PSIBLAST alignment of GI: 254780127 and protein with PDB id: 1taq

>gi|157833899|pdb|1TAQ|A Chain A, Structure Of Taq Dna Polymerase Length = 832
 Score =  260 bits (663), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 84/606 (13%), Positives = 156/606 (25%), Gaps = 141/606 (23%)

Query: 76  ERILFKKTLGIDIPSKRWICTSVLARTNGLPSSL-KNACLALNFSEHLTKMEEGKALIAR 134
           +  +     G+ +P        +LA      ++  +                        
Sbjct: 355 DLSVLALREGLGLPPG--DDPMLLAYLLDPSNTTPEGVARRYG----------------- 395

Query: 135 FCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLSDGERDLWLLDQTI 194
                      + T     +A      +         E  + L    + ER L  +   +
Sbjct: 396 ----------GEWTEEAGERAALSERLFANLWGRLEGE-ERLLWLYREVERPLSAVLAHM 444

Query: 195 NDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID-- 252
              G R+D+  +  L   +A+E  +L+ ++ +L      +      L   LF   G+   
Sbjct: 445 EATGVRLDVAYLRALSLEVAEEIARLEAEVFRLAGHPF-NLNSRDQLERVLFDELGLPAI 503

Query: 253 --LVDMSE-GTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGT 308
                  +  T  ++L          + IL     +      ++ L + +    GRL   
Sbjct: 504 GKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTR 563

Query: 309 LQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCI 368
                A+ TGR   C    QN+P                                +R   
Sbjct: 564 FNQT-ATATGRLCCCDPNLQNIP------------------------VRTPLGQRIRRGF 598

Query: 369 IASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQ 428
           IA  G  LV  D + IE RVLA ++G++  I+ F  G DI+  T +  F  P + V    
Sbjct: 599 IAEEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLM 658

Query: 429 RAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQ 488
           R   K +   + Y   A           L +            F+ + +  +      ++
Sbjct: 659 RRAAKTINFGVLYGMSAHRLSQE-----LAIPYEEAQAFIERYFQSFPKVRAWIEKTLEE 713

Query: 489 YPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPR 548
                  + L G          R     +    K + E    +                 
Sbjct: 714 GRRRGYVETLFGR---------RRYVPDLEARVKSVREAAERMAFNMPVQGTAADL---- 760

Query: 549 LVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRD 608
                             +L    +      +                            
Sbjct: 761 -----------------MKLAMVKLFPRLEEMG--------------------------- 776

Query: 609 ILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTL-CSLMTKNPSWAKGLPLKAEG 667
                +                 +V E P     +V  L   +M      A  +PL+ E 
Sbjct: 777 --ARMLLQVHDE-----------LVLEAPKERAEAVARLAKEVMEGVYPLA--VPLEVEV 821

Query: 668 YEAKRY 673
              + +
Sbjct: 822 GIGEDW 827