PSIBLAST alignment of GI: 254780127 and protein with PDB id: 3hp6

>gi|299688922|pdb|3HP6|A Chain A, Crystal Structure Of Fragment Dna Polymerase I From Bacillus Stearothermophilus F710y Mutant Bound To G:t Mismatch Length = 580
>gi|299688923|pdb|3HP6|D Chain D, Crystal Structure Of Fragment Dna Polymerase I From Bacillus Stearothermophilus F710y Mutant Bound To G:t Mismatch Length = 580
 Score =  267 bits (683), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 91/673 (13%), Positives = 188/673 (27%), Gaps = 153/673 (22%)

Query: 26  EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRDETVMCVAHNSLFERI---LFKK 82
             A I   A   ++            A P   + +L DET       S+F+     +  K
Sbjct: 32  HDAPIVGIAV-VNEHGRFFLRPETALADP-QFVAWLGDETKKK----SMFDSKRAAVALK 85

Query: 83  TLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLTKMEEGK-ALIARFCKGSID 141
             GI++    +                      L               +         +
Sbjct: 86  WKGIELXGVSFD---------------LLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDE 130

Query: 142 SPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS----------DGERDLWLLD 191
           +      +        +  E+  R   A  EL +  +             + E+ L  + 
Sbjct: 131 AVYGKGAKRAVPDE-PVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSIL 189

Query: 192 QTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGI 251
             +   G ++D   + ++ + +A++   +++ I +L      +      L + LF    +
Sbjct: 190 AEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEF-NINSPKQLGVILFEKLQL 248

Query: 252 DLVDMSE---GTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGT 308
            ++  ++    T   +L          + IL+           +  L + V    +   T
Sbjct: 249 PVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHT 308

Query: 309 LQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCI 368
           +     ++TGR S      QN+P                                +R   
Sbjct: 309 IFNQALTQTGRLSSTEPNLQNIP------------------------IRLEEGRKIRQAF 344

Query: 369 IASN-GKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKE 427
           + S     +  AD + IE RVLA IA +D  ++AF    DI+  T    F    D+V+  
Sbjct: 345 VPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPN 404

Query: 428 QRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQD 487
            R   K +                    G+     +QN                      
Sbjct: 405 MRRQAKAVNY--------------GIVYGISDYGLAQN---------------------- 428

Query: 488 QYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVP 547
                     +         + +     GV +  +++ +           +         
Sbjct: 429 --------LNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLH-------- 472

Query: 548 RLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISR 607
                             RR    D+      + +   ++              +Q  + 
Sbjct: 473 ------------------RRRYLPDITSRNFNVRSFAERM---------AMNTPIQGSAA 505

Query: 608 DILCEGMKNA------TKNGYDIVLTVHDEIVSETPDTPYFSVGTLC-SLMTKNPSWAKG 660
           DI+ + M +        +    ++L VHDE++ E P      +  L   +M +  +    
Sbjct: 506 DIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVT--LR 563

Query: 661 LPLKAEGYEAKRY 673
           +PLK + +    +
Sbjct: 564 VPLKVDYHYGSTW 576