEAKELID--GYFETYPQIKEY 844


>gi|119475294|ref|ZP_01615647.1| DNA polymerase I [marine gamma proteobacterium HTCC2143]
 gi|119451497|gb|EAW32730.1| DNA polymerase I [marine gamma proteobacterium HTCC2143]
          Length = 920

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (61%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           VR   +A +G K+V AD + IE R++A ++ ++  +KAFA G+DI+  T A+ F   +++
Sbjct: 681 VRQAFVARDGYKIVAADYSQIELRIMAHLSQDNGLLKAFAEGKDIHQATAAEVFGLELEQ 740

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 741 VSTEQRRRAKAINFGLIY 758


>gi|119946792|ref|YP_944472.1| fused DNA polymerase 5'->3' exonuclease and 3'->5' polymerase and
           3'->5' exonuclease [Psychromonas ingrahamii 37]
 gi|119865396|gb|ABM04873.1| fused DNA polymerase 5'->3' exonuclease and 3'->5' polymerase and
           3'->5' exonuclease [Psychromonas ingrahamii 37]
          Length = 938

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G K+V AD + IE R++A ++ +   + AF+ G+DI+  T ++ F+ P+D+
Sbjct: 698 IRQAFIAQPGYKIVAADYSQIELRIMAHLSQDKGLLDAFSTGKDIHKATASEVFSVPLDE 757

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 758 VTTEQRRSAKAINFGLIY 775


>gi|295103350|emb|CBL00894.1| DNA polymerase I [Faecalibacterium prausnitzii SL3/3]
          Length = 857

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 73/164 (44%), Gaps = 32/164 (19%)

Query: 288 AILKLNT-----LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILT 341
           A  KLN+     L + +  DGR+  T     A RTGR S      QN+P R E   ++  
Sbjct: 562 AYQKLNSTYVEGLLKVIGEDGRIHSTFNQTEA-RTGRLSSDNPNLQNIPIRTELGSQL-- 618

Query: 342 QTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKA 401
                                  R+  +A  G  LV AD + IE R+LA I G++   +A
Sbjct: 619 -----------------------RAYFVAKPGCVLVDADYSQIELRILAHITGDEHMQQA 655

Query: 402 FANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGA 445
           F NGEDI+ +T AK +  P  +V+   R+  K +   + Y  GA
Sbjct: 656 FLNGEDIHRSTAAKIYGIPQSEVTPRLRSSAKAINFGIMYGKGA 699


>gi|160892692|ref|ZP_02073482.1| hypothetical protein CLOL250_00222 [Clostridium sp. L2-50]
 gi|156865733|gb|EDO59164.1| hypothetical protein CLOL250_00222 [Clostridium sp. L2-50]
          Length = 878

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 68/156 (43%), Gaps = 30/156 (19%)

Query: 291 KLNT-----LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQ 345
           KLN+     L+  +S DGR+ GT      + TGR S      QN+P +            
Sbjct: 586 KLNSTYAQGLTAYISEDGRIHGTFN-QTITATGRISSTDPNLQNIPMK------------ 632

Query: 346 ALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
            L  G             +R   I  +G   V AD + IE RVLA ++ +     AF N 
Sbjct: 633 -LELGR-----------LIRKAFIPEDGYVFVDADYSQIELRVLAHLSEDQVMQNAFLNH 680

Query: 406 EDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            DI+ TT ++ F+ PID+V+  QR   K +   + Y
Sbjct: 681 VDIHATTASEVFDVPIDQVTSLQRRNAKAVNFGIVY 716


>gi|315106932|gb|EFT78908.1| hypothetical protein HMPREF9601_00873 [Propionibacterium acnes
           HL030PA1]
          Length = 112

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 53/110 (48%), Gaps = 13/110 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLC--AYAWDDEPVKLWDRTEQSAMPSDLL 58
           M ++ IDIET SP PL K GV+ YAE     L    Y+ D  PV++ D      +P ++L
Sbjct: 1   MRQIAIDIETFSPAPLAKTGVYPYAEHPDFRLLIFGYSIDGGPVEVVDLASGGGLPDEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL----------GIDIPSKRWICTSV 98
             L D  V   AHN+ FER+     L          G   PS+ W CT V
Sbjct: 61  AALVDPGVAKWAHNAAFERVALSAWLQRHHPELLAAGFLDPSQ-WRCTMV 109


>gi|238898050|ref|YP_002923731.1| multifunctional DNA polymerase I: 5'->3' exonuclease (N-terminal);
           3'->5' polymerase; 3'->5' exonuclease (C-terminal)
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229465809|gb|ACQ67583.1| multifunctional DNA polymerase I: 5'->3' exonuclease (N-terminal);
           3'->5' polymerase; 3'->5' exonuclease (C-terminal)
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 963

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G ++V AD + IE R++A ++ +   + AF+ G+DI++ T A+ F  P+ +
Sbjct: 717 IRHAFIAPRGYQIVAADYSQIELRIMAHLSQDQGLLNAFSEGQDIHLITAAEVFGLPVSQ 776

Query: 424 VSKEQRAIGKVMELALGY 441
           VS +QR   K +   L Y
Sbjct: 777 VSAQQRRSAKAINFGLIY 794


>gi|213963385|ref|ZP_03391641.1| DNA polymerase type I [Capnocytophaga sputigena Capno]
 gi|213954053|gb|EEB65379.1| DNA polymerase type I [Capnocytophaga sputigena Capno]
          Length = 928

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 81/309 (26%), Positives = 126/309 (40%), Gaps = 65/309 (21%)

Query: 161 EYCKRDVEAT---RELFKRLIP-------LSDGERDLWLLDQTINDRGYRIDLDLVLKLQ 210
           EY   D + T   + +F+  +P        +D E  L  +   +   G  +D+D      
Sbjct: 495 EYAVEDADVTWQLKNVFQSQMPQVNAQKIYTDLEAPLIKVLAAMEREGVNLDVDF----- 549

Query: 211 ELIAQERKKLDEDIVKLTDGIIRSSRQTYALRM------YLFLITGIDLVDMSEGTLKSI 264
             + +  K LD DI +L   I + + +T+ L         LF    ID       T +  
Sbjct: 550 --LKEYSKTLDADIAQLETAIAQQAGETFNLASPKQLGDILFEKLKIDSKPKKTKTGQYA 607

Query: 265 LSHSNITQLAK------DLI----LNRLASSGSAILKLNTLSEAVSSDGRLRGT-LQFYG 313
            S   +   A       D++    + +L S+    L L    E   S GR+  T +Q   
Sbjct: 608 TSEEVLAPFAAKHKIVADILEWRQVQKLKSTYVDALPL----EVNKSTGRVHTTYMQTVA 663

Query: 314 ASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG 373
           A  TGR S      QN+P                     I  P G     VR   IA N 
Sbjct: 664 A--TGRLSSNNPNLQNIP---------------------IRTPRG---QQVRKAFIARNP 697

Query: 374 KK-LVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIG 432
              L+ AD + IE R++A ++ E   I++F +GEDI+  T AK FN P+++V++EQR+  
Sbjct: 698 DYVLLSADYSQIELRIIAALSEEHNMIESFLHGEDIHRATAAKVFNVPLEEVTREQRSHA 757

Query: 433 KVMELALGY 441
           K +   + Y
Sbjct: 758 KTVNFGIIY 766


>gi|297581848|ref|ZP_06943769.1| DNA polymerase I [Vibrio cholerae RC385]
 gi|297533942|gb|EFH72782.1| DNA polymerase I [Vibrio cholerae RC385]
          Length = 934

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 694 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 753

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 754 VSSEQRRRAKAVNFGLIY 771


>gi|293393657|ref|ZP_06637967.1| DNA-directed DNA polymerase I [Serratia odorifera DSM 4582]
 gi|291423992|gb|EFE97211.1| DNA-directed DNA polymerase I [Serratia odorifera DSM 4582]
          Length = 933

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (57%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G ++V AD + IE R++A ++ +   + AFA G+DI+  T  + F  P+DK
Sbjct: 693 IRQAFIAPAGYRIVAADYSQIELRIMAHLSQDRGLLNAFAAGKDIHRATAGEVFGLPLDK 752

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 753 VTNEQRRSAKAINFGLIY 770


>gi|288800530|ref|ZP_06405988.1| DNA polymerase type I [Prevotella sp. oral taxon 299 str. F0039]
 gi|288332743|gb|EFC71223.1| DNA polymerase type I [Prevotella sp. oral taxon 299 str. F0039]
          Length = 921

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R C I + G     AD + IE R++A ++G++  I+AF  G DI+  T AK +  PID+
Sbjct: 682 IRKCFIPNEGCLFFSADYSQIELRIMAHLSGDENMIEAFIEGHDIHAATAAKIYKKPIDE 741

Query: 424 VSKEQRAIGKVMELALGYQGGAKVF 448
           V++++R   K     + Y  G  VF
Sbjct: 742 VTRDERTKAKRANFGIIY--GITVF 764


>gi|92112681|ref|YP_572609.1| DNA polymerase I [Chromohalobacter salexigens DSM 3043]
 gi|91795771|gb|ABE57910.1| DNA polymerase I [Chromohalobacter salexigens DSM 3043]
          Length = 928

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G ++V AD + IE R++A ++G+   + AFA G DI+  T A+ F   +D 
Sbjct: 689 IRQAFVARPGYRIVAADYSQIELRIMAHLSGDKGLLDAFAEGRDIHTATAAEVFGVALDA 748

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 749 VSGEQRRSAKAINFGLIY 766


>gi|229527149|ref|ZP_04416543.1| DNA polymerase I [Vibrio cholerae 12129(1)]
 gi|229335380|gb|EEO00863.1| DNA polymerase I [Vibrio cholerae 12129(1)]
          Length = 906

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 666 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 725

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 726 VSSEQRRRAKAVNFGLIY 743


>gi|153214860|ref|ZP_01949668.1| DNA polymerase I [Vibrio cholerae 1587]
 gi|153826297|ref|ZP_01978964.1| DNA polymerase I [Vibrio cholerae MZO-2]
 gi|124115103|gb|EAY33923.1| DNA polymerase I [Vibrio cholerae 1587]
 gi|149739965|gb|EDM54144.1| DNA polymerase I [Vibrio cholerae MZO-2]
          Length = 886

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 646 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 705

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 706 VSSEQRRRAKAVNFGLIY 723


>gi|153953306|ref|YP_001394071.1| DNA polymerase I [Clostridium kluyveri DSM 555]
 gi|219853937|ref|YP_002471059.1| hypothetical protein CKR_0594 [Clostridium kluyveri NBRC 12016]
 gi|146346187|gb|EDK32723.1| PolA [Clostridium kluyveri DSM 555]
 gi|219567661|dbj|BAH05645.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 880

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 67/151 (44%), Gaps = 26/151 (17%)

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLP-RQERSEEILTQTIQALNRGETI 353
           L   +  DG++         + TGR S      QN+P + E  +EI         R   I
Sbjct: 596 LKGVIEEDGKIHSNFN-QTVTTTGRLSSTEPNLQNIPIKYEMGKEI---------RKIFI 645

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTY 413
            D         R C+I S       AD + IE RVLA I+G++  I AF N  DI+  T 
Sbjct: 646 PDN--------RDCVILS-------ADYSQIELRVLAHISGDENLINAFINHNDIHTKTA 690

Query: 414 AKAFNTPIDKVSKEQRAIGKVMELALGYQGG 444
           ++ FN P+ +V+  QR+  K +   + Y  G
Sbjct: 691 SEVFNVPLGEVTSTQRSNAKAVNFGIVYGIG 721


>gi|251791718|ref|YP_003006439.1| DNA polymerase I [Dickeya zeae Ech1591]
 gi|247540339|gb|ACT08960.1| DNA polymerase I [Dickeya zeae Ech1591]
          Length = 928

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G  ++ AD + IE R++A ++ +   ++AF+NG DI+  T A+ F  P+D+
Sbjct: 689 IRQAFIAPEGYHILAADYSQIELRIMAHLSRDAGLLRAFSNGLDIHRATAAEVFGLPLDR 748

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 749 VTTEQRRSAKAINFGLIY 766


>gi|238785638|ref|ZP_04629616.1| DNA polymerase I [Yersinia bercovieri ATCC 43970]
 gi|238713473|gb|EEQ05507.1| DNA polymerase I [Yersinia bercovieri ATCC 43970]
          Length = 932

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   IA  G +++ AD + IE R++A ++ ++  + AFA G+DI+  T A+ F  P++K
Sbjct: 692 IRQAFIAPKGYRIMAADYSQIELRIMAHLSQDEGLLAAFAAGKDIHRATAAEVFGLPLEK 751

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 752 VTTEQRRSAKAINFGLIY 769


>gi|327483012|gb|AEA77419.1| DNA polymerase I [Vibrio cholerae LMA3894-4]
          Length = 934

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 694 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 753

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 754 VSSEQRRRAKAVNFGLIY 771


>gi|262151175|ref|ZP_06028314.1| DNA polymerase I [Vibrio cholerae INDRE 91/1]
 gi|262031069|gb|EEY49694.1| DNA polymerase I [Vibrio cholerae INDRE 91/1]
          Length = 890

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 650 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 709

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 710 VSSEQRRRAKAVNFGLIY 727


>gi|229520098|ref|ZP_04409526.1| DNA polymerase I [Vibrio cholerae TM 11079-80]
 gi|229342886|gb|EEO07876.1| DNA polymerase I [Vibrio cholerae TM 11079-80]
          Length = 906

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 666 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 725

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 726 VSSEQRRRAKAVNFGLIY 743


>gi|146299377|ref|YP_001193968.1| DNA polymerase I [Flavobacterium johnsoniae UW101]
 gi|146153795|gb|ABQ04649.1| DNA polymerase I [Flavobacterium johnsoniae UW101]
          Length = 949

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 61/127 (48%), Gaps = 27/127 (21%)

Query: 317 TGRWSGCVFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASN-GK 374
           TGR S      QN+P R ER  +I                         R   +A +   
Sbjct: 686 TGRLSSNNPNLQNIPIRTERGRQI-------------------------RKAFVARDENY 720

Query: 375 KLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKV 434
            L+ AD + IE R++A ++GE+  I AF NGEDI+  T AK F+  +++VS+EQR+  K 
Sbjct: 721 TLISADYSQIELRIIAALSGEENMIAAFQNGEDIHRATAAKVFDVALEEVSREQRSNAKT 780

Query: 435 MELALGY 441
           +   + Y
Sbjct: 781 VNFGIIY 787


>gi|147675220|ref|YP_001218310.1| DNA polymerase I [Vibrio cholerae O395]
 gi|262167045|ref|ZP_06034762.1| DNA polymerase I [Vibrio cholerae RC27]
 gi|146317103|gb|ABQ21642.1| DNA polymerase I [Vibrio cholerae O395]
 gi|227011890|gb|ACP08100.1| DNA polymerase I [Vibrio cholerae O395]
 gi|262024563|gb|EEY43247.1| DNA polymerase I [Vibrio cholerae RC27]
          Length = 934

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 694 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 753

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 754 VSSEQRRRAKAVNFGLIY 771


>gi|229508387|ref|ZP_04397891.1| DNA polymerase I [Vibrio cholerae BX 330286]
 gi|229508932|ref|ZP_04398422.1| DNA polymerase I [Vibrio cholerae B33]
 gi|229517046|ref|ZP_04406492.1| DNA polymerase I [Vibrio cholerae RC9]
 gi|229606661|ref|YP_002877309.1| DNA polymerase I [Vibrio cholerae MJ-1236]
 gi|229346109|gb|EEO11081.1| DNA polymerase I [Vibrio cholerae RC9]
 gi|229354049|gb|EEO18982.1| DNA polymerase I [Vibrio cholerae B33]
 gi|229354660|gb|EEO19582.1| DNA polymerase I [Vibrio cholerae BX 330286]
 gi|229369316|gb|ACQ59739.1| DNA polymerase I [Vibrio cholerae MJ-1236]
          Length = 906

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 666 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 725

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 726 VSSEQRRRAKAVNFGLIY 743


>gi|254226589|ref|ZP_04920170.1| DNA polymerase I [Vibrio cholerae V51]
 gi|125620861|gb|EAZ49214.1| DNA polymerase I [Vibrio cholerae V51]
          Length = 930

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 690 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 749

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 750 VSSEQRRRAKAVNFGLIY 767


>gi|126734956|ref|ZP_01750702.1| DNA polymerase I [Roseobacter sp. CCS2]
 gi|126715511|gb|EBA12376.1| DNA polymerase I [Roseobacter sp. CCS2]
          Length = 938

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 120/272 (44%), Gaps = 44/272 (16%)

Query: 184 ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRM 243
           ER L  +   +   G ++D D + ++    AQ+   L+++I ++  G   +      L  
Sbjct: 534 ERPLVPVLAQMERHGIKVDRDTLSRMSNAFAQKMAGLEDEIQEMA-GRPFNVGSPKQLGE 592

Query: 244 YLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLI--------------LNRLASSGSAI 289
            LF   G+++ D  + +     ++S    + +DL               L++L S+ +  
Sbjct: 593 ILFDEMGLEMPDGKKPSTGKTGAYSTGADVLEDLATLHDMPRRILDWRQLSKLKSTYTDA 652

Query: 290 LKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNR 349
           L+ +  +E     GR+  +    GA+ TGR +      QN+P   RSEE           
Sbjct: 653 LQEHINAET----GRVHTSYSIAGAN-TGRLASTDPNLQNIPV--RSEE----------- 694

Query: 350 GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIY 409
           G  I           R   +A +GK +V  D + IE R+LA IAG D   +AF +G DI+
Sbjct: 695 GRRI-----------REAFVAEDGKVIVSLDYSQIELRILAHIAGIDALKQAFLDGIDIH 743

Query: 410 VTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
             T ++ F+ P+D+++ + R   K +   + Y
Sbjct: 744 AMTASEMFDVPLDEMTPDVRRQAKAINFGVIY 775


>gi|15640140|ref|NP_229767.1| DNA polymerase I [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|153822326|ref|ZP_01974993.1| DNA polymerase I [Vibrio cholerae B33]
 gi|227080344|ref|YP_002808895.1| DNA polymerase I [Vibrio cholerae M66-2]
 gi|255743936|ref|ZP_05417891.1| DNA polymerase I [Vibrio cholera CIRS 101]
 gi|298501121|ref|ZP_07010921.1| DNA polymerase I [Vibrio cholerae MAK 757]
 gi|9654507|gb|AAF93286.1| DNA polymerase I [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|126520152|gb|EAZ77375.1| DNA polymerase I [Vibrio cholerae B33]
 gi|227008232|gb|ACP04444.1| DNA polymerase I [Vibrio cholerae M66-2]
 gi|255738419|gb|EET93809.1| DNA polymerase I [Vibrio cholera CIRS 101]
 gi|297540155|gb|EFH76216.1| DNA polymerase I [Vibrio cholerae MAK 757]
          Length = 934

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 694 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 753

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 754 VSSEQRRRAKAVNFGLIY 771


>gi|37524397|ref|NP_927741.1| DNA polymerase I [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36783821|emb|CAE12681.1| DNA polymerase I [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 929

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 47/78 (60%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G +++ AD + IE R++A ++ +   +KAFA G+DI+  T A+ F  P+++
Sbjct: 690 IRQAFVAPEGYRIMAADYSQIELRIMAHLSQDQGLLKAFAEGKDIHRATAAEVFGLPLEQ 749

Query: 424 VSKEQRAIGKVMELALGY 441
           V+ EQR   K +   L Y
Sbjct: 750 VTSEQRRSAKAINFGLIY 767


>gi|153830617|ref|ZP_01983284.1| DNA polymerase I [Vibrio cholerae 623-39]
 gi|148873889|gb|EDL72024.1| DNA polymerase I [Vibrio cholerae 623-39]
          Length = 934

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 694 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 753

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 754 VSSEQRRRAKAVNFGLIY 771


>gi|229515857|ref|ZP_04405315.1| DNA polymerase I [Vibrio cholerae TMA 21]
 gi|229347120|gb|EEO12081.1| DNA polymerase I [Vibrio cholerae TMA 21]
          Length = 906

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 666 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 725

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 726 VSSEQRRRAKAVNFGLIY 743


>gi|229525005|ref|ZP_04414410.1| DNA polymerase I [Vibrio cholerae bv. albensis VL426]
 gi|229338586|gb|EEO03603.1| DNA polymerase I [Vibrio cholerae bv. albensis VL426]
          Length = 906

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 666 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 725

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 726 VSSEQRRRAKAVNFGLIY 743


>gi|86157736|ref|YP_464521.1| DNA polymerase I [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774247|gb|ABC81084.1| DNA polymerase I [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 897

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 81/179 (45%), Gaps = 33/179 (18%)

Query: 270 ITQLAKDLILNRLASSGSAILKL-----NTLSEAV-SSDGRLRGTLQFYGASRTGRWSGC 323
           + +LA+   L RL     ++ KL     + L + V  +DGR+  T    GA+ TGR S  
Sbjct: 583 LEKLAEQHALPRLVLEHRSLSKLKGTYVDALPQLVDPADGRIHTTFHQAGAA-TGRLSSS 641

Query: 324 VFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLA 382
               QN+P R E S  I                         R   +A  G +L+ AD +
Sbjct: 642 DPNLQNIPVRTELSRRI-------------------------RQAFVAPAGARLLSADYS 676

Query: 383 GIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            IE R+LA  + +   ++AF + ED++  T A+ F    ++V+ +QR I KV+   + Y
Sbjct: 677 QIELRILAHYSDDPGLLQAFRDREDVHTRTAAETFGVAPEQVTPDQRRIAKVLNFGIAY 735


>gi|254851493|ref|ZP_05240843.1| DNA polymerase I [Vibrio cholerae MO10]
 gi|254847198|gb|EET25612.1| DNA polymerase I [Vibrio cholerae MO10]
          Length = 934

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 694 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 753

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 754 VSSEQRRRAKAVNFGLIY 771


>gi|197122953|ref|YP_002134904.1| DNA polymerase I [Anaeromyxobacter sp. K]
 gi|196172802|gb|ACG73775.1| DNA polymerase I [Anaeromyxobacter sp. K]
          Length = 897

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 81/179 (45%), Gaps = 33/179 (18%)

Query: 270 ITQLAKDLILNRLASSGSAILKL-----NTLSEAV-SSDGRLRGTLQFYGASRTGRWSGC 323
           + +LA+   L RL     ++ KL     + L + V  +DGR+  T    GA+ TGR S  
Sbjct: 583 LEKLAEQHALPRLVLEHRSLSKLKGTYVDALPQLVDPADGRIHTTFHQAGAA-TGRLSSS 641

Query: 324 VFQPQNLP-RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLA 382
               QN+P R E S  I                         R   +A  G +L+ AD +
Sbjct: 642 DPNLQNIPVRTELSRRI-------------------------RQAFVAPAGARLLSADYS 676

Query: 383 GIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            IE R+LA  + +   ++AF + ED++  T A+ F    ++V+ +QR I KV+   + Y
Sbjct: 677 QIELRILAHYSDDPGLLQAFRDREDVHTRTAAETFGVAPEQVTPDQRRIAKVLNFGIAY 735


>gi|38233736|ref|NP_939503.1| DNA polymerase I [Corynebacterium diphtheriae NCTC 13129]
 gi|38199997|emb|CAE49666.1| DNA polymerase I [Corynebacterium diphtheriae]
          Length = 899

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (45%), Gaps = 26/151 (17%)

Query: 292 LNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE 351
           L+ L +AV  DGR+  T     AS TGR S      QN+P                    
Sbjct: 611 LDGLIKAVGDDGRIHTTFNQTVAS-TGRLSSTEPNLQNIP-------------------- 649

Query: 352 TIADPLGLASDCVRSCIIASNG-KKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYV 410
            +  P G     +RS  +   G K L+ AD + IE RV+A ++ +   I+A+  GED++ 
Sbjct: 650 -VRTPAGRK---IRSAFVVGQGYKSLLTADYSQIEMRVMAHLSEDPGLIEAYQTGEDLHN 705

Query: 411 TTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
              +K F+ P+D+V+ E R   K M   L Y
Sbjct: 706 FVGSKVFDVPVDQVTPELRRRVKAMSYGLVY 736


>gi|288870561|ref|ZP_06409803.1| DNA-directed DNA polymerase [Clostridium hathewayi DSM 13479]
 gi|288866720|gb|EFC99018.1| DNA-directed DNA polymerase [Clostridium hathewayi DSM 13479]
          Length = 653

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (55%)

Query: 365 RSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV 424
           RSC  A +G+KL++AD + IE RV A I+G+     A   GED++  T +   + P+ +V
Sbjct: 420 RSCFTAPDGRKLILADYSQIELRVAAQISGDSRMKSACQKGEDLHALTASLISSIPVSQV 479

Query: 425 SKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +K QR   K +   L +  GA+  K  A
Sbjct: 480 TKAQRQAAKAVNFGLIFGMGAEGLKQYA 507


>gi|153820094|ref|ZP_01972761.1| DNA polymerase I [Vibrio cholerae NCTC 8457]
 gi|126509364|gb|EAZ71958.1| DNA polymerase I [Vibrio cholerae NCTC 8457]
          Length = 851

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A +G K++  D + IE R++A ++G+   + AF +G+DI+  T A+    PID+
Sbjct: 611 IRQAFVAPHGWKIMAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIIGVPIDQ 670

Query: 424 VSKEQRAIGKVMELALGY 441
           VS EQR   K +   L Y
Sbjct: 671 VSSEQRRRAKAVNFGLIY 688


>gi|253698996|ref|YP_003020185.1| DNA polymerase I [Geobacter sp. M21]
 gi|251773846|gb|ACT16427.1| DNA polymerase I [Geobacter sp. M21]
          Length = 892

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 92/351 (26%), Positives = 148/351 (42%), Gaps = 58/351 (16%)

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRE 172
            LAL + +H        A +AR  K  ++    D  RA         G Y   D +AT  
Sbjct: 424 ALALEYLDHRMI---SYAEVARSGKCELNFSEVDLDRA---------GPYSCEDADATYL 471

Query: 173 LFKRLIP----------LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
           L + L+P          L D E  L  +   +   G ++D+DL+ +L     ++  +L+ 
Sbjct: 472 LHEILLPKVREQGMEELLFDLEMPLMRILADMELHGVKLDVDLMKELSTGFGKQLIELEA 531

Query: 223 DIVKLTDGI--IRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILN 280
            I +   G   I S +Q   L   LF   G+ +   ++G      +   + +LA++  + 
Sbjct: 532 QIHEHCGGPFNINSPKQ---LGEMLFERMGLAVGKKTKGKTGWSTNVEELERLAEEHEVA 588

Query: 281 RLASSGSAILKL-NTLSEAVS-----SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
           RL     +I KL +T ++A+      + GR+  +      + TGR S      QN+P   
Sbjct: 589 RLLLQYRSISKLKSTYTDALPKLVAPATGRVHTSYN-QAVTSTGRLSSSDPNLQNIPI-- 645

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
           R EE          RG             +R   IA  G  ++ AD + IE RVLA ++G
Sbjct: 646 RGEE---------GRG-------------IRRAFIAEPGSLMLSADYSQIELRVLAHLSG 683

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGA 445
           +    +AFA GEDI+  T ++ F    + V+ E R   KV+   + Y  GA
Sbjct: 684 DRVLCEAFAAGEDIHRRTASEVFGMFPELVTSEMRRQAKVINFGVIYGQGA 734


>gi|304388549|ref|ZP_07370650.1| DNA-directed DNA polymerase I [Neisseria meningitidis ATCC 13091]
 gi|304337469|gb|EFM03637.1| DNA-directed DNA polymerase I [Neisseria meningitidis ATCC 13091]
          Length = 975

 Score = 60.8 bits (146), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 104/245 (42%), Gaps = 38/245 (15%)

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTY------ALRMYLFLITGIDLVDMSEGTLKSILS 266
           +A++  +L  +++KL      ++ Q +       L+  LF   GI    + +     I +
Sbjct: 596 LARQSAELGAELMKLEQQAYAAADQPFNLNSPKQLQEILFDKMGIPTKGLKKTAKGGIST 655

Query: 267 HSNI-TQLAKDLILNRLASSGSAILKLNT-----LSEAVSS-DGRLRGTLQFYGASRTGR 319
           +  +  QLA D  L ++     ++ KL +     L E +S  DGR+  T      + TGR
Sbjct: 656 NEAVLEQLAPDYPLPKIILQNRSLAKLKSTYTDKLPEMISPKDGRVHTTYA-QAVAITGR 714

Query: 320 WSGCVFQPQNLPRQERSEEILTQTIQ